Q9UQN3 (CHM2B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Charged multivesicular body protein 2b Alternative name(s): CHMP2.5 Chromatin-modifying protein 2b Short name=CHMP2b Vacuolar protein sorting-associated protein 2-2 Short name=Vps2-2 Short name=hVps2-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 213 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. |
| Subunit structure | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentally. Interacts with CHMP2A. Interacts with VPS4A. Interacts with VPS4B; the interaction is direct. Ref.8 Ref.16 |
| Subcellular location | Cytoplasm › cytosol. Late endosome membrane; Peripheral membrane protein Probable Ref.10. |
| Tissue specificity | Widely expressed. Expressed in brain, heart, skeletal muscle, spleen, kidney, liver, small intestine, pancreas, lung, placenta and leukocytes. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal chord, occipital lobe, frontal lobe, temporal lobe and putamen. Ref.10 |
| Domain | The acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components By similarity. |
| Involvement in disease | Frontotemporal dementia, chromosome 3-linked (FTD3) [MIM:600795]: Characterized by an onset of dementia in the late 50's initially characterized by behavioral and personality changes including apathy, restlessness, disinhibition and hyperorality, progressing to stereotyped behaviors, non-fluent aphasia, mutism and dystonia, with a marked lack of insight. The brains of individuals with FTD3 have no distinctive neuropathological features. They show global cortical and central atrophy, but no beta-amyloid deposits. Amyotrophic lateral sclerosis 17 (ALS17) [MIM:614696]: An adult-onset progressive neurodegenerative disorder with predominantly lower motor neuron involvement, manifest as muscle weakness and wasting of the upper and lower limbs, bulbar signs, and respiratory insufficiency. |
| Sequence similarities | Belongs to the SNF7 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Disease | Amyotrophic lateral sclerosis Disease mutation Neurodegeneration |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell death Inferred from electronic annotation. Source: UniProtKB-KW cellular membrane organizationTraceable author statement. Source: Reactome endosomal transportTraceable author statement. Source: Reactome protein transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytosol Traceable author statement. Source: Reactome late endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionInferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UQN3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UQN3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQL → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 213 | 213 | Charged multivesicular body protein 2b | PRO_0000211469 | |||||||
Regions | |||||||||||
| Coiled coil | 25 – 55 | 31 | Potential | ||||||||
| Motif | 201 – 211 | 11 | MIT-interacting motif | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 199 | 1 | Phosphoserine Ref.11 Ref.12 Ref.13 Ref.15 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 42 | 42 | MASLF…QEKQL → M in isoform 2. | VSP_045142 | |||||||
| Natural variant | 29 | 1 | I → V in ALS17; cells expressing the mutant protein have large cytoplasmic vacuoles with an accumulation of the mutant protein on the outer membrane termed halos; cells with the mutant protein also have aberrant localization of CD63 and an increase in MAP1LC3A1 overall indicating a defect in the autophagic pathway. Ref.17 Ref.18 | VAR_038373 | |||||||
| Natural variant | 104 | 1 | T → N in ALS17; cells expressing the mutant protein have large cytoplasmic vacuoles with an accumulation of the mutant protein on the outer membrane termed halos; cells with the mutant protein also have aberrant localization of CD63 and an increase in MAP1LC3A overall indicating a defect in the autophagic pathway. Ref.18 | VAR_068689 | |||||||
| Natural variant | 148 | 1 | D → Y in FTD3. Ref.10 | VAR_023383 | |||||||
| Natural variant | 206 | 1 | Q → H in ALS17; cells expressing the mutant protein have large cytoplasmic vacuoles with an accumulation of the mutant protein on the outer membrane termed halos; cells with the mutant protein also have aberrant localization of CD63 and an increase in MAP1LC3A overall indicating a defect in the autophagic pathway. Ref.17 Ref.18 | VAR_038374 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 8 | 1 | K → R in CAB45721. Ref.2 | ||||||||
| Sequence conflict | 8 | 1 | K → R in CAG38487. Ref.3 | ||||||||
| Sequence conflict | 113 | 1 | N → S in BAD96374. Ref.5 | ||||||||
| Sequence conflict | 201 | 1 | E → V in CAB45721. Ref.2 | ||||||||
| Sequence conflict | 201 | 1 | E → V in CAG38487. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 201 – 210 | 10 | |||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Thalamus. |
| [4] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [6] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cervix. |
