Reviewed,
UniProtKB/Swiss-Prot Q9UQB8 (BAIP2_HUMAN)
Last modified
February 9, 2010.
Version 83.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Brain-specific angiogenesis inhibitor 1-associated protein 2 Short name=BAI1-associated protein 2 Short name=BAI-associated protein 2 Short name=Protein BAP2 Alternative name(s): Insulin receptor substrate protein of 53 kDa Short name=Insulin receptor substrate p53 Short name=IRSp53 Insulin receptor substrate p53/p58 Short name=IRSp53/58 Short name=IRS-58 Fas ligand-associated factor 3 Short name=FLAF3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 552 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation. Ref.7 Ref.8 Ref.12 |
| Subunit structure | Homodimer. Interacts with CDC42 and RAC1 that have been activated by GTP binding. Interacts with ATN1, BAI1, EPS8, SHANK1, SHANK2, SHANK3, WASF1 and WASF2. Interacts with ENAH after recruitment of CDC42. Interacts with TIAM1 and DIAPH1 By similarity. Ref.7 Ref.8 Ref.1 Ref.2 Ref.9 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm. Membrane; Peripheral membrane protein. Cell projection › filopodium. Cell projection › ruffle. Note: Detected throughout the cytoplasm in the absence of specific binding partners. Detected in filopodia and close to membrane ruffles. Ref.1 Ref.2 Ref.10 Ref.11 |
| Tissue specificity | Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta. Ref.1 Ref.2 Ref.9 |
| Domain | The IMD domain forms a coiled coil. The isolated domain can induce actin bundling and filopodia formation. In the absence of G-proteins intramolecular interaction between the IMD and the SH3 domain gives rise to an auto-inhibited state of the protein. Interaction of the IMD with RAC1 or CDC42 leads to activation. Ref.12 The SH3 domain interacts with ATN1, BAI1, WASF1, WASF2, SHANK1, DIAPH1 and ENAH. Ref.12 |
| Post-translational modification | Phosphorylated on tyrosine residues by INSR in response to insulin treatment. Ref.2 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 |
| Sequence similarities | Contains 1 IMD (IRSp53/MIM homology) domain. Contains 1 SH3 domain. |
| Caution | It is uncertain whether Met-1 or Met-59 is the initiator. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ABI1 | Q8IZP0 | 1 | EBI-525456,EBI-375446 | |
| EPS8 | Q12929 | 1 | EBI-525456,EBI-375576 | |
| Eps8 | Q08509 | 6 | EBI-525456,EBI-375596 | From a different organism. |
| PBX2 | P40425 | 1 | EBI-525456,EBI-348489 | |
| YWHAG | P61981 | 1 | EBI-525456,EBI-359832 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UQB8-1) Also known as: IRSp53(L); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UQB8-2) The sequence of this isoform differs from the canonical sequence as follows: 529-552: CDLSAQGPEGREHGDGSARTLAGR → SAPLLS | ||||||
| Isoform 3 (identifier: Q9UQB8-3) The sequence of this isoform differs from the canonical sequence as follows: 513-552: Missing. | ||||||
| Isoform 4 (identifier: Q9UQB8-4) Also known as: BAIAP2-alpha; The sequence of this isoform differs from the canonical sequence as follows: 512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV | ||||||
| Isoform 5 (identifier: Q9UQB8-5) Also known as: BAIAP2-beta; The sequence of this isoform differs from the canonical sequence as follows: 512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SADVEVARF | ||||||
| Isoform 6 (identifier: Q9UQB8-6) The sequence of this isoform differs from the canonical sequence as follows: 356-356: T → TA 512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 552 | 552 | Brain-specific angiogenesis inhibitor 1-associated protein 2 | PRO_0000064816 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 1 – 250 | 250 | IMD | |||||||||||||||||||||
| Domain | 374 – 437 | 64 | SH3 | |||||||||||||||||||||
| Coiled coil | 132 – 153 | 22 | Potential | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 157 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||
| Modified residue | 296 | 1 | Phosphothreonine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 310 | 1 | Phosphotyrosine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 323 | 1 | Phosphoserine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 325 | 1 | Phosphoserine Ref.2 Ref.14 Ref.15 Ref.16 | |||||||||||||||||||||
| Modified residue | 337 | 1 | Phosphotyrosine Ref.2 Ref.13 Ref.17 | |||||||||||||||||||||
| Modified residue | 346 | 1 | Phosphoserine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 348 | 1 | Phosphothreonine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 366 | 1 | Phosphoserine Ref.2 Ref.15 | |||||||||||||||||||||
| Modified residue | 452 | 1 | Phosphoserine By similarity | |||||||||||||||||||||
| Modified residue | 453 | 1 | Phosphoserine By similarity | |||||||||||||||||||||
| Modified residue | 454 | 1 | Phosphoserine Ref.2 Ref.16 | |||||||||||||||||||||
