Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain-specific angiogenesis inhibitor 1-associated protein 2

Gene

BAIAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection. Participates in actin bundling when associated with EPS8, promoting filopodial protrusions.5 Publications

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • cytoskeletal adaptor activity Source: ProtInc
  • identical protein binding Source: IntAct
  • proline-rich region binding Source: UniProtKB
  • protein C-terminus binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.
SignaLinkiQ9UQB8.
SIGNORiQ9UQB8.

Names & Taxonomyi

Protein namesi
Recommended name:
Brain-specific angiogenesis inhibitor 1-associated protein 2
Short name:
BAI-associated protein 2
Short name:
BAI1-associated protein 2
Short name:
Protein BAP2
Alternative name(s):
Fas ligand-associated factor 3
Short name:
FLAF3
Insulin receptor substrate p53/p58
Short name:
IRS-58
Short name:
IRSp53/58
Insulin receptor substrate protein of 53 kDa
Short name:
IRSp53
Short name:
Insulin receptor substrate p53
Gene namesi
Name:BAIAP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:947. BAIAP2.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • cytoplasm Source: HPA
  • cytoskeleton Source: UniProtKB-SubCell
  • cytosol Source: UniProtKB
  • dendritic spine Source: Ensembl
  • extracellular exosome Source: UniProtKB
  • filopodium Source: UniProtKB-SubCell
  • neuronal cell body Source: Ensembl
  • plasma membrane Source: HPA
  • postsynaptic density Source: Ensembl
  • ruffle Source: UniProtKB-SubCell
  • secretory granule Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi142K → E: Abolishes actin-bundling and filopodia formation; when associated with E-143; E-146 and E147. 1 Publication1
Mutagenesisi143K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-146 and E147. 1 Publication1
Mutagenesisi146K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E147. 1 Publication1
Mutagenesisi147K → E: Abolishes actin-bundling and filopodia formation; when associated with E-142; E-143 and E146. 1 Publication1
Mutagenesisi267I → N: Loss of interaction with CDC42. Loss of stimulation of neurite growth. 1 Publication1
Mutagenesisi413W → G: Impairs the SH3 domain and abolishes the interaction with EPS8. 1 Publication1
Mutagenesisi427F → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-428. 1 Publication1
Mutagenesisi428P → A: Loss of interaction with ENAH and no induction of filopodia; when associated with A-427. 1 Publication1

Organism-specific databases

DisGeNETi10458.
OpenTargetsiENSG00000175866.
PharmGKBiPA25251.

Polymorphism and mutation databases

BioMutaiBAIAP2.
DMDMi73917636.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000648161 – 552Brain-specific angiogenesis inhibitor 1-associated protein 2Add BLAST552

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei261PhosphoserineCombined sources1
Modified residuei296PhosphothreonineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei325PhosphoserineCombined sources1
Modified residuei336PhosphoserineCombined sources1
Modified residuei340PhosphothreonineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Modified residuei360PhosphothreonineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei384PhosphoserineCombined sources1
Modified residuei395PhosphoserineBy similarity1
Modified residuei454PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine residues by INSR in response to insulin treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UQB8.
PaxDbiQ9UQB8.
PeptideAtlasiQ9UQB8.
PRIDEiQ9UQB8.

2D gel databases

UCD-2DPAGEQ9UQB8.

PTM databases

iPTMnetiQ9UQB8.
PhosphoSitePlusiQ9UQB8.

Expressioni

Tissue specificityi

Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta.3 Publications

Gene expression databases

BgeeiENSG00000175866.
CleanExiHS_BAIAP2.
ExpressionAtlasiQ9UQB8. baseline and differential.
GenevisibleiQ9UQB8. HS.

Organism-specific databases

HPAiHPA023310.
HPA027421.

