Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trehalase

Gene

Treh

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei193SubstrateBy similarity1
Binding sitei237SubstrateBy similarity1
Binding sitei341Substrate; via carbonyl oxygenBy similarity1
Active sitei343Proton donor/acceptorBy similarity1
Active sitei541Proton donor/acceptorBy similarity1
Binding sitei556SubstrateBy similarity1

GO - Molecular functioni

  • alpha,alpha-trehalase activity Source: FlyBase
  • trehalase activity Source: FlyBase

GO - Biological processi

  • neuronal stem cell population maintenance Source: FlyBase
  • trehalose catabolic process Source: GO_Central
  • trehalose metabolic process Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

Names & Taxonomyi

Protein namesi
Recommended name:
Trehalase (EC:3.2.1.28)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene namesi
Name:Treh
ORF Names:CG9364
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0003748. Treh.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001205824 – 596TrehalaseAdd BLAST573

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi288N-linked (GlcNAc...)Sequence analysis1
Glycosylationi293N-linked (GlcNAc...)Sequence analysis1
Glycosylationi359N-linked (GlcNAc...)Sequence analysis1
Glycosylationi451N-linked (GlcNAc...)1 Publication1
Glycosylationi516N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9W2M2.
PRIDEiQ9W2M2.

Expressioni

Gene expression databases

BgeeiFBgn0003748.
ExpressionAtlasiQ9W2M2. baseline.
GenevisibleiQ9W2M2. DM.

Interactioni

Protein-protein interaction databases

BioGridi69627. 26 interactors.
DIPiDIP-23202N.
IntActiQ9W2M2. 6 interactors.
MINTiMINT-994217.
STRINGi7227.FBpp0071468.

Structurei

3D structure databases

ProteinModelPortaliQ9W2M2.
SMRiQ9W2M2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni200 – 201Substrate bindingBy similarity2
Regioni246 – 248Substrate bindingBy similarity3
Regioni307 – 309Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0602. Eukaryota.
COG1626. LUCA.
GeneTreeiENSGT00390000006949.
InParanoidiQ9W2M2.
KOiK01194.
OMAiNQWDAPF.
OrthoDBiEOG091G0341.
PhylomeDBiQ9W2M2.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform C (identifier: Q9W2M2-1) [UniParc]FASTAAdd to basket
Also known as: F

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFKLPTISLL LVSWSCLVAL SQAKTYSLPD LTTDYNNAIP VDEEEAQDPF
60 70 80 90 100
ASCKIYCEGN LLHTIQTAVP KLFADSKTFV DMKLNNSPDK TLEDFNAMME
110 120 130 140 150
AKNQTPSSED LKQFVDKYFS APGTELEKWT PTDWKENPSF LDLISDPDLK
160 170 180 190 200
QWGVELNSIW KDLGRKMKDE VSKNPEYYSI IPVPNPVIVP GGRFIEFYYW
210 220 230 240 250
DSYWIIRGLL YSQMFDTARG MIENFFSIVN RFGFIPNGGR VYYHGRSQPP
260 270 280 290 300
LLTGMVKSYV DFTNDDKFAI DALDTLEHEF EFFVNNHNVT VKNHSLCVYR
310 320 330 340 350
DSSSGPRPES YREDVETGEE FPTDEAKELH YSELKAGAES GMDFSSRWFI
360 370 380 390 400
SPTGTNDGNR SALSTTSIVP VDLNAYLYWN AKLIAEFHSK AGNTKKVTEY
410 420 430 440 450
ETKAEKLLLG IQEVLWNEEA GVWLDYDMIN QKPRDYYTPT NLSPLWVKAF
460 470 480 490 500
NISESEKISA SVMAYIERNK LDSFPGGVPN TLSYTGEQWD APNVWAPMQY
510 520 530 540 550
ILVEGLNNLN TPEAKNMSLK WATRWVKTNF AAFSKDRHMY EKYNADEFGV
560 570 580 590
GGGGGEYEVQ TGFGWSNGVI IEWLSKHGRD ISIGSGCGCL AGEKRQ
Note: No experimental confirmation available.
Length:596
Mass (Da):67,689
Last modified:May 1, 2000 - v1
Checksum:i600D03B2087929EC
GO
Isoform A (identifier: Q9W2M2-2) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MFKLPTISLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASC → MASPANPSSNHKMNGNG

