Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9VWH4

- IDH3A_DROME

UniProt

Q9VWH4 - IDH3A_DROME

Protein

Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial

Gene

l(1)G0156

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    Isocitrate + NAD+ = 2-oxoglutarate + CO2 + NADH.By similarity

    Cofactori

    Binds 1 magnesium or manganese ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei131 – 1311SubstrateBy similarity
    Binding sitei141 – 1411SubstrateBy similarity
    Binding sitei162 – 1621SubstrateBy similarity
    Sitei169 – 1691Critical for catalysisBy similarity
    Sitei216 – 2161Critical for catalysisBy similarity
    Metal bindingi249 – 2491Magnesium or manganeseBy similarity
    Binding sitei249 – 2491SubstrateBy similarity
    Metal bindingi273 – 2731Magnesium or manganeseBy similarity
    Metal bindingi277 – 2771Magnesium or manganeseBy similarity

    GO - Molecular functioni

    1. isocitrate dehydrogenase (NAD+) activity Source: UniProtKB
    2. magnesium ion binding Source: InterPro
    3. NAD binding Source: InterPro

    GO - Biological processi

    1. tricarboxylic acid cycle Source: UniProtKB

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Tricarboxylic acid cycle

    Keywords - Ligandi

    Magnesium, Manganese, Metal-binding, NAD

    Enzyme and pathway databases

    ReactomeiREACT_218888. Citric acid cycle (TCA cycle).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (EC:1.1.1.41)
    Alternative name(s):
    Isocitric dehydrogenase subunit alpha
    NAD(+)-specific ICDH subunit alpha
    Gene namesi
    Name:l(1)G0156
    ORF Names:CG12233
    OrganismiDrosophila melanogaster (Fruit fly)Imported
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome X

    Organism-specific databases

    FlyBaseiFBgn0027291. l(1)G0156.

    Subcellular locationi

    Mitochondrion By similarity

    GO - Cellular componenti

    1. lipid particle Source: FlyBase
    2. microtubule associated complex Source: FlyBase
    3. mitochondrion Source: UniProtKB

    Keywords - Cellular componenti

    Mitochondrion

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini? – 377Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrialPRO_0000014442
    Transit peptidei1 – ?MitochondrionCurated

    Proteomic databases

    PaxDbiQ9VWH4.
    PRIDEiQ9VWH4.

    Expressioni

    Gene expression databases

    BgeeiQ9VWH4.

    Interactioni

    Subunit structurei

    Heterooligomer of subunits alpha, beta, and gamma in the apparent ratio of 2:1:1.By similarity

    Protein-protein interaction databases

    BioGridi59242. 81 interactions.
    MINTiMINT-898629.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9VWH4.
    SMRiQ9VWH4. Positions 50-377.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0473.
    InParanoidiQ9VWH4.
    KOiK00030.
    OMAiLIDNMCM.
    OrthoDBiEOG75B85R.
    PhylomeDBiQ9VWH4.

    Family and domain databases

    Gene3Di3.40.718.10. 1 hit.
    InterProiIPR019818. IsoCit/isopropylmalate_DH_CS.
    IPR001804. Isocitrate/isopropylmalate_DH.
    IPR004434. Isocitrate_DH_NAD.
    IPR024084. IsoPropMal-DH-like_dom.
    [Graphical view]
    PANTHERiPTHR11835. PTHR11835. 1 hit.
    PfamiPF00180. Iso_dh. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00175. mito_nad_idh. 1 hit.
    PROSITEiPS00470. IDH_IMDH. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform D (identifier: Q9VWH4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAARFIQKIL NQLGLIAARD APAVTATPAV SQVNATPAAS RSYSSGTKKV    50
    TLIPGDGIGP EISAAVQKIF TAANVPIEWE AVDVTPVRGP DGKFGIPQAA 100
    IDSVNTNKIG LKGPLMTPVG KGHRSLNLAL RKEFNLYANV RPCRSLEGYK 150
    TLYDDVDVVT IRENTEGEYS GIEHEIVDGV VQSIKLITEE ASKRVAEYAF 200
    QYAKNNNRKK VTVVHKANIM RMSDGLFLRC VRDMAQKFPE IQFEEKYLDT 250
    VCLNMVQNPG KYDVLVMPNL YGDILSDMCA GLVGGLGLTP SGNMGLNGAL 300
    FESVHGTAPD IAGKDLANPT ALLLSAVMML RHMELNTYAD KIERAAFETI 350
    KEGKYLTGDL GGRAKCSEFT NEICAKL 377

    Note: No experimental confirmation available.

