Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9W0G1

- PTP61_DROME

UniProt

Q9W0G1 - PTP61_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tyrosine-protein phosphatase non-receptor type 61F

Gene

Ptp61F

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Non-receptor protein tyrosine phosphatase required for maintaining Dock in its non-phosphorylated state.2 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.1 PublicationPROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei203 – 2031SubstrateBy similarity
Active sitei237 – 2371Phosphocysteine intermediateBy similarityPROSITE-ProRule annotation
Binding sitei281 – 2811SubstrateBy similarity

GO - Molecular functioni

  1. protein tyrosine phosphatase activity Source: FlyBase

GO - Biological processi

  1. axon guidance Source: FlyBase
  2. cellular response to hypoxia Source: FlyBase
  3. germ-band extension Source: UniProtKB
  4. mitotic cell cycle Source: FlyBase
  5. negative regulation of cell proliferation Source: FlyBase
  6. negative regulation of insulin receptor signaling pathway Source: FlyBase
  7. negative regulation of JAK-STAT cascade Source: FlyBase
  8. negative regulation of peptidyl-tyrosine phosphorylation Source: FlyBase
  9. peptidyl-tyrosine dephosphorylation Source: FlyBase
  10. protein dephosphorylation Source: FlyBase
  11. regulation of protein localization Source: FlyBase
  12. regulation of protein stability Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 61F (EC:3.1.3.48)
Alternative name(s):
dPTP61F
Gene namesi
Name:Ptp61F
ORF Names:CG9181
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0003138. Ptp61F.

Subcellular locationi

Isoform A : Cytoplasm. Endomembrane system
Note: Associates with the membranes of the reticular network and the mitochondria.

GO - Cellular componenti

  1. cytoplasm Source: FlyBase
  2. membrane Source: UniProtKB-KW
  3. mitochondrial envelope Source: UniProtKB
  4. nucleus Source: FlyBase
  5. perinuclear region of cytoplasm Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 548548Tyrosine-protein phosphatase non-receptor type 61FPRO_0000094853Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei83 – 831Phosphoserine1 Publication
Modified residuei86 – 861Phosphotyrosine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9W0G1.
PRIDEiQ9W0G1.

Expressioni

Tissue specificityi

Expressed during oogenesis and embryogenesis. Isoform A and isoform B are expressed in distinct patterns. Isoform B is expressed in the mesoderm and neuroblast layer during germband extension and later in the gut epithelia. Isoform A accumulates in 16 segmentally repeated stripes in the ectoderm during germband extension. These stripes are flanked by, and adjacent to, the domains of engrailed and wingless gene expression in the anterior/posterior axis. In stage 10 embryos, isoform A colocalizes with the area lateral to the denticle belts that will give rise to naked cuticle. Isoform A is also expressed later in embryogenesis in the central nervous system.1 Publication

Gene expression databases

BgeeiQ9W0G1.
ExpressionAtlasiQ9W0G1. differential.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
dockQ242186EBI-74714,EBI-74727

Protein-protein interaction databases

BioGridi63702. 6 interactions.
IntActiQ9W0G1. 5 interactions.
MINTiMINT-823894.

Structurei

3D structure databases

ProteinModelPortaliQ9W0G1.
SMRiQ9W0G1. Positions 13-352.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 296264Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni237 – 2437Substrate bindingBy similarity

Sequence similaritiesi

Contains 1 tyrosine-protein phosphatase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5599.
GeneTreeiENSGT00760000118836.
InParanoidiQ9W0G1.
KOiK05696.
OMAiFCLVDCC.
OrthoDBiEOG7RV9G4.
PhylomeDBiQ9W0G1.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00194. PTPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A1 Publication (identifier: Q9W0G1-1) [UniParc]FASTAAdd to Basket