| Modified residue | 491 | 1 | Phosphotyrosine Ref.2 Ref.13 | |||||||||||||||||||||
| Modified residue | 505 | 1 | Phosphotyrosine Ref.2 Ref.13 | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 356 | 1 | T → TA in isoform 6. | VSP_015502 | ||||||||||||||||||||
| Alternative sequence | 512 – 552 | 41 | RNPFA…TLAGR → SGSGTLVSTV in isoform 4 and isoform 6. | VSP_015503 | ||||||||||||||||||||
| Alternative sequence | 512 – 552 | 41 | RNPFA…TLAGR → SADVEVARF in isoform 5. | VSP_015504 | ||||||||||||||||||||
| Alternative sequence | 513 – 552 | 40 | Missing in isoform 3. | VSP_015505 | ||||||||||||||||||||
| Alternative sequence | 529 – 552 | 24 | CDLSA…TLAGR → SAPLLS in isoform 2. | VSP_015506 | ||||||||||||||||||||
| Natural variant | 519 | 1 | Q → R: dbSNP rs4969391. | VAR_050686 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Mutagenesis | 142 | 1 | K → E: Abolishes actin-bundling and filopodia formation; when associated with E-143; E-146 and E147. Ref.18 | |||||||||||||||||||||
| Mutagenesis | 143 | 1 | K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-146 and E147. Ref.18 | |||||||||||||||||||||
| Mutagenesis | 146 | 1 | K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E147. Ref.18 | |||||||||||||||||||||
| Mutagenesis | 147 | 1 | K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E146. Ref.18 | |||||||||||||||||||||
| Mutagenesis | 267 | 1 | I → N: Loss of interaction with CDC42. Loss of stimulation of neurite growth. Ref.9 | |||||||||||||||||||||
| Mutagenesis | 427 | 1 | F → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-428. Ref.8 | |||||||||||||||||||||
| Mutagenesis | 428 | 1 | P → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-427. Ref.8 | |||||||||||||||||||||
| Sequence conflict | 84 | 1 | R → W in BAD96390. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 415 | 1 | Y → H in BAD96390. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 473 | 1 | A → T in BAD96390. Ref.4 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Helix | 2 – 22 | 21 | ||||||||||||||||||||||
| Helix | 24 – 64 | 41 | ||||||||||||||||||||||
| Beta strand | 66 – 68 | 3 | ||||||||||||||||||||||
| Helix | 70 – 99 | 30 | ||||||||||||||||||||||
| Helix | 102 – 149 | 48 | ||||||||||||||||||||||
| Turn | 154 – 157 | 4 | ||||||||||||||||||||||
| Helix | 158 – 229 | 72 | ||||||||||||||||||||||
| Helix | 238 – 246 | 9 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of BAIAP2 (BAI-associated protein 2), a novel human homologue of hamster IRSp53, whose SH3 domain interacts with the cytoplasmic domain of BAI1." Oda K., Shiratsuchi T., Nishimori H., Inazawa J., Yoshikawa H., Taketani Y., Nakamura Y., Tokino T. Cytogenet. Cell Genet. 84:75-82(1999) [PubMed: 10343108] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), INTERACTION WITH BAI1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "Dentatorubral-pallidoluysian atrophy protein interacts through a proline-rich region near polyglutamine with the SH3 domain of an insulin receptor tyrosine kinase substrate." Okamura-Oho Y., Miyashita T., Ohmi K., Yamada M. Hum. Mol. Genet. 8:947-957(1999) [PubMed: 10332026] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), PHOSPHORYLATION AT TYROSINE RESIDUES, SUBCELLULAR LOCATION, INTERACTION WITH ATN1, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [3] | "Genomic structure and alternative splicing of the insulin receptor tyrosine kinase substrate of 53-kDa protein." Miyahara A., Okumura-Oho Y., Miyashita T., Hoshika A., Yamada M. J. Hum. Genet. 48:410-414(2003) [PubMed: 12884081] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 4 AND 5). |
| [4] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 6). Tissue: Brain and Duodenum. |
| [6] | "A Fas-ligand associated factor 3, FLAF3, potentiates Fas-ligand stability." Hachiya T., Kobayasi A., Touji S., Tamai K. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-328. Tissue: Placenta. |
| [7] | "IRSp53 is an essential intermediate between Rac and WAVE in the regulation of membrane ruffling." Miki H., Yamaguchi H., Suetsugu S., Takenawa T. Nature 408:732-735(2000) [PubMed: 11130076] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAC1; CDC42; WASF1 AND WASF2. |
| [8] | "Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex." Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Curr. Biol. 11:1645-1655(2001) [PubMed: 11696321] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDC42 AND ENAH, MUTAGENESIS OF PHE-427 AND PRO-428. |
| [9] | "Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin." Govind S., Kozma R., Monfries C., Lim L., Ahmed S. J. Cell Biol. 152:579-594(2001) [PubMed: 11157984] [Abstract] Cited for: INTERACTION WITH CDC42, MUTAGENESIS OF ILE-267, TISSUE SPECIFICITY. |
