Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9W0G1 (PTP61_DROME) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tyrosine-protein phosphatase non-receptor type 61F

EC=3.1.3.48
Alternative name(s):
dPTP61F
Gene names
Name:Ptp61F
ORF Names:CG9181
OrganismDrosophila melanogaster (Fruit fly) [Reference proteome]
Taxonomic identifier7227 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Protein attributes

Sequence length548 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Non-receptor protein tyrosine phosphatase required for maintaining Dock in its non-phosphorylated state. Ref.1 Ref.8

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.1

Subcellular location

Isoform A: Cytoplasm. Endomembrane system. Note: Associates with the membranes of the reticular network and the mitochondria. Ref.1

Isoform B: Nucleus Ref.1.

Tissue specificity

Expressed during oogenesis and embryogenesis. Isoform A and isoform B are expressed in distinct patterns. Isoform B is expressed in the mesoderm and neuroblast layer during germband extension and later in the gut epithelia. Isoform A accumulates in 16 segmentally repeated stripes in the ectoderm during germband extension. These stripes are flanked by, and adjacent to, the domains of engrailed and wingless gene expression in the anterior/posterior axis. In stage 10 embryos, isoform A colocalizes with the area lateral to the denticle belts that will give rise to naked cuticle. Isoform A is also expressed later in embryogenesis in the central nervous system. Ref.7

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.

Contains 1 tyrosine-protein phosphatase domain.

Ontologies

Keywords
   Cellular componentCytoplasm
Membrane
Nucleus
   Coding sequence diversityAlternative splicing
   Molecular functionHydrolase
Protein phosphatase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processaxon guidance

Inferred from physical interaction Ref.6. Source: FlyBase

cellular response to hypoxia

Inferred from mutant phenotype PubMed 18653470. Source: FlyBase

germ-band extension

Inferred from direct assay Ref.7. Source: UniProtKB

mitotic cell cycle

Inferred from mutant phenotype PubMed 17306545. Source: FlyBase

negative regulation of JAK-STAT cascade

Inferred from mutant phenotype PubMed 16094372. Source: FlyBase

negative regulation of cell proliferation

Inferred from mutant phenotype PubMed 23339871. Source: FlyBase

negative regulation of insulin receptor signaling pathway

Inferred from genetic interaction PubMed 21707536. Source: FlyBase

negative regulation of peptidyl-tyrosine phosphorylation

Inferred from mutant phenotype PubMed 17804420. Source: FlyBase

regulation of protein localization

Inferred from direct assay PubMed 17804420. Source: FlyBase

regulation of protein stability

Inferred from mutant phenotype PubMed 17804420. Source: FlyBase

   Cellular_componentendomembrane system

Inferred from electronic annotation. Source: UniProtKB-SubCell

membrane

Inferred from electronic annotation. Source: UniProtKB-KW

mitochondrial envelope

Inferred from direct assay Ref.1. Source: UniProtKB

nucleus

Inferred from direct assay Ref.1. Source: FlyBase

perinuclear region of cytoplasm

Inferred from direct assay PubMed 17804420. Source: FlyBase

   Molecular_functionprotein tyrosine phosphatase activity

Inferred from direct assay PubMed 21707536Ref.1. Source: FlyBase

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

dockQ242186EBI-74714,EBI-74727

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform A Ref.1 (identifier: Q9W0G1-1)

Also known as: Cytoplasmic; DPTP61Fm;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B Ref.1 (identifier: Q9W0G1-2)

Also known as: Nuclear; DPTP61Fn;

The sequence of this isoform differs from the canonical sequence as follows:
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK
Isoform C Ref.3 (identifier: Q9W0G1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFY → MTKFAQRSKKTCEIRGTMDVCVCVCVSMW
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 548548Tyrosine-protein phosphatase non-receptor type 61F
PRO_0000094853

Regions

Domain33 – 296264Tyrosine-protein phosphatase
Region237 – 2437Substrate binding By similarity

Sites

Active site2371Phosphocysteine intermediate By similarity UniProtKB P18031
Binding site2031Substrate By similarity
Binding site2811Substrate By similarity

Amino acid modifications

Modified residue831Phosphoserine Ref.9
Modified residue861Phosphotyrosine Ref.9

Natural variations

Alternative sequence1 – 3434MSEQK…WHRFY → MTKFAQRSKKTCEIRGTMDV CVCVCVSMW in isoform C. Ref.3
VSP_050733
Alternative sequence525 – 54824SLLTY…YTKLG → RGNRLKKSKTK in isoform B and isoform C. Ref.1
VSP_050259

Experimental info

Sequence conflict2741S → T Ref.1
Sequence conflict2741S → T Ref.2
Sequence conflict3821I → F in AAA75348. Ref.1
Sequence conflict3821I → F in AAA75349. Ref.1
Sequence conflict3821I → F in AAA75338. Ref.1
Sequence conflict3821I → F in AAA75339. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform A (Cytoplasmic) (DPTP61Fm) [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: C6AF630E2DE3F11C

FASTA54862,105
        10         20         30         40         50         60 
MSEQKTSGSG SAAAARLQIE AEYKDKGPQW HRFYKEICET CDREAKEKQF STSESERHTN 

        70         80         90        100        110        120 
RGLNRYRDVN PYDHSRIVLK RGSVDYINAN LVQLERAERQ YILTQGPLVD TVGHFWLMVW 

       130        140        150        160        170        180 
EQKSRAVLML NKLMEKKQIK CHLYWPNEMG ADKALKLPHV KLTVELVRLE TYQNFVRRWF 

