Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9V7S5 (PICO_DROME) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 93. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative inorganic phosphate cotransporter
Gene names
Name:Picot
ORF Names:CG8098
OrganismDrosophila melanogaster (Fruit fly) [Reference proteome]
Taxonomic identifier7227 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Protein attributes

Sequence length529 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be an inorganic phosphate cotransporter.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the major facilitator superfamily. Sodium/anion cotransporter family.

Ontologies

Keywords
   Biological processIon transport
Sodium transport
Symport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandSodium
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processsodium ion transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionphosphate ion transmembrane transporter activity

Inferred from electronic annotation. Source: InterPro

symporter activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CG1602Q9V4M91EBI-246284,EBI-134974

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform B (identifier: Q9V7S5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform A (identifier: Q9V7S5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQR → MSASKEAICGSTEKDLEKPALG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 529529Putative inorganic phosphate cotransporter
PRO_0000220946

Regions

Transmembrane37 – 5721Helical; Potential
Transmembrane110 – 13021Helical; Potential
Transmembrane148 – 16821Helical; Potential
Transmembrane202 – 22221Helical; Potential
Transmembrane232 – 25221Helical; Potential
Transmembrane338 – 35821Helical; Potential
Transmembrane429 – 44921Helical; Potential
Transmembrane466 – 48621Helical; Potential

Natural variations

Alternative sequence1 – 3535MPFRR…QQPQR → MSASKEAICGSTEKDLEKPA LG in isoform A.
VSP_007009

Sequences

Sequence LengthMass (Da)Tools
Isoform B [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 07B89A52D5081EFB

FASTA52958,372
        10         20         30         40         50         60 
MPFRRSSLNH RHRDGHVLVW NQRNLHESLE QQPQRCFATR YFVTFMLFLG MANAYVMRTN 

        70         80         90        100        110        120 
MSVAIVAMVN HTAIKSGEAE EYDDECGDRD IPIDDSQDGE FAWSSALQGY ILSSFFYGYV 

       130        140        150        160        170        180 
ITQIPFGILA KKYGSLRFLG YGMLINSVFA FLVPVAARGG GVWGLCAVRF IQGLGEGPIV 

       190        200        210        220        230        240 
PCTHAMLAKW IPPNERSRMG AAVYAGAQFG TIISMPLSGL LAEYGFDGGW PSIFYVFGIV 

       250        260        270        280        290        300 
GTVWSIAFLI FVHEDPSSHP TIDEREKKYI NDSLWGTDVV KSPPIPFKAI IKSLPFYAIL 

       310        320        330        340        350        360 
FAHMGHNYGY ETLMTELPTY MKQVLRFSLK SNGLLSSLPY LAMWLFSMFI SVVADWMISS 

       370        380        390        400        410        420 
KRFSHTATRK LINSIGQYGP GVALIAASYT GCDRALTLAI LTIGVGLNGG IYSGFKINHL 

       430        440        450        460        470        480 
DLTPRFAGFL MSITNCSANL AGLLAPIAAG HLISDPSKPM MGQWQIVFFI AAFVYIICGT 

       490        500        510        520 
FYNIFGSGER QYWDNPEDDE QKPALQTTVT TSPARLSNGS TAPAAISSS 

« Hide

Isoform A [UniParc].

Checksum: B7657ECFE020BED8
Show »

FASTA51656,278

References

« Hide 'large scale' references
[1]"The genome sequence of Drosophila melanogaster."
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. expand/collapse author list , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[2]"Annotation of the Drosophila melanogaster euchromatic genome: a systematic review."
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. expand/collapse author list , Drysdale R.A., Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
Strain: Berkeley.
[3]"A Drosophila full-length cDNA resource."
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E.
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
Strain: Berkeley.
Tissue: Embryo.
[4]Da Lage J.-L.
Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE OF 449-529.
Strain: Canton-S.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AE013599 Genomic DNA. Translation: AAF57968.1.
AE013599 Genomic DNA. Translation: AAF57969.1.
AY069501 mRNA. Translation: AAL39646.1.
AF022713 Genomic DNA. Translation: AAD09148.1.
RefSeqNP_611146.1. NM_137302.2. [Q9V7S5-2]
NP_725600.1. NM_166187.1. [Q9V7S5-1]
UniGeneDm.657.

3D structure databases

ProteinModelPortalQ9V7S5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid62577. 5 interactions.
DIPDIP-22400N.
MINTMINT-801314.

Protein family/group databases

TCDB2.A.1.14.34. the major facilitator superfamily (mfs).

Proteomic databases

PaxDbQ9V7S5.
PRIDEQ9V7S5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaFBtr0087115; FBpp0086261; FBgn0024315. [Q9V7S5-1]
GeneID36865.
KEGGdme:Dmel_CG8098.
UCSCCG8098-RA. d. melanogaster. [Q9V7S5-1]

Organism-specific databases

CTD36865.
FlyBaseFBgn0024315. Picot.

Phylogenomic databases

eggNOGCOG0477.
GeneTreeENSGT00630000089608.
InParanoidQ9V7S5.
OMAKQVLRFS.
OrthoDBEOG789C9Z.
PhylomeDBQ9V7S5.

Gene expression databases

BgeeQ9V7S5.

Family and domain databases

InterProIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004745. Pi_cotranspt.
[Graphical view]
PfamPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMSSF103473. SSF103473. 2 hits.
TIGRFAMsTIGR00894. 2A0114euk. 1 hit.
PROSITEPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi36865.
NextBio800790.

Entry information

Entry namePICO_DROME
AccessionPrimary (citable) accession number: Q9V7S5
Secondary accession number(s): O61364, Q8T077, Q9V7S6
Entry history
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Drosophila

Drosophila: entries, gene names and cross-references to FlyBase