SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9V7S5

- PICO_DROME

UniProt

Q9V7S5 - PICO_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative inorganic phosphate cotransporter

Gene
Picot, CG8098
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

May be an inorganic phosphate cotransporter.

GO - Molecular functioni

  1. phosphate ion transmembrane transporter activity Source: InterPro
  2. symporter activity Source: UniProtKB-KW

GO - Biological processi

  1. sodium ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.1.14.34. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Putative inorganic phosphate cotransporter
Gene namesi
Name:Picot
ORF Names:CG8098
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0024315. Picot.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei37 – 5721Helical; Reviewed predictionAdd
BLAST
Transmembranei110 – 13021Helical; Reviewed predictionAdd
BLAST
Transmembranei148 – 16821Helical; Reviewed predictionAdd
BLAST
Transmembranei202 – 22221Helical; Reviewed predictionAdd
BLAST
Transmembranei232 – 25221Helical; Reviewed predictionAdd
BLAST
Transmembranei338 – 35821Helical; Reviewed predictionAdd
BLAST
Transmembranei429 – 44921Helical; Reviewed predictionAdd
BLAST
Transmembranei466 – 48621Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 529529Putative inorganic phosphate cotransporterPRO_0000220946Add
BLAST

Proteomic databases

PaxDbiQ9V7S5.
PRIDEiQ9V7S5.

Expressioni

Gene expression databases

BgeeiQ9V7S5.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CG1602Q9V4M91EBI-246284,EBI-134974

Protein-protein interaction databases

BioGridi62577. 5 interactions.
DIPiDIP-22400N.
MINTiMINT-801314.

Structurei

3D structure databases

ProteinModelPortaliQ9V7S5.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0477.
GeneTreeiENSGT00630000089608.
InParanoidiQ9V7S5.
OMAiKQVLRFS.
OrthoDBiEOG789C9Z.
PhylomeDBiQ9V7S5.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004745. Pi_cotranspt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00894. 2A0114euk. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform B (identifier: Q9V7S5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPFRRSSLNH RHRDGHVLVW NQRNLHESLE QQPQRCFATR YFVTFMLFLG    50
MANAYVMRTN MSVAIVAMVN HTAIKSGEAE EYDDECGDRD IPIDDSQDGE 100
FAWSSALQGY ILSSFFYGYV ITQIPFGILA KKYGSLRFLG YGMLINSVFA 150
FLVPVAARGG GVWGLCAVRF IQGLGEGPIV PCTHAMLAKW IPPNERSRMG 200
AAVYAGAQFG TIISMPLSGL LAEYGFDGGW PSIFYVFGIV GTVWSIAFLI 250
FVHEDPSSHP TIDEREKKYI NDSLWGTDVV KSPPIPFKAI IKSLPFYAIL 300
FAHMGHNYGY ETLMTELPTY MKQVLRFSLK SNGLLSSLPY LAMWLFSMFI 350
SVVADWMISS KRFSHTATRK LINSIGQYGP GVALIAASYT GCDRALTLAI 400
LTIGVGLNGG IYSGFKINHL DLTPRFAGFL MSITNCSANL AGLLAPIAAG 450
HLISDPSKPM MGQWQIVFFI AAFVYIICGT FYNIFGSGER QYWDNPEDDE 500
QKPALQTTVT TSPARLSNGS TAPAAISSS 529
Length:529
Mass (Da):58,372
Last modified:May 1, 2000 - v1
Checksum:i07B89A52D5081EFB
GO
Isoform A (identifier: Q9V7S5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQR → MSASKEAICGSTEKDLEKPALG

Note: No experimental confirmation available.

Show »
Length:516
Mass (Da):56,278
Checksum:iB7657ECFE020BED8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MPFRR…QQPQR → MSASKEAICGSTEKDLEKPA LG in isoform A. VSP_007009Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AE013599 Genomic DNA. Translation: AAF57968.1.
AE013599 Genomic DNA. Translation: AAF57969.1.
AY069501 mRNA. Translation: AAL39646.1.
AF022713 Genomic DNA. Translation: AAD09148.1.
RefSeqiNP_611146.1. NM_137302.2. [Q9V7S5-2]
NP_725600.1. NM_166187.1. [Q9V7S5-1]
UniGeneiDm.657.

Genome annotation databases

EnsemblMetazoaiFBtr0087115; FBpp0086261; FBgn0024315. [Q9V7S5-1]
GeneIDi36865.
KEGGidme:Dmel_CG8098.
UCSCiCG8098-RA. d. melanogaster. [Q9V7S5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AE013599 Genomic DNA. Translation: AAF57968.1 .
AE013599 Genomic DNA. Translation: AAF57969.1 .
AY069501 mRNA. Translation: AAL39646.1 .
AF022713 Genomic DNA. Translation: AAD09148.1 .
RefSeqi NP_611146.1. NM_137302.2. [Q9V7S5-2 ]
NP_725600.1. NM_166187.1. [Q9V7S5-1 ]
UniGenei Dm.657.

3D structure databases

ProteinModelPortali Q9V7S5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 62577. 5 interactions.
DIPi DIP-22400N.
MINTi MINT-801314.

Protein family/group databases

TCDBi 2.A.1.14.34. the major facilitator superfamily (mfs).

Proteomic databases

PaxDbi Q9V7S5.
PRIDEi Q9V7S5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0087115 ; FBpp0086261 ; FBgn0024315 . [Q9V7S5-1 ]
GeneIDi 36865.
KEGGi dme:Dmel_CG8098.
UCSCi CG8098-RA. d. melanogaster. [Q9V7S5-1 ]

Organism-specific databases

CTDi 36865.
FlyBasei FBgn0024315. Picot.

Phylogenomic databases

eggNOGi COG0477.
GeneTreei ENSGT00630000089608.
InParanoidi Q9V7S5.
OMAi KQVLRFS.
OrthoDBi EOG789C9Z.
PhylomeDBi Q9V7S5.

Miscellaneous databases

GenomeRNAii 36865.
NextBioi 800790.

Gene expression databases

Bgeei Q9V7S5.

Family and domain databases

InterProi IPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004745. Pi_cotranspt.
[Graphical view ]
Pfami PF07690. MFS_1. 1 hit.
[Graphical view ]
SUPFAMi SSF103473. SSF103473. 2 hits.
TIGRFAMsi TIGR00894. 2A0114euk. 1 hit.
PROSITEi PS50850. MFS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  2. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
    Strain: Berkeley.
    Tissue: Embryo.
  4. Da Lage J.-L.
    Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE OF 449-529.
    Strain: Canton-S.

Entry informationi

Entry nameiPICO_DROME
AccessioniPrimary (citable) accession number: Q9V7S5
Secondary accession number(s): O61364, Q8T077, Q9V7S6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi