Reviewed,
UniProtKB/Swiss-Prot Q9VWH4 (IDH3A_DROME)
Last modified
February 9, 2010.
Version 66.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial EC=1.1.1.41 Alternative name(s): Isocitric dehydrogenase subunit alpha NAD(+)-specific ICDH subunit alpha | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 377 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | Isocitrate + NAD+ = 2-oxoglutarate + CO2 + NADH. UniProtKB P56471 |
| Cofactor | Binds 1 magnesium or manganese ion per subunit By similarity. |
| Subunit structure | Heterooligomer of subunits alpha, beta, and gamma in the apparent ratio of 2:1:1 By similarity. UniProtKB P56471 |
| Subcellular location | Mitochondrion By similarity UniProtKB P56471. |
| Sequence similarities | Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
| Sequence caution | The sequence AAL90367.1 differs from that shown. Reason: Frameshift at position 205. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Tricarboxylic acid cycle |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Ligand | Magnesium Manganese Metal-binding NAD |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | oxidation reduction Inferred from electronic annotation. Source: UniProtKB-KW tricarboxylic acid cycleInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | lipid particle Inferred from direct assay. Source: FlyBase mitochondrionInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | NAD or NADH binding Inferred from electronic annotation. Source: InterPro isocitrate dehydrogenase (NAD+) activityInferred from sequence or structural similarity. Source: UniProtKB magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B Ref.1 (identifier: Q9VWH4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform A Ref.1 (identifier: Q9VWH4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MAARFIQKILNQLGLIAARDAPAVTATPAVSQ → MAARFIQKI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – ? | Mitochondrion Potential | |||||||
| Chain | ? – 377 | Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial | PRO_0000014442 | ||||||
Sites | |||||||||
| Metal binding | 249 | 1 | Magnesium or manganese By similarity | ||||||
| Metal binding | 273 | 1 | Magnesium or manganese By similarity | ||||||
| Metal binding | 277 | 1 | Magnesium or manganese By similarity | ||||||
| Binding site | 131 | 1 | Substrate By similarity | ||||||
| Binding site | 141 | 1 | Substrate By similarity | ||||||
| Binding site | 162 | 1 | Substrate By similarity | ||||||
| Binding site | 249 | 1 | Substrate By similarity | ||||||
| Site | 169 | 1 | Critical for catalysis By similarity | ||||||
| Site | 216 | 1 | Critical for catalysis By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 32 | 32 | MAARF…PAVSQ → MAARFIQKI in isoform A. Ref.1 | VSP_050698 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE014298 Genomic DNA. Translation: AAF48965.1. AE014298 Genomic DNA. Translation: AAN09496.1. AY089629 mRNA. Translation: AAL90367.1. Frameshift. |
| RefSeq | NP_573388.1. NP_728257.1. |
| UniGene | Dm.222 |
3D structure databases | |
| SMR | Q9VWH4. Positions 41-377. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9VWH4. 4 interactions. |
| STRING | Q9VWH4. |
Proteomic databases | |
| PRIDE | Q9VWH4. |
Genome annotation databases | |
| Ensembl | FBtr0074780; FBpp0074549; FBgn0027291; Drosophila melanogaster. [Genome view] FBtr0074781; FBpp0074550; FBgn0027291; Drosophila melanogaster. [Genome view] |
| GeneID | 32940. |
| KEGG | dme:Dmel_CG12233. |
| NMPDR | fig|7227.3.peg.18632. |
Organism-specific databases | |
| FlyBase | FBgn0027291. l(1)G0156. |
Phylogenomic databases | |
| eggNOG | inNOG04170. |
| InParanoid | Q9VWH4. |
| OMA | ANIGKRY. |
| OrthoDB | EOG9HHP8V. |
| PhylomeDB | Q9VWH4. |
Enzyme and pathway databases | |
| BioCyc | DMEL-XXX-02:DMEL-XXX-02-002607-MONOMER. |
| BRENDA | 1.1.1.41. 48. |
Gene expression databases | |
| ArrayExpress | Q9VWH4. |
| Bgee | Q9VWH4. |
| GermOnline | CG12233. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR019818. IsoCit/isopropylmalate_DH_CS. IPR001804. Isocitrate/isopropylmalate_DH. IPR004434. Isocitrate_DH_NAD_mit. [Graphical view] |
| Gene3D | G3DSA:3.40.718.10. IDH_IMDH. 1 hit. |
| PANTHER | PTHR11835. IDH_IMDH_dimeric. 1 hit. |
| Pfam | PF00180. Iso_dh. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00175. mito_nad_idh. 1 hit. |
| PROSITE | PS00470. IDH_IMDH. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 781145. |
Entry information
| Entry name | IDH3A_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9VWH4 Secondary accession number(s): Q8IQW9, Q8SXH8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with


