Reviewed,
UniProtKB/Swiss-Prot Q9V4N3 (CYB5_DROME)
Last modified
June 16, 2009.
Version 72.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cytochrome b5 Short name=CYTB5 | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 134 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side By similarity. Microsome membrane; Single-pass membrane protein; Cytoplasmic side By similarity. |
| Sequence similarities | Belongs to the cytochrome b5 family. Contains 1 cytochrome b5 heme-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Electron transport Transport |
| Cellular component | Endoplasmic reticulum Membrane Microsome |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| Ligand | Heme Iron Metal-binding |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | electron transport chain Inferred from electronic annotation. Source: UniProtKB-KW transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW lipid particleInferred from direct assay. Source: FlyBase microsomeInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | heme binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: Q9V4N3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform A (identifier: Q9V4N3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-40: MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNE → MVQSKRNFARVLRIKVSVTLLAYKCQIKS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 134 | 134 | Cytochrome b5 | PRO_0000166016 | |||||
Regions | |||||||||
| Transmembrane | 111 – 131 | 21 | Potential | ||||||
| Domain | 6 – 82 | 77 | Cytochrome b5 heme-binding | ||||||
Sites | |||||||||
| Metal binding | 41 | 1 | Iron (heme axial ligand) By similarity | ||||||
| Metal binding | 65 | 1 | Iron (heme axial ligand) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 40 | 40 | MSSEE…AFLNE → MVQSKRNFARVLRIKVSVTL LAYKCQIKS in isoform A. | VSP_008871 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AE013599 Genomic DNA. Translation: AAF59233.3. AE013599 Genomic DNA. Translation: AAG22305.2. BT001378 mRNA. Translation: AAN71133.1. BT004852 mRNA. Translation: AAO45208.1. BT015196 mRNA. Translation: AAT94425.1. | |
| RefSeq | NP_610294.1. NP_724575.1. |
| UniGene | Dm.6903 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1EHB based on UniProtKB P00171. |
| SMR | Q9V4N3. Positions 3-88. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:22488N. |
| IntAct | Q9V4N3. 2 interactions. |
Proteomic databases | |
| PRIDE | Q9V4N3. |
Genome annotation databases | |
| Ensembl | FBgn0033189. Drosophila melanogaster. [Contig view] |
| GeneID | 35688. |
| KEGG | dme:Dmel_CG2140. |
| NMPDR | fig|7227.3.peg.3676. |
Organism-specific databases | |
| FlyBase | FBgn0033189. Cyt-b5. |
Phylogenomic databases | |
| HOGENOM | Q9V4N3. |
| OMA | Q9V4N3. TAFLNEH. |
Enzyme and pathway databases | |
| BioCyc | DMEL-XXX-02:DMEL-XXX-02-003239-MON. |
Gene expression databases | |
| ArrayExpress | Q9V4N3. |
| GermOnline | CG2140. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR001199. Cyt_B5. IPR018506. Cyt_B5_heme-BS. [Graphical view] |
| Gene3D | G3DSA:3.10.120.10. Cyt_B5. 1 hit. |
| Pfam | PF00173. Cyt-b5. 1 hit. [Graphical view] |
| PRINTS | PR00363. CYTOCHROMEB5. |
| ProDom | PD000612. Cyt_B5. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS00191. CYTOCHROME_B5_1. 1 hit. PS50255. CYTOCHROME_B5_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 794735. |
Entry information
| Entry name | CYB5_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9V4N3 Secondary accession number(s): Q6AWQ2, Q8IH75, Q9I7E0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with