Note: No experimental confirmation available.
Show »
Length:560
Mass (Da):63,552
Checksum:iAB9992F3BB522733
GO
Isoform B (identifier: Q9W2M2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Note: No experimental confirmation available.
Show »
Length:515
Mass (Da):58,722
Checksum:i1580AADE103A1E25
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0218311 – 81Missing in isoform B. CuratedAdd BLAST81
Alternative sequenceiVSP_0077351 – 53MFKLP…PFASC → MASPANPSSNHKMNGNG in isoform A. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF46668.1.
AE013599 Genomic DNA. Translation: AAF46669.1.
AE013599 Genomic DNA. Translation: AAM68192.1.
AY051466 mRNA. Translation: AAK92890.1.
RefSeqiNP_001261115.1. NM_001274186.1. [Q9W2M2-2]
NP_524821.1. NM_080082.3. [Q9W2M2-2]
NP_726023.1. NM_166421.2. [Q9W2M2-2]
NP_726024.1. NM_166422.2. [Q9W2M2-2]
NP_726025.1. NM_166423.3. [Q9W2M2-1]
NP_726026.1. NM_166424.2. [Q9W2M2-1]
NP_726027.1. NM_166425.2. [Q9W2M2-3]
UniGeneiDm.6686.

Genome annotation databases

EnsemblMetazoaiFBtr0071539; FBpp0071468; FBgn0003748. [Q9W2M2-1]
FBtr0071540; FBpp0071469; FBgn0003748. [Q9W2M2-1]
GeneIDi45368.
KEGGidme:Dmel_CG9364.
UCSCiCG9364-RA. d. melanogaster. [Q9W2M2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF46668.1.
AE013599 Genomic DNA. Translation: AAF46669.1.
AE013599 Genomic DNA. Translation: AAM68192.1.
AY051466 mRNA. Translation: AAK92890.1.
RefSeqiNP_001261115.1. NM_001274186.1. [Q9W2M2-2]
NP_524821.1. NM_080082.3. [Q9W2M2-2]
NP_726023.1. NM_166421.2. [Q9W2M2-2]
NP_726024.1. NM_166422.2. [Q9W2M2-2]
NP_726025.1. NM_166423.3. [Q9W2M2-1]
NP_726026.1. NM_166424.2. [Q9W2M2-1]
NP_726027.1. NM_166425.2. [Q9W2M2-3]
UniGeneiDm.6686.

3D structure databases

ProteinModelPortaliQ9W2M2.
SMRiQ9W2M2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi69627. 26 interactors.
DIPiDIP-23202N.
IntActiQ9W2M2. 6 interactors.
MINTiMINT-994217.
STRINGi7227.FBpp0071468.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

Proteomic databases

PaxDbiQ9W2M2.
PRIDEiQ9W2M2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0071539; FBpp0071468; FBgn0003748. [Q9W2M2-1]
FBtr0071540; FBpp0071469; FBgn0003748. [Q9W2M2-1]
GeneIDi45368.
KEGGidme:Dmel_CG9364.
UCSCiCG9364-RA. d. melanogaster. [Q9W2M2-1]

Organism-specific databases

CTDi11181.
FlyBaseiFBgn0003748. Treh.

Phylogenomic databases

eggNOGiKOG0602. Eukaryota.
COG1626. LUCA.
GeneTreeiENSGT00390000006949.
InParanoidiQ9W2M2.
KOiK01194.
OMAiNQWDAPF.
OrthoDBiEOG091G0341.
PhylomeDBiQ9W2M2.

Miscellaneous databases

GenomeRNAii45368.
PROiQ9W2M2.

Gene expression databases

BgeeiFBgn0003748.
ExpressionAtlasiQ9W2M2. baseline.
GenevisibleiQ9W2M2. DM.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTREA_DROME
AccessioniPrimary (citable) accession number: Q9W2M2
Secondary accession number(s): Q0E903
, Q0E904, Q7YWL2, Q961P0, Q9W2M1, Q9W2M3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.