Reviewed,
UniProtKB/Swiss-Prot Q9W1K5 (SEST_DROME)
Last modified
September 2, 2008.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Putative sestrin | ||
| Gene names |
| ||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||
| Taxonomic identifier | 7227 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 497 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subcellular location | NucleusBy similarity. |
| Sequence similarities | Belongs to the sestrin family. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
Gene Ontology (GO) | |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Cyp4s3 | Q9VXY0 | 1 | EBI-212772,EBI-133844 | |
| Flo | O61491-1 | 1 | EBI-212772,EBI-212825 | |
| l(2)k10201 | Q9V574 | 1 | EBI-212772,EBI-154227 | |
| Pp2B-14D | Q27889 | 1 | EBI-212772,EBI-132663 | |
| tna | Q9VTB8 | 1 | EBI-212772,EBI-162797 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q9W1K5-1) Also known as: A; B; C; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q9W1K5-2) The sequence of this isoform differs from the canonical sequence as follows: 80-111: AAARHQCPYLVKRYEKEFINQGGDSAWLGGLD → SIFRLLFPTFISLPNWPKTIAIDWANEEHGLL 112-497: Missing. | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 3 (identifier: Q9W1K5-3) The sequence of this isoform differs from the canonical sequence as follows: 433-437: LLVRP → VRNQL 438-497: Missing. | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 497 | 497 | Putative sestrin | |||||
Amino acid modifications | ||||||||
| Modified residue | 185 | 1 | Phosphoserine | |||||
| Modified residue | 190 | 1 | Phosphoserine | |||||
Natural variations | ||||||||
| Alternative sequence | 80 – 111 | 32 | AAARH…LGGLD → SIFRLLFPTFISLPNWPKTI AIDWANEEHGLL in isoform 2. | |||||
| Alternative sequence | 112 – 497 | 386 | Missing in isoform 2. | |||||
| Alternative sequence | 433 – 437 | 5 | LLVRP → VRNQL in isoform 3. | |||||
| Alternative sequence | 438 – 497 | 60 | Missing in isoform 3. | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AE013599 Genomic DNA. Translation: AAF47053.2. AE013599 Genomic DNA. Translation: ABV53897.1. AE013599 Genomic DNA. Translation: ABV53898.1. AY069626 mRNA. Translation: AAL39771.1. | |
| RefSeq | NP_001097437.1. NP_001097438.1. NP_611821.1. |
| UniGene | Dm.2037 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:19601N. |
| IntAct | Q9W1K5. |
Genome annotation databases | |
| Ensembl | CG11299. Drosophila melanogaster. [Contig view] |
| GeneID | 37755. |
| KEGG | dme:Dmel_CG11299. |
| NMPDR | fig|7227.3.peg.7121. |
Organism-specific databases | |
| FlyBase | FBgn0034897. CG11299. |
Phylogenomic databases | |
| HOGENOM | Q9W1K5. |
Enzyme and pathway databases | |
| BioCyc | DMEL-XXX-02:DMEL-XXX-02-006283-MON. |
Gene expression databases | |
| ArrayExpress | Q9W1K5. |
| GermOnline | CG11299. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR006730. PA26. [Graphical view] |
| PANTHER | PTHR12474. PA26. 1 hit. |
| Pfam | PF04636. PA26. 1 hit. [Graphical view] |
| ProDom | Q9W1K5. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| ProtoNet | Search... |
Entry information
| Entry name | SEST_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9W1K5 Secondary accession number(s): A8DYN7, Q9I7V1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |
| Recent format changes Overview of recent format changes |

Clusters with