| [8] | "Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins." Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:12414-12419(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CHMP2A. |
| [9] | Erratum Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:152845-152845(2003) |
| [10] | "Mutations in the endosomal ESCRTIII-complex subunit CHMP2B in frontotemporal dementia." Skibinski G., Parkinson N.J., Brown J.M., Chakrabarti L., Lloyd S.L., Hummerich H., Nielsen J.E., Hodges J.R., Spillantini M.G., Thusgaard T., Brandner S., Brun A., Rossor M.N., Gade A., Johannsen P., Soerensen S.A., Gydesen S., Fisher E.M.C., Collinge J. Nat. Genet. 37:806-808(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT FTD3 TYR-148. |
| [11] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-199, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-199, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-199, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-199, MASS SPECTROMETRY. |
| [16] | "ESCRT-III recognition by VPS4 ATPases." Stuchell-Brereton M.D., Skalicky J.J., Kieffer C., Karren M.A., Ghaffarian S., Sundquist W.I. Nature 449:740-744(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 195-213 IN COMPLEX WITH VPS4B, INTERACTION WITH VPS4A. |
| [17] | "ALS phenotypes with mutations in CHMP2B (charged multivesicular body protein 2B)." Parkinson N., Ince P.G., Smith M.O., Highley R., Skibinski G., Andersen P.M., Morrison K.E., Pall H.S., Hardiman O., Collinge J., Shaw P.J., Fisher E.M. Neurology 67:1074-1077(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ALS17 HIS-206, VARIANT VAL-29. |
| [18] | "Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS)." Cox L.E., Ferraiuolo L., Goodall E.F., Heath P.R., Higginbottom A., Mortiboys H., Hollinger H.C., Hartley J.A., Brockington A., Burness C.E., Morrison K.E., Wharton S.B., Grierson A.J., Ince P.G., Kirby J., Shaw P.J. PLoS ONE 5:E9872-E9872(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALS17 VAL-29; ASN-104 AND HIS-206, CHARACTERIZATION OF VARIANTS ALS17 VAL-29; ASN-104 AND HIS-206. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF151842 mRNA. Translation: AAD34079.1. AL080122 mRNA. Translation: CAB45721.1. AK296072 mRNA. Translation: BAG58830.1. CR533456 mRNA. Translation: CAG38487.1. AK222654 mRNA. Translation: BAD96374.1. AC123511 Genomic DNA. No translation available. AC130885 Genomic DNA. No translation available. BC001553 mRNA. Translation: AAH01553.1. | ||||||||||||
| IPI | IPI00550181. | ||||||||||||
| PIR | T12468. | ||||||||||||
| RefSeq | NP_001231573.1. NM_001244644.1. NP_054762.2. NM_014043.3. | ||||||||||||
| UniGene | Hs.476930. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UQN3. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9UQN3. 4 interactions. | ||||||||||||
| MINT | MINT-1430090. | ||||||||||||
| STRING | 9606.ENSP00000263780. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UQN3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 73917746. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UQN3. | ||||||||||||
| PRIDE | Q9UQN3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 25978. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000263780; ENSP00000263780; ENSG00000083937. ENST00000471660; ENSP00000419998; ENSG00000083937. | ||||||||||||
| GeneID | 25978. | ||||||||||||
| KEGG | hsa:25978. | ||||||||||||
| UCSC | uc003dqp.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 25978. | ||||||||||||
| GeneCards | GC03P087360. | ||||||||||||
| HGNC | HGNC:24537. CHMP2B. | ||||||||||||
| HPA | HPA035069. | ||||||||||||
| MIM | 600795. phenotype. 609512. gene. 614696. phenotype. | ||||||||||||
| neXtProt | NX_Q9UQN3. | ||||||||||||
| Orphanet | 803. Amyotrophic lateral sclerosis. 275864. Behavioural variant of frontotemporal dementia. | ||||||||||||
| PharmGKB | PA142672112. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG268821. | ||||||||||||
| HOGENOM | HOG000177218. | ||||||||||||
| HOVERGEN | HBG102628. | ||||||||||||
| InParanoid | Q9UQN3. | ||||||||||||
| KO | K12192. | ||||||||||||
| OMA | DPQKTLK. | ||||||||||||
| PhylomeDB | Q9UQN3. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_11123. Membrane Trafficking. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UQN3. | ||||||||||||
| Bgee | Q9UQN3. | ||||||||||||
| CleanEx | HS_CHMP2B. | ||||||||||||
| Genevestigator | Q9UQN3. | ||||||||||||
| GermOnline | ENSG00000083937. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005024. Snf7. [Graphical view] | ||||||||||||
| Pfam | PF03357. Snf7. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | CHMP2B. human. | ||||||||||||
| EvolutionaryTrace | Q9UQN3. | ||||||||||||
| GenomeRNAi | 25978. | ||||||||||||
| NextBio | 47630. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CHM2B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UQN3 Secondary accession number(s): B4DJG8, Q53HC7, Q9Y4U6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