Interactioni

Subunit structurei

Homodimer. Interacts with CDC42 and RAC1 that have been activated by GTP binding. Interacts with ATN1, BAI1, EPS8, SHANK1, SHANK2, SHANK3, WASF1 and WASF2. Interacts with ENAH after recruitment of CDC42. Interacts with TIAM1 and DIAPH1 (By similarity). Interacts (via SH3 domain) with E.coli effector protein EspF(U) (via PXXP motifs). Interacts with E.coli intimin receptor Tir.By similarity10 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself5EBI-525456,EBI-525456
C19orf25Q9UFG53EBI-525456,EBI-741214
CDC42P609534EBI-6174091,EBI-81752
CDC42P60953-22EBI-525456,EBI-287394
Cdc42Q8CFN22EBI-525456,EBI-7023929From a different organism.
EnahQ031733EBI-525456,EBI-6083294From a different organism.
EPS8Q129298EBI-525456,EBI-375576
Eps8Q085098EBI-525456,EBI-375596From a different organism.
KANK1Q146786EBI-525456,EBI-2556221
KANK1Q14678-24EBI-6174091,EBI-6173812
NCKIPSDQ9NZQ32EBI-525456,EBI-745080
PRR13Q9NZ813EBI-525456,EBI-740924
RAC1P630004EBI-525456,EBI-413628
SF3B4Q154273EBI-525456,EBI-348469
tirQ7DB773EBI-525456,EBI-6480811From a different organism.
TP53BP2Q13625-33EBI-525456,EBI-10175039
VASPP505526EBI-6174091,EBI-748201
WASF2Q9Y6W55EBI-6174091,EBI-4290615
ZDHHC17Q8IUH53EBI-9091996,EBI-524753

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • cytoskeletal adaptor activity Source: ProtInc
  • identical protein binding Source: IntAct
  • proline-rich region binding Source: UniProtKB
  • protein C-terminus binding Source: ProtInc

Protein-protein interaction databases

BioGridi115721. 55 interactors.
DIPiDIP-29272N.
IntActiQ9UQB8. 56 interactors.
MINTiMINT-92955.
STRINGi9606.ENSP00000316338.

Structurei

Secondary structure

1552
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi5 – 22Combined sources18
Helixi24 – 64Combined sources41
Beta strandi66 – 68Combined sources3
Helixi70 – 98Combined sources29
Turni99 – 101Combined sources3
Helixi102 – 146Combined sources45
Helixi150 – 152Combined sources3
Turni154 – 157Combined sources4
Helixi159 – 228Combined sources70
Helixi238 – 246Combined sources9
Helixi281 – 286Combined sources6
Beta strandi378 – 383Combined sources6
Beta strandi401 – 404Combined sources4
Beta strandi406 – 408Combined sources3
Beta strandi413 – 418Combined sources6
Turni419 – 421Combined sources3
Beta strandi424 – 428Combined sources5
Helixi429 – 431Combined sources3
Beta strandi432 – 434Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WDZX-ray2.63A/B1-228[»]
1Y2OX-ray2.20A/B1-250[»]
2YKTX-ray2.11A1-250[»]
3RNJX-ray1.50A375-436[»]
4JS0X-ray1.90B260-291[»]
ProteinModelPortaliQ9UQB8.
SMRiQ9UQB8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UQB8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 250IMDPROSITE-ProRule annotationAdd BLAST250
Domaini374 – 437SH3PROSITE-ProRule annotationAdd BLAST64

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili132 – 153Sequence analysisAdd BLAST22

Domaini

The IMD domain forms a coiled coil. The isolated domain can induce actin bundling and filopodia formation. In the absence of G-proteins intramolecular interaction between the IMD and the SH3 domain gives rise to an auto-inhibited state of the protein. Interaction of the IMD with RAC1 or CDC42 leads to activation.1 Publication
The SH3 domain interacts with ATN1, BAI1, WASF1, WASF2, SHANK1, DIAPH1 and ENAH.1 Publication

Sequence similaritiesi

Contains 1 IMD (IRSp53/MIM homology) domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiENOG410IKMM. Eukaryota.
ENOG41110CD. LUCA.
GeneTreeiENSGT00390000005995.
HOVERGENiHBG054462.
InParanoidiQ9UQB8.
KOiK05627.
PhylomeDBiQ9UQB8.
TreeFamiTF325648.

