Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9W2M2

- TREA_DROME

UniProt

Q9W2M2 - TREA_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Trehalase

Gene

Treh

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Catalytic activityi

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei193 – 1931SubstrateBy similarity
Binding sitei237 – 2371SubstrateBy similarity
Binding sitei341 – 3411Substrate; via carbonyl oxygenBy similarity
Active sitei343 – 3431Proton donor/acceptorBy similarity
Active sitei541 – 5411Proton donor/acceptorBy similarity
Binding sitei556 – 5561SubstrateBy similarity

GO - Molecular functioni

  1. alpha,alpha-trehalase activity Source: FlyBase
  2. trehalase activity Source: FlyBase

GO - Biological processi

  1. trehalose metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

ReactomeiREACT_235382. Digestion of dietary carbohydrate.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

Names & Taxonomyi

Protein namesi
Recommended name:
Trehalase (EC:3.2.1.28)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene namesi
Name:Treh
ORF Names:CG9364
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0003748. Treh.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 596573TrehalasePRO_0000012058Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
Glycosylationi293 – 2931N-linked (GlcNAc...)Sequence Analysis
Glycosylationi359 – 3591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi451 – 4511N-linked (GlcNAc...)1 Publication
Glycosylationi516 – 5161N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9W2M2.
PRIDEiQ9W2M2.

Expressioni

Gene expression databases

BgeeiQ9W2M2.
ExpressionAtlasiQ9W2M2. differential.

Interactioni

Protein-protein interaction databases

BioGridi69627. 26 interactions.
DIPiDIP-23202N.
IntActiQ9W2M2. 6 interactions.
MINTiMINT-994217.

Structurei

3D structure databases

ProteinModelPortaliQ9W2M2.
SMRiQ9W2M2. Positions 59-574.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni200 – 2012Substrate bindingBy similarity
Regioni246 – 2483Substrate bindingBy similarity
Regioni307 – 3093Substrate bindingBy similarity

Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1626.
GeneTreeiENSGT00390000006949.
InParanoidiQ9W2M2.
KOiK01194.
OMAiQRSEAMY.
OrthoDBiEOG7P02H6.
PhylomeDBiQ9W2M2.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform C (identifier: Q9W2M2-1) [UniParc]FASTAAdd to Basket

Also known as: F

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFKLPTISLL LVSWSCLVAL SQAKTYSLPD LTTDYNNAIP VDEEEAQDPF
60 70 80 90 100
ASCKIYCEGN LLHTIQTAVP KLFADSKTFV DMKLNNSPDK TLEDFNAMME
110 120 130 140 150
AKNQTPSSED LKQFVDKYFS APGTELEKWT PTDWKENPSF LDLISDPDLK
160 170 180 190 200
QWGVELNSIW KDLGRKMKDE VSKNPEYYSI IPVPNPVIVP GGRFIEFYYW
210 220 230 240 250
DSYWIIRGLL YSQMFDTARG MIENFFSIVN RFGFIPNGGR VYYHGRSQPP
260 270 280 290 300
LLTGMVKSYV DFTNDDKFAI DALDTLEHEF EFFVNNHNVT VKNHSLCVYR
310 320 330 340 350
DSSSGPRPES YREDVETGEE FPTDEAKELH YSELKAGAES GMDFSSRWFI
360 370 380 390 400
SPTGTNDGNR SALSTTSIVP VDLNAYLYWN AKLIAEFHSK AGNTKKVTEY
410 420 430 440 450
ETKAEKLLLG IQEVLWNEEA GVWLDYDMIN QKPRDYYTPT NLSPLWVKAF
460 470 480 490 500
NISESEKISA SVMAYIERNK LDSFPGGVPN TLSYTGEQWD APNVWAPMQY
510 520 530 540 550
ILVEGLNNLN TPEAKNMSLK WATRWVKTNF AAFSKDRHMY EKYNADEFGV
560 570 580 590
GGGGGEYEVQ TGFGWSNGVI IEWLSKHGRD ISIGSGCGCL AGEKRQ

Note: No experimental confirmation available.

Length:596
Mass (Da):67,689
Last modified:May 1, 2000 - v1
Checksum:i600D03B2087929EC
GO
Isoform A (identifier: Q9W2M2-2) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MFKLPTISLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASC → MASPANPSSNHKMNGNG

Note: No experimental confirmation available.

Show »
Length:560
Mass (Da):63,552
Checksum:iAB9992F3BB522733
GO
Isoform B (identifier: Q9W2M2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Note: No experimental confirmation available.

