Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9V7S5

- PICO_DROME

UniProt

Q9V7S5 - PICO_DROME

Protein

Putative inorganic phosphate cotransporter

Gene

Picot

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be an inorganic phosphate cotransporter.

    GO - Molecular functioni

    1. phosphate ion transmembrane transporter activity Source: InterPro
    2. symporter activity Source: UniProtKB-KW

    GO - Biological processi

    1. sodium ion transport Source: UniProtKB-KW

    Keywords - Biological processi

    Ion transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Protein family/group databases

    TCDBi2.A.1.14.34. the major facilitator superfamily (mfs).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative inorganic phosphate cotransporter
    Gene namesi
    Name:Picot
    ORF Names:CG8098
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome 2R

    Organism-specific databases

    FlyBaseiFBgn0024315. Picot.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 529529Putative inorganic phosphate cotransporterPRO_0000220946Add
    BLAST

    Proteomic databases

    PaxDbiQ9V7S5.
    PRIDEiQ9V7S5.

    Expressioni

    Gene expression databases

    BgeeiQ9V7S5.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CG1602Q9V4M91EBI-246284,EBI-134974

    Protein-protein interaction databases

    BioGridi62577. 5 interactions.
    DIPiDIP-22400N.
    MINTiMINT-801314.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9V7S5.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei37 – 5721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei110 – 13021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei148 – 16821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei202 – 22221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei232 – 25221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei338 – 35821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei429 – 44921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei466 – 48621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0477.
    GeneTreeiENSGT00630000089608.
    InParanoidiQ9V7S5.
    OMAiKQVLRFS.
    OrthoDBiEOG789C9Z.
    PhylomeDBiQ9V7S5.

    Family and domain databases

    InterProiIPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR004745. Pi_cotranspt.
    [Graphical view]
    PfamiPF07690. MFS_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF103473. SSF103473. 2 hits.
    TIGRFAMsiTIGR00894. 2A0114euk. 1 hit.
    PROSITEiPS50850. MFS. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform B (identifier: Q9V7S5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPFRRSSLNH RHRDGHVLVW NQRNLHESLE QQPQRCFATR YFVTFMLFLG    50
    MANAYVMRTN MSVAIVAMVN HTAIKSGEAE EYDDECGDRD IPIDDSQDGE 100
    FAWSSALQGY ILSSFFYGYV ITQIPFGILA KKYGSLRFLG YGMLINSVFA 150
    FLVPVAARGG GVWGLCAVRF IQGLGEGPIV PCTHAMLAKW IPPNERSRMG 200
    AAVYAGAQFG TIISMPLSGL LAEYGFDGGW PSIFYVFGIV GTVWSIAFLI 250
    FVHEDPSSHP TIDEREKKYI NDSLWGTDVV KSPPIPFKAI IKSLPFYAIL 300
    FAHMGHNYGY ETLMTELPTY MKQVLRFSLK SNGLLSSLPY LAMWLFSMFI 350
    SVVADWMISS KRFSHTATRK LINSIGQYGP GVALIAASYT GCDRALTLAI 400
    LTIGVGLNGG IYSGFKINHL DLTPRFAGFL MSITNCSANL AGLLAPIAAG 450
    HLISDPSKPM MGQWQIVFFI AAFVYIICGT FYNIFGSGER QYWDNPEDDE 500
    QKPALQTTVT TSPARLSNGS TAPAAISSS 529
    Length:529
    Mass (Da):58,372
    Last modified:May 1, 2000 - v1
    Checksum:i07B89A52D5081EFB
    GO
    Isoform A (identifier: Q9V7S5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQR → MSASKEAICGSTEKDLEKPALG

    Note: No experimental confirmation available.

    Show »
    Length:516
    Mass (Da):56,278
    Checksum:iB7657ECFE020BED8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MPFRR…QQPQR → MSASKEAICGSTEKDLEKPA LG in isoform A. CuratedVSP_007009Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE013599 Genomic DNA. Translation: AAF57968.1.
    AE013599 Genomic DNA. Translation: AAF57969.1.
    AY069501 mRNA. Translation: AAL39646.1.
    AF022713 Genomic DNA. Translation: AAD09148.1.
    RefSeqiNP_611146.1. NM_137302.2. [Q9V7S5-2]
    NP_725600.1. NM_166187.1. [Q9V7S5-1]
    UniGeneiDm.657.

    Genome annotation databases

    EnsemblMetazoaiFBtr0087115; FBpp0086261; FBgn0024315. [Q9V7S5-1]
    GeneIDi36865.
    KEGGidme:Dmel_CG8098.
    UCSCiCG8098-RA. d. melanogaster. [Q9V7S5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AE013599 Genomic DNA. Translation: AAF57968.1 .
    AE013599 Genomic DNA. Translation: AAF57969.1 .
    AY069501 mRNA. Translation: AAL39646.1 .
    AF022713 Genomic DNA. Translation: AAD09148.1 .
    RefSeqi NP_611146.1. NM_137302.2. [Q9V7S5-2 ]
    NP_725600.1. NM_166187.1. [Q9V7S5-1 ]
    UniGenei Dm.657.

    3D structure databases

    ProteinModelPortali Q9V7S5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 62577. 5 interactions.
    DIPi DIP-22400N.
    MINTi MINT-801314.

    Protein family/group databases

    TCDBi 2.A.1.14.34. the major facilitator superfamily (mfs).

    Proteomic databases

    PaxDbi Q9V7S5.
    PRIDEi Q9V7S5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai FBtr0087115 ; FBpp0086261 ; FBgn0024315 . [Q9V7S5-1 ]
    GeneIDi 36865.
    KEGGi dme:Dmel_CG8098.
    UCSCi CG8098-RA. d. melanogaster. [Q9V7S5-1 ]

    Organism-specific databases

    CTDi 36865.
    FlyBasei FBgn0024315. Picot.

    Phylogenomic databases

    eggNOGi COG0477.
    GeneTreei ENSGT00630000089608.
    InParanoidi Q9V7S5.
    OMAi KQVLRFS.
    OrthoDBi EOG789C9Z.
    PhylomeDBi Q9V7S5.

    Miscellaneous databases

    GenomeRNAii 36865.
    NextBioi 800790.

    Gene expression databases

    Bgeei Q9V7S5.

    Family and domain databases

    InterProi IPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR004745. Pi_cotranspt.
    [Graphical view ]
    Pfami PF07690. MFS_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF103473. SSF103473. 2 hits.
    TIGRFAMsi TIGR00894. 2A0114euk. 1 hit.
    PROSITEi PS50850. MFS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    2. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
      Strain: Berkeley.
      Tissue: Embryo.
    4. Da Lage J.-L.
      Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE OF 449-529.
      Strain: Canton-S.

    Entry informationi

    Entry nameiPICO_DROME
    AccessioniPrimary (citable) accession number: Q9V7S5
    Secondary accession number(s): O61364, Q8T077, Q9V7S6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 28, 2003
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3