Also known as: Cytoplasmic1 Publication

, DPTP61Fm

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQKTSGSG SAAAARLQIE AEYKDKGPQW HRFYKEICET CDREAKEKQF
60 70 80 90 100
STSESERHTN RGLNRYRDVN PYDHSRIVLK RGSVDYINAN LVQLERAERQ
110 120 130 140 150
YILTQGPLVD TVGHFWLMVW EQKSRAVLML NKLMEKKQIK CHLYWPNEMG
160 170 180 190 200
ADKALKLPHV KLTVELVRLE TYQNFVRRWF KLTDLETQQS REVMQFHYTT
210 220 230 240 250
WPDFGIPSSP NAFLKFLQQV RDSGCLSRDV GPAVVHCSAG IGRSGTFCLV
260 270 280 290 300
DCCLVLIDKY GECNVSKVLC ELRSYRMGLI QTADQLDFSY QAIIEGIKKL
310 320 330 340 350
HDPTFLDAEE PLISNDTETH TLDELPPPLP PRVQSLNLPL APNSGGILSL
360 370 380 390 400
NMRAAQANGA ESIGKELSKD ALNNFINQHD MIHDAEVADS RPLPPLPVRA
410 420 430 440 450
FNDSDSDEDY LLDDDDEDDT DEDEEYETIN EHDADPVNGH VPATTQPHAD
460 470 480 490 500
DVNANNEKPA VPVDEQHKAN GIDPIPGQLP ASPENELKRR KRNEYQASLE
510 520 530 540
QKVNDMKRKQ RENEDKQLAA KKRRSLLTYI AAGVVVGVIC AYAYTKLG
Length:548
Mass (Da):62,105
Last modified:May 1, 2000 - v1
Checksum:iC6AF630E2DE3F11C
GO
Isoform B1 Publication (identifier: Q9W0G1-2) [UniParc]FASTAAdd to Basket

Also known as: Nuclear1 Publication

, DPTP61Fn

The sequence of this isoform differs from the canonical sequence as follows:
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK

Show »
Length:535
Mass (Da):60,974
Checksum:iD80C8CD1AC99AF60
GO
Isoform C1 Publication (identifier: Q9W0G1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFY → MTKFAQRSKKTCEIRGTMDVCVCVCVSMW
     525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK

Note: No experimental confirmation available.Curated

Show »
Length:530
Mass (Da):60,487
Checksum:i1EF64FCDF6AA177E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti274 – 2741S → T(PubMed:8463208)Curated
Sequence conflicti274 – 2741S → T1 PublicationCurated
Sequence conflicti382 – 3821I → F in AAA75348. (PubMed:8463208)Curated
Sequence conflicti382 – 3821I → F in AAA75349. (PubMed:8463208)Curated
Sequence conflicti382 – 3821I → F in AAA75338. (PubMed:8463208)Curated
Sequence conflicti382 – 3821I → F in AAA75339. (PubMed:8463208)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MSEQK…WHRFY → MTKFAQRSKKTCEIRGTMDV CVCVCVSMW in isoform C. 2 PublicationsVSP_050733Add
BLAST
Alternative sequencei525 – 54824SLLTY…YTKLG → RGNRLKKSKTK in isoform B and isoform C. 2 PublicationsVSP_050259Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L11250, L11249 Genomic DNA. Translation: AAA75348.1.
L11251, L11249, L11250 Genomic DNA. Translation: AAA75349.1.
L11252 mRNA. Translation: AAA75338.1.
L11253 mRNA. Translation: AAA75339.1.
L14849 mRNA. Translation: AAA28748.1.
AE014296 Genomic DNA. Translation: AAF47486.1.
AE014296 Genomic DNA. Translation: AAF47487.1.
AE014296 Genomic DNA. Translation: AAN11475.1.
AY069713 mRNA. Translation: AAL39858.1.
PIRiA46101.
B46101.
RefSeqiNP_476687.1. NM_057339.5. [Q9W0G1-1]
NP_476688.1. NM_057340.4. [Q9W0G1-2]
NP_728600.1. NM_167874.2. [Q9W0G1-3]
UniGeneiDm.1991.

