Q9V7S5 (PICO_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative inorganic phosphate cotransporter | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 529 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be an inorganic phosphate cotransporter. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the major facilitator superfamily. Sodium/anion cotransporter family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sodium transport Symport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phosphate ion transport Non-traceable author statement. Source: UniProtKB sodium ion transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Non-traceable author statement. Source: UniProtKB |
| Molecular_function | inorganic phosphate transmembrane transporter activity Non-traceable author statement. Source: UniProtKB phosphate ion transmembrane transporter activityInferred from electronic annotation. Source: InterPro symporter activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CG1602 | Q9V4M9 | 1 | EBI-246284,EBI-134974 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: Q9V7S5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q9V7S5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQR → MSASKEAICGSTEKDLEKPALG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 529 | 529 | Putative inorganic phosphate cotransporter | PRO_0000220946 | |||||
Regions | |||||||||
| Transmembrane | 37 – 57 | 21 | Helical; Potential | ||||||
| Transmembrane | 110 – 130 | 21 | Helical; Potential | ||||||
| Transmembrane | 148 – 168 | 21 | Helical; Potential | ||||||
| Transmembrane | 202 – 222 | 21 | Helical; Potential | ||||||
| Transmembrane | 232 – 252 | 21 | Helical; Potential | ||||||
| Transmembrane | 338 – 358 | 21 | Helical; Potential | ||||||
| Transmembrane | 429 – 449 | 21 | Helical; Potential | ||||||
| Transmembrane | 466 – 486 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 35 | 35 | MPFRR…QQPQR → MSASKEAICGSTEKDLEKPA LG in isoform A. | VSP_007009 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE013599 Genomic DNA. Translation: AAF57968.1. AE013599 Genomic DNA. Translation: AAF57969.1. AY069501 mRNA. Translation: AAL39646.1. AF022713 Genomic DNA. Translation: AAD09148.1. |
| RefSeq | NP_611146.1. NM_137302.2. NP_725600.1. NM_166187.1. |
| UniGene | Dm.657. |
3D structure databases | |
| ProteinModelPortal | Q9V7S5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-22400N. |
| MINT | MINT-801314. |
Proteomic databases | |
| PaxDb | Q9V7S5. |
| PRIDE | Q9V7S5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0087115; FBpp0086261; FBgn0024315. |
| GeneID | 36865. |
| KEGG | dme:Dmel_CG8098. |
| UCSC | CG8098-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 36865. |
| FlyBase | FBgn0024315. Picot. |
Phylogenomic databases | |
| eggNOG | COG0477. |
| GeneTree | ENSGT00630000089608. |
| InParanoid | Q9V7S5. |
| OMA | DWMISSK. |
| OrthoDB | EOG48CZ9Q. |
| PhylomeDB | Q9V7S5. |
Gene expression databases | |
| Bgee | Q9V7S5. |
| GermOnline | CG8098. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR011701. MFS. IPR020846. MFS_dom. IPR016196. MFS_dom_general_subst_transpt. IPR004745. Pi_cotranspt. [Graphical view] |
| Pfam | PF07690. MFS_1. 1 hit. [Graphical view] |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| TIGRFAMs | TIGR00894. 2A0114euk. 1 hit. |
| PROSITE | PS50850. MFS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 36865. |
| NextBio | 800790. |
Entry information
| Entry name | PICO_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9V7S5 Secondary accession number(s): O61364, Q8T077, Q9V7S6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
