Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative inorganic phosphate cotransporter

Gene

Picot

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be an inorganic phosphate cotransporter.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.1.14.34. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Putative inorganic phosphate cotransporter
Gene namesi
Name:Picot
ORF Names:CG8098
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0024315. Picot.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei37 – 57HelicalSequence analysisAdd BLAST21
Transmembranei110 – 130HelicalSequence analysisAdd BLAST21
Transmembranei148 – 168HelicalSequence analysisAdd BLAST21
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Transmembranei232 – 252HelicalSequence analysisAdd BLAST21
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Transmembranei429 – 449HelicalSequence analysisAdd BLAST21
Transmembranei466 – 486HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002209461 – 529Putative inorganic phosphate cotransporterAdd BLAST529

Proteomic databases

PaxDbiQ9V7S5.
PRIDEiQ9V7S5.

Expressioni

Gene expression databases

BgeeiFBgn0024315.
ExpressionAtlasiQ9V7S5. baseline.
GenevisibleiQ9V7S5. DM.

Interactioni

Protein-protein interaction databases

BioGridi62577. 5 interactors.
DIPiDIP-22400N.
MINTiMINT-801314.
STRINGi7227.FBpp0086261.

Structurei

3D structure databases

ProteinModelPortaliQ9V7S5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
InParanoidiQ9V7S5.
OMAiCAVRFIQ.
OrthoDBiEOG091G06DG.
PhylomeDBiQ9V7S5.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR004745. Pi_cotranspt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00894. 2A0114euk. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: Q9V7S5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPFRRSSLNH RHRDGHVLVW NQRNLHESLE QQPQRCFATR YFVTFMLFLG
60 70 80 90 100
MANAYVMRTN MSVAIVAMVN HTAIKSGEAE EYDDECGDRD IPIDDSQDGE
110 120 130 140 150
FAWSSALQGY ILSSFFYGYV ITQIPFGILA KKYGSLRFLG YGMLINSVFA
160 170 180 190 200
FLVPVAARGG GVWGLCAVRF IQGLGEGPIV PCTHAMLAKW IPPNERSRMG
210 220 230 240 250
AAVYAGAQFG TIISMPLSGL LAEYGFDGGW PSIFYVFGIV GTVWSIAFLI
260 270 280 290 300
FVHEDPSSHP TIDEREKKYI NDSLWGTDVV KSPPIPFKAI IKSLPFYAIL
310 320 330 340 350
FAHMGHNYGY ETLMTELPTY MKQVLRFSLK SNGLLSSLPY LAMWLFSMFI
360 370 380 390 400
SVVADWMISS KRFSHTATRK LINSIGQYGP GVALIAASYT GCDRALTLAI
410 420 430 440 450
LTIGVGLNGG IYSGFKINHL DLTPRFAGFL MSITNCSANL AGLLAPIAAG
460 470 480 490 500
HLISDPSKPM MGQWQIVFFI AAFVYIICGT FYNIFGSGER QYWDNPEDDE
510 520
QKPALQTTVT TSPARLSNGS TAPAAISSS
Length:529
Mass (Da):58,372
Last modified:May 1, 2000 - v1
Checksum:i07B89A52D5081EFB
GO
Isoform A (identifier: Q9V7S5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQR → MSASKEAICGSTEKDLEKPALG

Note: No experimental confirmation available.
Show »
Length:516
Mass (Da):56,278
Checksum:iB7657ECFE020BED8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0070091 – 35MPFRR…QQPQR → MSASKEAICGSTEKDLEKPA LG in isoform A. CuratedAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF57968.1.
AE013599 Genomic DNA. Translation: AAF57969.1.
AY069501 mRNA. Translation: AAL39646.1.
AF022713 Genomic DNA. Translation: AAD09148.1.
RefSeqiNP_001286496.1. NM_001299567.1. [Q9V7S5-2]
NP_001286497.1. NM_001299568.1. [Q9V7S5-2]
NP_611146.1. NM_137302.3. [Q9V7S5-2]
NP_725600.1. NM_166187.2. [Q9V7S5-1]
UniGeneiDm.657.

Genome annotation databases

EnsemblMetazoaiFBtr0087115; FBpp0086261; FBgn0024315. [Q9V7S5-1]
GeneIDi36865.
KEGGidme:Dmel_CG8098.
UCSCiCG8098-RA. d. melanogaster. [Q9V7S5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA. Translation: AAF57968.1.
AE013599 Genomic DNA. Translation: AAF57969.1.
AY069501 mRNA. Translation: AAL39646.1.
AF022713 Genomic DNA. Translation: AAD09148.1.
RefSeqiNP_001286496.1. NM_001299567.1. [Q9V7S5-2]
NP_001286497.1. NM_001299568.1. [Q9V7S5-2]
NP_611146.1. NM_137302.3. [Q9V7S5-2]
NP_725600.1. NM_166187.2. [Q9V7S5-1]
UniGeneiDm.657.

3D structure databases

ProteinModelPortaliQ9V7S5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi62577. 5 interactors.
DIPiDIP-22400N.
MINTiMINT-801314.
STRINGi7227.FBpp0086261.

Protein family/group databases

TCDBi2.A.1.14.34. the major facilitator superfamily (mfs).

Proteomic databases

PaxDbiQ9V7S5.
PRIDEiQ9V7S5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0087115; FBpp0086261; FBgn0024315. [Q9V7S5-1]
GeneIDi36865.
KEGGidme:Dmel_CG8098.
UCSCiCG8098-RA. d. melanogaster. [Q9V7S5-1]

Organism-specific databases

CTDi36865.
FlyBaseiFBgn0024315. Picot.

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
InParanoidiQ9V7S5.
OMAiCAVRFIQ.
OrthoDBiEOG091G06DG.
PhylomeDBiQ9V7S5.

Miscellaneous databases

GenomeRNAii36865.
PROiQ9V7S5.

Gene expression databases

BgeeiFBgn0024315.
ExpressionAtlasiQ9V7S5. baseline.
GenevisibleiQ9V7S5. DM.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR004745. Pi_cotranspt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00894. 2A0114euk. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPICO_DROME
AccessioniPrimary (citable) accession number: Q9V7S5
Secondary accession number(s): O61364, Q8T077, Q9V7S6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.