Show »
Length:515
Mass (Da):58,722
Checksum:i1580AADE103A1E25
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8181Missing in isoform B. CuratedVSP_021831Add
BLAST
Alternative sequencei1 – 5353MFKLP…PFASC → MASPANPSSNHKMNGNG in isoform A. 1 PublicationVSP_007735Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF46668.1.
AE013599 Genomic DNA. Translation: AAF46669.1.
AE013599 Genomic DNA. Translation: AAM68192.1.
AY051466 mRNA. Translation: AAK92890.1.
RefSeqiNP_001261115.1. NM_001274186.1. [Q9W2M2-2]
NP_524821.1. NM_080082.3. [Q9W2M2-2]
NP_726023.1. NM_166421.2. [Q9W2M2-2]
NP_726024.1. NM_166422.2. [Q9W2M2-2]
NP_726025.1. NM_166423.3. [Q9W2M2-1]
NP_726026.1. NM_166424.2. [Q9W2M2-1]
NP_726027.1. NM_166425.2. [Q9W2M2-3]
UniGeneiDm.6686.

Genome annotation databases

EnsemblMetazoaiFBtr0071539; FBpp0071468; FBgn0003748. [Q9W2M2-1]
FBtr0071540; FBpp0071469; FBgn0003748. [Q9W2M2-1]
GeneIDi45368.
KEGGidme:Dmel_CG9364.
UCSCiCG9364-RA. d. melanogaster. [Q9W2M2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF46668.1 .
AE013599 Genomic DNA. Translation: AAF46669.1 .
AE013599 Genomic DNA. Translation: AAM68192.1 .
AY051466 mRNA. Translation: AAK92890.1 .
RefSeqi NP_001261115.1. NM_001274186.1. [Q9W2M2-2 ]
NP_524821.1. NM_080082.3. [Q9W2M2-2 ]
NP_726023.1. NM_166421.2. [Q9W2M2-2 ]
NP_726024.1. NM_166422.2. [Q9W2M2-2 ]
NP_726025.1. NM_166423.3. [Q9W2M2-1 ]
NP_726026.1. NM_166424.2. [Q9W2M2-1 ]
NP_726027.1. NM_166425.2. [Q9W2M2-3 ]
UniGenei Dm.6686.

3D structure databases

ProteinModelPortali Q9W2M2.
SMRi Q9W2M2. Positions 59-574.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 69627. 26 interactions.
DIPi DIP-23202N.
IntActi Q9W2M2. 6 interactions.
MINTi MINT-994217.

Protein family/group databases

CAZyi GH37. Glycoside Hydrolase Family 37.

Proteomic databases

PaxDbi Q9W2M2.
PRIDEi Q9W2M2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0071539 ; FBpp0071468 ; FBgn0003748 . [Q9W2M2-1 ]
FBtr0071540 ; FBpp0071469 ; FBgn0003748 . [Q9W2M2-1 ]
GeneIDi 45368.
KEGGi dme:Dmel_CG9364.
UCSCi CG9364-RA. d. melanogaster. [Q9W2M2-1 ]

Organism-specific databases

CTDi 11181.
FlyBasei FBgn0003748. Treh.

Phylogenomic databases

eggNOGi COG1626.
GeneTreei ENSGT00390000006949.
InParanoidi Q9W2M2.
KOi K01194.
OMAi QRSEAMY.
OrthoDBi EOG7P02H6.
PhylomeDBi Q9W2M2.

Enzyme and pathway databases

Reactomei REACT_235382. Digestion of dietary carbohydrate.

Miscellaneous databases

GenomeRNAii 45368.
NextBioi 838071.
PROi Q9W2M2.

Gene expression databases

Bgeei Q9W2M2.
ExpressionAtlasi Q9W2M2. differential.

Family and domain databases

InterProi IPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view ]
PANTHERi PTHR23403. PTHR23403. 1 hit.
Pfami PF01204. Trehalase. 1 hit.
[Graphical view ]
PRINTSi PR00744. GLHYDRLASE37.
SUPFAMi SSF48208. SSF48208. 1 hit.
PROSITEi PS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  2. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: Berkeley.
    Tissue: Head.
  4. "Identification of N-glycosylated proteins from the central nervous system of Drosophila melanogaster."
    Koles K., Lim J.-M., Aoki K., Porterfield M., Tiemeyer M., Wells L., Panin V.
    Glycobiology 17:1388-1403(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-451, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Oregon-R.
    Tissue: Head.

Entry informationi

Entry nameiTREA_DROME
AccessioniPrimary (citable) accession number: Q9W2M2
Secondary accession number(s): Q0E903
, Q0E904, Q7YWL2, Q961P0, Q9W2M1, Q9W2M3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: May 1, 2000
Last modified: November 26, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3