       190        200        210        220        230        240 
KLTDLETQQS REVMQFHYTT WPDFGIPSSP NAFLKFLQQV RDSGCLSRDV GPAVVHCSAG 

       250        260        270        280        290        300 
IGRSGTFCLV DCCLVLIDKY GECNVSKVLC ELRSYRMGLI QTADQLDFSY QAIIEGIKKL 

       310        320        330        340        350        360 
HDPTFLDAEE PLISNDTETH TLDELPPPLP PRVQSLNLPL APNSGGILSL NMRAAQANGA 

       370        380        390        400        410        420 
ESIGKELSKD ALNNFINQHD MIHDAEVADS RPLPPLPVRA FNDSDSDEDY LLDDDDEDDT 

       430        440        450        460        470        480 
DEDEEYETIN EHDADPVNGH VPATTQPHAD DVNANNEKPA VPVDEQHKAN GIDPIPGQLP 

       490        500        510        520        530        540 
ASPENELKRR KRNEYQASLE QKVNDMKRKQ RENEDKQLAA KKRRSLLTYI AAGVVVGVIC 


AYAYTKLG 

« Hide

Isoform B (Nuclear) (DPTP61Fn) [UniParc].

Checksum: D80C8CD1AC99AF60
Show »

FASTA53560,974
Isoform C [UniParc].

Checksum: 1EF64FCDF6AA177E
Show »

FASTA53060,487

References

« Hide 'large scale' references
[1]"Alternative splicing gives rise to a nuclear protein tyrosine phosphatase in Drosophila."
McLaughlin S., Dixon J.E.
J. Biol. Chem. 268:6839-6842(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), FUNCTION, SUBCELLULAR LOCATION.
Strain: Canton-S.
Tissue: Head.
[2]"Identification of a Drosophila protein tyrosine phosphatase expressed in a pattern of segmental stripes in the germ band extended embryo."
Kung T.Y., Tian S.S., Zinn K.
Submitted (APR-1993) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM A).
[3]"The genome sequence of Drosophila melanogaster."
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. expand/collapse author list , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[4]"Annotation of the Drosophila melanogaster euchromatic genome: a systematic review."
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. expand/collapse author list , Drysdale R.A., Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
Strain: Berkeley.
[5]"A Drosophila full-length cDNA resource."
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E.
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
Strain: Berkeley.
Tissue: Larva and Pupae.
[6]"A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance."
Clemens J.C., Ursuliak Z., Clemens K.K., Price J.V., Dixon J.E.
J. Biol. Chem. 271:17002-17005(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH DOCK.
[7]"Differential accumulation of DPTP61F alternative transcripts: regulation of a protein tyrosine phosphatase by segmentation genes."
Ursuliak Z., Clemens J.C., Dixon J.E., Price J.V.
Mech. Dev. 65:19-30(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[8]"Use of double-stranded RNA-mediated interference to determine the substrates of protein tyrosine kinases and phosphatases."
Muda M., Worby C.A., Simonson-Leff N., Clemens J.C., Dixon J.E.
Biochem. J. 366:73-77(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[9]"Phosphoproteome analysis of Drosophila melanogaster embryos."
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83 AND TYR-86, MASS SPECTROMETRY.
Tissue: Embryo.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L11250, L11249 Genomic DNA. Translation: AAA75348.1.
L11251, L11249, L11250 Genomic DNA. Translation: AAA75349.1.
L11252 mRNA. Translation: AAA75338.1.
L11253 mRNA. Translation: AAA75339.1.
L14849 mRNA. Translation: AAA28748.1.
AE014296 Genomic DNA. Translation: AAF47486.1.
AE014296 Genomic DNA. Translation: AAF47487.1.
AE014296 Genomic DNA. Translation: AAN11475.1.
AY069713 mRNA. Translation: AAL39858.1.
PIRA46101.
B46101.
RefSeqNP_476687.1. NM_057339.4.
NP_476688.1. NM_057340.3.
NP_728600.1. NM_167874.2.
UniGeneDm.1991.

3D structure databases

ProteinModelPortalQ9W0G1.
SMRQ9W0G1. Positions 17-418.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid63702. 6 interactions.
IntActQ9W0G1. 5 interactions.
MINTMINT-823894.

Proteomic databases

PaxDbQ9W0G1.
PRIDEQ9W0G1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaFBtr0072718; FBpp0072602; FBgn0003138.
GeneID38160.
KEGGdme:Dmel_CG9181.

Organism-specific databases

CTD38160.
FlyBaseFBgn0003138. Ptp61F.

Phylogenomic databases

eggNOGCOG5599.
GeneTreeENSGT00740000114913.
InParanoidQ9W0G1.
KOK05696.
OMAFCLVDCC.
OrthoDBEOG7RV9G4.
PhylomeDBQ9W0G1.

Gene expression databases

BgeeQ9W0G1.

Family and domain databases

InterProIPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSPR00700. PRTYPHPHTASE.
SMARTSM00194. PTPc. 1 hit.
[Graphical view]
PROSITEPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi38160.
NextBio807270.
PROQ9W0G1.

Entry information

Entry namePTP61_DROME
AccessionPrimary (citable) accession number: Q9W0G1
Secondary accession number(s): Q27932, Q8SZY3, Q9W0G2
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 1, 2000
Last modified: March 19, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Drosophila

Drosophila: entries, gene names and cross-references to FlyBase