Family and domain databases

InterProiIPR013606. I-BAR_dom.
IPR030128. IRSp53.
IPR027681. IRSp53/IRTKS/Pinkbar.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR14206. PTHR14206. 1 hit.
PTHR14206:SF3. PTHR14206:SF3. 1 hit.
PfamiPF08397. IMD. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51338. IMD. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UQB8-1) [UniParc]FASTAAdd to basket
Also known as: IRSp53(L)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLSRSEEMH RLTENVYKTI MEQFNPSLRN FIAMGKNYEK ALAGVTYAAK
60 70 80 90 100
GYFDALVKMG ELASESQGSK ELGDVLFQMA EVHRQIQNQL EEMLKSFHNE
110 120 130 140 150
LLTQLEQKVE LDSRYLSAAL KKYQTEQRSK GDALDKCQAE LKKLRKKSQG
160 170 180 190 200
SKNPQKYSDK ELQYIDAISN KQGELENYVS DGYKTALTEE RRRFCFLVEK
210 220 230 240 250
QCAVAKNSAA YHSKGKELLA QKLPLWQQAC ADPSKIPERA VQLMQQVASN
260 270 280 290 300
GATLPSALSA SKSNLVISDP IPGAKPLPVP PELAPFVGRM SAQESTPIMN
310 320 330 340 350
GVTGPDGEDY SPWADRKAAQ PKSLSPPQSQ SKLSDSYSNT LPVRKSVTPK
360 370 380 390 400
NSYATTENKT LPRSSSMAAG LERNGRMRVK AIFSHAAGDN STLLSFKEGD
410 420 430 440 450
LITLLVPEAR DGWHYGESEK TKMRGWFPFS YTRVLDSDGS DRLHMSLQQG
460 470 480 490 500
KSSSTGNLLD KDDLAIPPPD YGAASRAFPA QTASGFKQRP YSVAVPAFSQ
510 520 530 540 550
GLDDYGARSM SRNPFAHVQL KPTVTNDRCD LSAQGPEGRE HGDGSARTLA

GR
Length:552
Mass (Da):60,868
Last modified:May 1, 2000 - v1
Checksum:i3B9EDC6405DCC99D
GO
Isoform 2 (identifier: Q9UQB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-552: CDLSAQGPEGREHGDGSARTLAGR → SAPLLS

Show »
Length:534
Mass (Da):59,014
Checksum:iE63C4C08C48964B7
GO
Isoform 3 (identifier: Q9UQB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     513-552: Missing.

Show »
Length:512
Mass (Da):56,626
Checksum:i985ACC2B8DBEE7C3
GO
Isoform 4 (identifier: Q9UQB8-4) [UniParc]FASTAAdd to basket
Also known as: BAIAP2-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV

Show »
Length:521
Mass (Da):57,359
Checksum:i618A09FDBEB3A5C3
GO
Isoform 5 (identifier: Q9UQB8-5) [UniParc]FASTAAdd to basket
Also known as: BAIAP2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SADVEVARF

Show »
Length:520
Mass (Da):57,445
Checksum:iFC6852BB490F6C0B
GO
Isoform 6 (identifier: Q9UQB8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     356-356: T → TA
     512-552: RNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR → SGSGTLVSTV

Show »
Length:522
Mass (Da):57,430
Checksum:i58146A293AF313BC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti84R → W in BAD96390 (Ref. 4) Curated1
Sequence conflicti415Y → H in BAD96390 (Ref. 4) Curated1
Sequence conflicti473A → T in BAD96390 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050686519Q → R.Corresponds to variant rs4969391dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015502356T → TA in isoform 6. 2 Publications1
Alternative sequenceiVSP_015503512 – 552RNPFA…TLAGR → SGSGTLVSTV in isoform 4 and isoform 6. 4 PublicationsAdd BLAST41
Alternative sequenceiVSP_015504512 – 552RNPFA…TLAGR → SADVEVARF in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_015505513 – 552Missing in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_015506529 – 552CDLSA…TLAGR → SAPLLS in isoform 2. CuratedAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015019 mRNA. Translation: BAA36586.1.
AB015020 mRNA. Translation: BAA36587.1.
AB017119 mRNA. Translation: BAA74773.1.
AB017120 mRNA. Translation: BAA74774.1.
AB104726 Genomic DNA. Translation: BAC57945.1.
AB104726 Genomic DNA. Translation: BAC57946.1.
AB104726 Genomic DNA. Translation: BAC57947.1.
AB104726 Genomic DNA. Translation: BAC57948.1.
AK222670 mRNA. Translation: BAD96390.1.
BC014020 mRNA. Translation: AAH14020.1.
BC032559 mRNA. Translation: AAH32559.1.
U70669 mRNA. Translation: AAB93497.1.
CCDSiCCDS11775.1. [Q9UQB8-1]
CCDS11776.1. [Q9UQB8-5]
CCDS11777.1. [Q9UQB8-4]
CCDS45806.1. [Q9UQB8-2]
RefSeqiNP_001138360.1. NM_001144888.1. [Q9UQB8-2]
NP_006331.1. NM_006340.2. [Q9UQB8-5]
NP_059344.1. NM_017450.2. [Q9UQB8-4]
NP_059345.1. NM_017451.2. [Q9UQB8-1]
XP_005257005.1. XM_005256948.3. [Q9UQB8-6]
UniGeneiHs.128316.

