Q9W1K5 (SESN_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sestrin homolog | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 497 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Nucleus By similarity. |
| Sequence similarities | Belongs to the sestrin family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle arrest Inferred from electronic annotation. Source: InterPro inter-male aggressive behaviorInferred from mutant phenotype PubMed 19519879. Source: FlyBase mitochondrion degradationInferred from mutant phenotype PubMed 20203043. Source: FlyBase multicellular organismal agingInferred from mutant phenotype PubMed 20203043. Source: FlyBase negative regulation of cell growthInferred from mutant phenotype PubMed 20203043. Source: FlyBase regulation of reactive oxygen species metabolic processInferred from mutant phenotype PubMed 20203043. Source: FlyBase |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Cyp4s3 | Q9VXY0 | 1 | EBI-212765,EBI-133844 | |
| Flo | O61491 | 1 | EBI-212765,EBI-212813 | |
| l(2)k10201 | Q9V574 | 1 | EBI-212765,EBI-154227 | |
| Pp2B-14D | Q27889 | 1 | EBI-212765,EBI-132663 | |
| tna | Q9VTB8 | 1 | EBI-212765,EBI-162797 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9W1K5-1) Also known as: A; B; C; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9W1K5-2) The sequence of this isoform differs from the canonical sequence as follows: 80-111: AAARHQCPYLVKRYEKEFINQGGDSAWLGGLD → SIFRLLFPTFISLPNWPKTIAIDWANEEHGLL 112-497: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9W1K5-3) The sequence of this isoform differs from the canonical sequence as follows: 433-437: LLVRP → VRNQL 438-497: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 497 | 497 | Sestrin homolog | PRO_0000221186 | |||||
Amino acid modifications | |||||||||
| Modified residue | 185 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 190 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 80 – 111 | 32 | AAARH…LGGLD → SIFRLLFPTFISLPNWPKTI AIDWANEEHGLL in isoform 2. | VSP_006065 | |||||
| Alternative sequence | 112 – 497 | 386 | Missing in isoform 2. | VSP_006066 | |||||
| Alternative sequence | 433 – 437 | 5 | LLVRP → VRNQL in isoform 3. | VSP_006067 | |||||
| Alternative sequence | 438 – 497 | 60 | Missing in isoform 3. | VSP_006068 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE013599 Genomic DNA. Translation: AAF47053.2. AE013599 Genomic DNA. Translation: ABV53897.1. AE013599 Genomic DNA. Translation: ABV53898.1. AY069626 mRNA. Translation: AAL39771.1. |
| RefSeq | NP_001097437.1. NM_001103967.1. NP_001097438.1. NM_001103968.1. NP_611821.1. NM_137977.3. |
| UniGene | Dm.2037. |
3D structure databases | |
| ProteinModelPortal | Q9W1K5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-19601N. |
| IntAct | Q9W1K5. 5 interactions. |
| MINT | MINT-343891. |
Proteomic databases | |
| PaxDb | Q9W1K5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0072087; FBpp0071996; FBgn0034897. FBtr0113113; FBpp0112026; FBgn0034897. FBtr0113114; FBpp0112027; FBgn0034897. |
| GeneID | 37755. |
| KEGG | dme:Dmel_CG11299. |
| UCSC | CG11299-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 37755. |
| FlyBase | FBgn0034897. Sesn. |
Phylogenomic databases | |
| eggNOG | NOG312456. |
| GeneTree | ENSGT00440000040103. |
| InParanoid | Q9W1K5. |
| KO | K10141. |
| OMA | WIISSSS. |
| OrthoDB | EOG4VQ84M. |
| PhylomeDB | Q9W1K5. |
Gene expression databases | |
| Bgee | Q9W1K5. |
| GermOnline | CG11299. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR006730. PA26. [Graphical view] |
| PANTHER | PTHR12474. PTHR12474. 1 hit. |
| Pfam | PF04636. PA26. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 37755. |
| NextBio | 805253. |
Entry information
| Entry name | SESN_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9W1K5 Secondary accession number(s): A8DYN7, Q9I7V1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