| [10] | "The insulin receptor substrate IRSp53 links postsynaptic shank1 to the small G-protein cdc42." Soltau M., Richter D., Kreienkamp H.-J. Mol. Cell. Neurosci. 21:575-583(2002) [PubMed: 12504591] [Abstract] Cited for: INTERACTION WITH SHANK1; SHANK2; SHANK3 AND CDC42, SUBCELLULAR LOCATION. |
| [11] | "IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness." Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer Res. 64:5237-5244(2004) [PubMed: 15289329] [Abstract] Cited for: INTERACTION WITH EPS8, SUBCELLULAR LOCATION. |
| [12] | "A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein." Yamagishi A., Masuda M., Ohki T., Onishi H., Mochizuki N. J. Biol. Chem. 279:14929-14936(2004) [PubMed: 14752106] [Abstract] Cited for: DOMAIN, FUNCTION. |
| [13] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-337; TYR-491 AND TYR-505, MASS SPECTROMETRY. |
| [14] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-325, MASS SPECTROMETRY. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-296; TYR-310; SER-323; SER-325; SER-346; THR-348 AND SER-366, MASS SPECTROMETRY. |
| [16] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-325 AND SER-454, MASS SPECTROMETRY. |
| [17] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-337, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [18] | "Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53." Millard T.H., Bompard G., Heung M.Y., Dafforn T.R., Scott D.J., Machesky L.M., Fuetterer K. EMBO J. 24:240-250(2005) [PubMed: 15635447] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 1-250, MUTAGENESIS OF LYS-142; LYS-143; LYS-146 AND LYS-147. |
| [19] | "Crystal structure of RCB domain of IRSP53." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2005) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.63 ANGSTROMS) OF 1-228. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB015019 mRNA. Translation: BAA36586.1. AB015020 mRNA. Translation: BAA36587.1. AB017119 mRNA. Translation: BAA74773.1. AB017120 mRNA. Translation: BAA74774.1. AB104726 Genomic DNA. Translation: BAC57945.1. AB104726 Genomic DNA. Translation: BAC57946.1. AB104726 Genomic DNA. Translation: BAC57947.1. AB104726 Genomic DNA. Translation: BAC57948.1. AK222670 mRNA. Translation: BAD96390.1. BC014020 mRNA. Translation: AAH14020.1. BC032559 mRNA. Translation: AAH32559.1. U70669 mRNA. Translation: AAB93497.1. | ||||||||||||||||||
| IPI | IPI00180292. IPI00185159. IPI00299088. IPI00642333. IPI00644120. IPI00647603. | ||||||||||||||||||
| RefSeq | NP_001138360.1. NP_006331.1. NP_059344.1. NP_059345.1. | ||||||||||||||||||
| UniGene | Hs.128316 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| SMR | Q9UQB8. Positions 378-440. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-29272N. | ||||||||||||||||||
| IntAct | Q9UQB8. 9 interactions. | ||||||||||||||||||
| STRING | Q9UQB8. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9UQB8. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q9UQB8. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000321300; ENSP00000316338; ENSG00000175866; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 10458. | ||||||||||||||||||
| KEGG | hsa:10458. | ||||||||||||||||||
| UCSC | uc002jyz.2. human. uc002jza.1. human. uc002jzc.1. human. uc002jzd.1. human. uc002jzf.1. human. uc002jzg.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 10458. | ||||||||||||||||||
| GeneCards | GC17P076623. | ||||||||||||||||||
| H-InvDB | HIX0020031. | ||||||||||||||||||
| HGNC | HGNC:947. BAIAP2. | ||||||||||||||||||
| HPA | HPA023310. | ||||||||||||||||||
| MIM | 605475. gene. | ||||||||||||||||||
| PharmGKB | PA25251. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG13810. | ||||||||||||||||||
| HOVERGEN | Q9UQB8. | ||||||||||||||||||
| InParanoid | Q9UQB8. | ||||||||||||||||||
| OMA | AVSRNPF. | ||||||||||||||||||
| OrthoDB | EOG9XKXS9. | ||||||||||||||||||
| PhylomeDB | Q9UQB8. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_14797. Signaling by GPCR. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9UQB8. | ||||||||||||||||||
| Bgee | Q9UQB8. | ||||||||||||||||||
| CleanEx | HS_BAIAP2. | ||||||||||||||||||
| Genevestigator | Q9UQB8. | ||||||||||||||||||
| GermOnline | ENSG00000175866. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR013606. IRSp53/MIM_homology_IMD. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:1.20.1270.80. IRSp53/MIM_homology_IMD. 1 hit. | ||||||||||||||||||
| Pfam | PF08397. IMD. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS51338. IMD. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 39651. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BAIP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UQB8 Secondary accession number(s): O43858 Q9UQ43 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


