Q9W0G1 (PTP61_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 61F EC=3.1.3.48 Alternative name(s): dPTP61F | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 548 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Non-receptor protein tyrosine phosphatase required for maintaining Dock in its non-phosphorylated state. Ref.1 Ref.8 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.1 |
| Subcellular location | Isoform A: Cytoplasm. Endomembrane system. Note: Associates with the membranes of the reticular network and the mitochondria. Ref.1 |
| Tissue specificity | Expressed during oogenesis and embryogenesis. Isoform A and isoform B are expressed in distinct patterns. Isoform B is expressed in the mesoderm and neuroblast layer during germband extension and later in the gut epithelia. Isoform A accumulates in 16 segmentally repeated stripes in the ectoderm during germband extension. These stripes are flanked by, and adjacent to, the domains of engrailed and wingless gene expression in the anterior/posterior axis. In stage 10 embryos, isoform A colocalizes with the area lateral to the denticle belts that will give rise to naked cuticle. Isoform A is also expressed later in embryogenesis in the central nervous system. Ref.7 |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| dock | Q24218 | 6 | EBI-74714,EBI-74727 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A Ref.1 (identifier: Q9W0G1-1) Also known as: Cytoplasmic; DPTP61Fm; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B Ref.1 (identifier: Q9W0G1-2) Also known as: Nuclear; DPTP61Fn; The sequence of this isoform differs from the canonical sequence as follows: 525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK | ||||||
| Isoform C Ref.3 (identifier: Q9W0G1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFY → MTKFAQRSKKTCEIRGTMDVCVCVCVSMW 525-548: SLLTYIAAGVVVGVICAYAYTKLG → RGNRLKKSKTK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 548 | 548 | Tyrosine-protein phosphatase non-receptor type 61F | PRO_0000094853 | |||||
Regions | |||||||||
| Domain | 33 – 296 | 264 | Tyrosine-protein phosphatase | ||||||
| Region | 237 – 243 | 7 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 237 | 1 | Phosphocysteine intermediate By similarity UniProtKB P18031 | ||||||
| Binding site | 203 | 1 | Substrate By similarity | ||||||
| Binding site | 281 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 83 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 86 | 1 | Phosphotyrosine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 34 | 34 | MSEQK…WHRFY → MTKFAQRSKKTCEIRGTMDV CVCVCVSMW in isoform C. Ref.3 | VSP_050733 | |||||
| Alternative sequence | 525 – 548 | 24 | SLLTY…YTKLG → RGNRLKKSKTK in isoform B and isoform C. Ref.1 | VSP_050259 | |||||
Experimental info | |||||||||
| Sequence conflict | 274 | 1 | S → T Ref.1 | ||||||
| Sequence conflict | 274 | 1 | S → T Ref.2 | ||||||
| Sequence conflict | 382 | 1 | I → F in AAA75348. Ref.1 | ||||||
| Sequence conflict | 382 | 1 | I → F in AAA75349. Ref.1 | ||||||
| Sequence conflict | 382 | 1 | I → F in AAA75338. Ref.1 | ||||||
| Sequence conflict | 382 | 1 | I → F in AAA75339. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Alternative splicing gives rise to a nuclear protein tyrosine phosphatase in Drosophila." McLaughlin S., Dixon J.E. J. Biol. Chem. 268:6839-6842(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS A AND B), FUNCTION, SUBCELLULAR LOCATION. Strain: Canton-S. Tissue: Head. |
| [2] | "Identification of a Drosophila protein tyrosine phosphatase expressed in a pattern of segmental stripes in the germ band extended embryo." Kung T.Y., Tian S.S., Zinn K. Submitted (APR-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM A). |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Strain: Berkeley. Tissue: Larva and Pupae. |
| [6] | "A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance." Clemens J.C., Ursuliak Z., Clemens K.K., Price J.V., Dixon J.E. J. Biol. Chem. 271:17002-17005(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DOCK. |
| [7] | "Differential accumulation of DPTP61F alternative transcripts: regulation of a protein tyrosine phosphatase by segmentation genes." Ursuliak Z., Clemens J.C., Dixon J.E., Price J.V. Mech. Dev. 65:19-30(1997) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "Use of double-stranded RNA-mediated interference to determine the substrates of protein tyrosine kinases and phosphatases." Muda M., Worby C.A., Simonson-Leff N., Clemens J.C., Dixon J.E. Biochem. J. 366:73-77(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83 AND TYR-86, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L11250, L11249 Genomic DNA. Translation: AAA75348.1. L11251, L11249, L11250 Genomic DNA. Translation: AAA75349.1. L11252 mRNA. Translation: AAA75338.1. L11253 mRNA. Translation: AAA75339.1. L14849 mRNA. Translation: AAA28748.1. AE014296 Genomic DNA. Translation: AAF47486.1. AE014296 Genomic DNA. Translation: AAF47487.1. AE014296 Genomic DNA. Translation: AAN11475.1. AY069713 mRNA. Translation: AAL39858.1. |
| PIR | A46101. B46101. |
| RefSeq | NP_476687.1. NM_057339.4. NP_476688.1. NM_057340.3. NP_728600.1. NM_167874.2. |
| UniGene | Dm.1991. |
3D structure databases | |
| ProteinModelPortal | Q9W0G1. |
| SMR | Q9W0G1. Positions 13-352. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9W0G1. 5 interactions. |
| MINT | MINT-823894. |
Proteomic databases | |
| PaxDb | Q9W0G1. |
| PRIDE | Q9W0G1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0072718; FBpp0072602; FBgn0003138. |
| GeneID | 38160. |
| KEGG | dme:Dmel_CG9181. |
Organism-specific databases | |
| CTD | 38160. |
| FlyBase | FBgn0003138. Ptp61F. |
Phylogenomic databases | |
| eggNOG | COG5599. |
| GeneTree | ENSGT00700000104092. |
| InParanoid | Q9W0G1. |
| KO | K05696. |
| OMA | FCLVDCC. |
| OrthoDB | EOG43J9MB. |
| PhylomeDB | Q9W0G1. |
Gene expression databases | |
| Bgee | Q9W0G1. |
| GermOnline | CG9181. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] |
| Pfam | PF00102. Y_phosphatase. 1 hit. [Graphical view] |
| PRINTS | PR00700. PRTYPHPHTASE. |
| SMART | SM00194. PTPc. 1 hit. [Graphical view] |
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 38160. |
| NextBio | 807270. |
Entry information
| Entry name | PTP61_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9W0G1 Secondary accession number(s): Q27932, Q8SZY3, Q9W0G2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