    Length:377
    Mass (Da):40,844
    Last modified:May 1, 2000 - v1
    Checksum:iFB3F30905B8939B3
    GO
    Isoform A1 Publication (identifier: Q9VWH4-2) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MAARFIQKILNQLGLIAARDAPAVTATPAVSQ → MAARFIQKI

    Note: No experimental confirmation available.Curated

    Show »
    Length:354
    Mass (Da):38,584
    Checksum:i64426D3BE3983BB4
    GO

    Sequence cautioni

    The sequence AAL90367.1 differs from that shown. Reason: Frameshift at position 205.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232MAARF…PAVSQ → MAARFIQKI in isoform A. 2 PublicationsVSP_050698Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE014298 Genomic DNA. Translation: AAF48965.2.
    AE014298 Genomic DNA. Translation: AAN09496.1.
    AE014298 Genomic DNA. Translation: AGB95545.1.
    AY089629 mRNA. Translation: AAL90367.1. Frameshift.
    BT125839 mRNA. Translation: ADR83724.2.
    RefSeqiNP_001259705.1. NM_001272776.1. [Q9VWH4-1]
    NP_573388.1. NM_133160.2. [Q9VWH4-2]
    NP_728257.2. NM_167657.3. [Q9VWH4-2]
    UniGeneiDm.222.

    Genome annotation databases

    GeneIDi32940.
    KEGGidme:Dmel_CG12233.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE014298 Genomic DNA. Translation: AAF48965.2 .
    AE014298 Genomic DNA. Translation: AAN09496.1 .
    AE014298 Genomic DNA. Translation: AGB95545.1 .
    AY089629 mRNA. Translation: AAL90367.1 . Frameshift.
    BT125839 mRNA. Translation: ADR83724.2 .
    RefSeqi NP_001259705.1. NM_001272776.1. [Q9VWH4-1 ]
    NP_573388.1. NM_133160.2. [Q9VWH4-2 ]
    NP_728257.2. NM_167657.3. [Q9VWH4-2 ]
    UniGenei Dm.222.

    3D structure databases

    ProteinModelPortali Q9VWH4.
    SMRi Q9VWH4. Positions 50-377.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 59242. 81 interactions.
    MINTi MINT-898629.

    Proteomic databases

    PaxDbi Q9VWH4.
    PRIDEi Q9VWH4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 32940.
    KEGGi dme:Dmel_CG12233.

    Organism-specific databases

    FlyBasei FBgn0027291. l(1)G0156.

    Phylogenomic databases

    eggNOGi COG0473.
    InParanoidi Q9VWH4.
    KOi K00030.
    OMAi LIDNMCM.
    OrthoDBi EOG75B85R.
    PhylomeDBi Q9VWH4.

    Enzyme and pathway databases

    Reactomei REACT_218888. Citric acid cycle (TCA cycle).

    Miscellaneous databases

    GenomeRNAii 32940.
    NextBioi 781145.
    PROi Q9VWH4.

    Gene expression databases

    Bgeei Q9VWH4.

    Family and domain databases

    Gene3Di 3.40.718.10. 1 hit.
    InterProi IPR019818. IsoCit/isopropylmalate_DH_CS.
    IPR001804. Isocitrate/isopropylmalate_DH.
    IPR004434. Isocitrate_DH_NAD.
    IPR024084. IsoPropMal-DH-like_dom.
    [Graphical view ]
    PANTHERi PTHR11835. PTHR11835. 1 hit.
    Pfami PF00180. Iso_dh. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00175. mito_nad_idh. 1 hit.
    PROSITEi PS00470. IDH_IMDH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley1 Publication.
    2. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Strain: Berkeley1 Publication.
      Tissue: Embryo1 Publication.
    4. Carlson J., Booth B., Frise E., Park S., Wan K., Yu C., Hoskins R., Svirskas R., Rubin G., Celniker S.
      Submitted (AUG-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D).
      Strain: Berkeley.
      Tissue: Larva and Pupae.

    Entry informationi

    Entry nameiIDH3A_DROME
    AccessioniPrimary (citable) accession number: Q9VWH4
    Secondary accession number(s): E4NKP2, Q8IQW9, Q8SXH8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 13, 2004
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3