Q9VBP9 (NPL4_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear protein localization protein 4 homolog | ||
| Gene names |
| ||
| Organism | Drosophila melanogaster (Fruit fly) | ||
| Taxonomic identifier | 7227 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 652 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome By similarity. |
| Pathway | Protein degradation; proteasomal ubiquitin-dependent pathway. |
| Sequence similarities | Belongs to the NPL4 family. Contains 1 RanBP2-type zinc finger. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9VBP9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B (identifier: Q9VBP9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MACAPLLLEQFIYKKRNFAYAFVRHRLFVLCKQS → MPNDKI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 652 | 652 | Nuclear protein localization protein 4 homolog | PRO_0000372853 | |||||
Regions | |||||||||
| Zinc finger | 625 – 652 | 28 | RanBP2-type | ||||||
Amino acid modifications | |||||||||
| Modified residue | 114 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 117 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 138 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 34 | 34 | MACAP…LCKQS → MPNDKI in isoform B. | VSP_037209 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [2] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [3] | Stapleton M., Carlson J.W., Frise E., Kapadia B., Park S., Wan K.H., Yu C., Celniker S.E. Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: Berkeley. Tissue: Head. |
| [4] | "Identification and characterization of a Drosophila proteasome regulatory network." Lundgren J., Masson P., Mirzaei Z., Young P. Mol. Cell. Biol. 25:4662-4675(2005) [PubMed: 15899868] [Abstract] Cited for: IDENTIFICATION. |
| [5] | "An integrated chemical, mass spectrometric and computational strategy for (quantitative) phosphoproteomics: application to Drosophila melanogaster Kc167 cells." Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D., Juenger M.A., Eng J.K., Aebersold R., Tao W.A. Mol. Biosyst. 3:275-286(2007) [PubMed: 17372656] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-138, MASS SPECTROMETRY. |
| [6] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed: 18327897] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-114; SER-115 AND THR-117, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE014297 Genomic DNA. Translation: AAF56480.3. AE014297 Genomic DNA. Translation: AAN14058.2. AY058286 mRNA. Translation: AAL13515.1. |
| RefSeq | NP_001163731.1. NM_001170260.1. NP_651407.3. NM_143150.4. NP_733110.2. NM_170231.2. |
| UniGene | Dm.4324. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1Q5W based on UniProtKB Q9ES54. |
| ProteinModelPortal | Q9VBP9. |
| SMR | Q9VBP9. Positions 32-103, 626-652. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9VBP9. 17 interactions. |
| MINT | MINT-1565061. |
| STRING | Q9VBP9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0084893; FBpp0084267; FBgn0039348. |
| GeneID | 43091. |
| KEGG | dme:Dmel_CG4673. |
| UCSC | CG4673-RA. d. melanogaster. |
Organism-specific databases | |
| FlyBase | FBgn0039348. CG4673. |
Phylogenomic databases | |
| eggNOG | inNOG08956. |
| GeneTree | EMGT00050000008511. |
| InParanoid | Q9VBP9. |
| OMA | MCRLSPD. |
| OrthoDB | EOG4BG7B0. |
| PhylomeDB | Q9VBP9. |
Gene expression databases | |
| ArrayExpress | Q9VBP9. |
| Bgee | Q9VBP9. |
Family and domain databases | |
| InterPro | IPR007717. NPL4. IPR024682. Npl4_Ub-like_dom. IPR007716. NPL4_Zn-bd_put. IPR016563. PolyUb_recognition_cplx_Npl4. IPR001876. Znf_RanBP2. [Graphical view] |
| KO | K14015. |
| Pfam | PF05021. NPL4. 1 hit. PF11543. UN_NPL4. 1 hit. PF05020. zf-NPL4. 1 hit. [Graphical view] |
| PIRSF | PIRSF010052. Polyub_prc_Npl4. 1 hit. |
| SMART | SM00547. ZnF_RBZ. 1 hit. [Graphical view] |
| PROSITE | PS01358. ZF_RANBP2_1. 1 hit. PS50199. ZF_RANBP2_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 832165. |
Entry information
| Entry name | NPL4_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9VBP9 Secondary accession number(s): Q8IMS6, Q95U63 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with