Genome annotation databases

EnsemblMetazoaiFBtr0072718; FBpp0072602; FBgn0003138. [Q9W0G1-1]
GeneIDi38160.
KEGGidme:Dmel_CG9181.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L11250 , L11249 Genomic DNA. Translation: AAA75348.1 .
L11251 , L11249 , L11250 Genomic DNA. Translation: AAA75349.1 .
L11252 mRNA. Translation: AAA75338.1 .
L11253 mRNA. Translation: AAA75339.1 .
L14849 mRNA. Translation: AAA28748.1 .
AE014296 Genomic DNA. Translation: AAF47486.1 .
AE014296 Genomic DNA. Translation: AAF47487.1 .
AE014296 Genomic DNA. Translation: AAN11475.1 .
AY069713 mRNA. Translation: AAL39858.1 .
PIRi A46101.
B46101.
RefSeqi NP_476687.1. NM_057339.5. [Q9W0G1-1 ]
NP_476688.1. NM_057340.4. [Q9W0G1-2 ]
NP_728600.1. NM_167874.2. [Q9W0G1-3 ]
UniGenei Dm.1991.

3D structure databases

ProteinModelPortali Q9W0G1.
SMRi Q9W0G1. Positions 13-352.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 63702. 6 interactions.
IntActi Q9W0G1. 5 interactions.
MINTi MINT-823894.

Proteomic databases

PaxDbi Q9W0G1.
PRIDEi Q9W0G1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0072718 ; FBpp0072602 ; FBgn0003138 . [Q9W0G1-1 ]
GeneIDi 38160.
KEGGi dme:Dmel_CG9181.

Organism-specific databases

CTDi 38160.
FlyBasei FBgn0003138. Ptp61F.

Phylogenomic databases

eggNOGi COG5599.
GeneTreei ENSGT00760000118836.
InParanoidi Q9W0G1.
KOi K05696.
OMAi FCLVDCC.
OrthoDBi EOG7RV9G4.
PhylomeDBi Q9W0G1.

Miscellaneous databases

GenomeRNAii 38160.
NextBioi 807270.
PROi Q9W0G1.

Gene expression databases

Bgeei Q9W0G1.
ExpressionAtlasi Q9W0G1. differential.

Family and domain databases

Gene3Di 3.90.190.10. 1 hit.
InterProi IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00102. Y_phosphatase. 1 hit.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
SMARTi SM00194. PTPc. 1 hit.
[Graphical view ]
SUPFAMi SSF52799. SSF52799. 1 hit.
PROSITEi PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Alternative splicing gives rise to a nuclear protein tyrosine phosphatase in Drosophila."
    McLaughlin S., Dixon J.E.
    J. Biol. Chem. 268:6839-6842(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), FUNCTION, SUBCELLULAR LOCATION.
    Strain: Canton-S1 Publication.
    Tissue: Head1 Publication.
  2. "Identification of a Drosophila protein tyrosine phosphatase expressed in a pattern of segmental stripes in the germ band extended embryo."
    Kung T.Y., Tian S.S., Zinn K.
    Submitted (APR-1993) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM A).
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley1 Publication.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
    Strain: Berkeley1 Publication.
    Tissue: Larva1 Publication and Pupae1 Publication.
  6. "A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance."
    Clemens J.C., Ursuliak Z., Clemens K.K., Price J.V., Dixon J.E.
    J. Biol. Chem. 271:17002-17005(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DOCK.
  7. "Differential accumulation of DPTP61F alternative transcripts: regulation of a protein tyrosine phosphatase by segmentation genes."
    Ursuliak Z., Clemens J.C., Dixon J.E., Price J.V.
    Mech. Dev. 65:19-30(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Use of double-stranded RNA-mediated interference to determine the substrates of protein tyrosine kinases and phosphatases."
    Muda M., Worby C.A., Simonson-Leff N., Clemens J.C., Dixon J.E.
    Biochem. J. 366:73-77(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Phosphoproteome analysis of Drosophila melanogaster embryos."
    Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
    J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83 AND TYR-86, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiPTP61_DROME
AccessioniPrimary (citable) accession number: Q9W0G1
Secondary accession number(s): Q27932, Q8SZY3, Q9W0G2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 1, 2000
Last modified: October 29, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3