Genome annotation databases

EnsembliENST00000321280; ENSP00000315685; ENSG00000175866. [Q9UQB8-4]
ENST00000321300; ENSP00000316338; ENSG00000175866. [Q9UQB8-1]
ENST00000428708; ENSP00000401022; ENSG00000175866. [Q9UQB8-2]
ENST00000435091; ENSP00000413069; ENSG00000175866. [Q9UQB8-5]
ENST00000575712; ENSP00000458964; ENSG00000175866. [Q9UQB8-3]
GeneIDi10458.
KEGGihsa:10458.
UCSCiuc002jyz.5. human. [Q9UQB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015019 mRNA. Translation: BAA36586.1.
AB015020 mRNA. Translation: BAA36587.1.
AB017119 mRNA. Translation: BAA74773.1.
AB017120 mRNA. Translation: BAA74774.1.
AB104726 Genomic DNA. Translation: BAC57945.1.
AB104726 Genomic DNA. Translation: BAC57946.1.
AB104726 Genomic DNA. Translation: BAC57947.1.
AB104726 Genomic DNA. Translation: BAC57948.1.
AK222670 mRNA. Translation: BAD96390.1.
BC014020 mRNA. Translation: AAH14020.1.
BC032559 mRNA. Translation: AAH32559.1.
U70669 mRNA. Translation: AAB93497.1.
CCDSiCCDS11775.1. [Q9UQB8-1]
CCDS11776.1. [Q9UQB8-5]
CCDS11777.1. [Q9UQB8-4]
CCDS45806.1. [Q9UQB8-2]
RefSeqiNP_001138360.1. NM_001144888.1. [Q9UQB8-2]
NP_006331.1. NM_006340.2. [Q9UQB8-5]
NP_059344.1. NM_017450.2. [Q9UQB8-4]
NP_059345.1. NM_017451.2. [Q9UQB8-1]
XP_005257005.1. XM_005256948.3. [Q9UQB8-6]
UniGeneiHs.128316.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WDZX-ray2.63A/B1-228[»]
1Y2OX-ray2.20A/B1-250[»]
2YKTX-ray2.11A1-250[»]
3RNJX-ray1.50A375-436[»]
4JS0X-ray1.90B260-291[»]
ProteinModelPortaliQ9UQB8.
SMRiQ9UQB8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115721. 55 interactors.
DIPiDIP-29272N.
IntActiQ9UQB8. 56 interactors.
MINTiMINT-92955.
STRINGi9606.ENSP00000316338.

PTM databases

iPTMnetiQ9UQB8.
PhosphoSitePlusiQ9UQB8.

Polymorphism and mutation databases

BioMutaiBAIAP2.
DMDMi73917636.

2D gel databases

UCD-2DPAGEQ9UQB8.

Proteomic databases

EPDiQ9UQB8.
PaxDbiQ9UQB8.
PeptideAtlasiQ9UQB8.
PRIDEiQ9UQB8.

Protocols and materials databases

DNASUi10458.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321280; ENSP00000315685; ENSG00000175866. [Q9UQB8-4]
ENST00000321300; ENSP00000316338; ENSG00000175866. [Q9UQB8-1]
ENST00000428708; ENSP00000401022; ENSG00000175866. [Q9UQB8-2]
ENST00000435091; ENSP00000413069; ENSG00000175866. [Q9UQB8-5]
ENST00000575712; ENSP00000458964; ENSG00000175866. [Q9UQB8-3]
GeneIDi10458.
KEGGihsa:10458.
UCSCiuc002jyz.5. human. [Q9UQB8-1]

Organism-specific databases

CTDi10458.
DisGeNETi10458.
GeneCardsiBAIAP2.
HGNCiHGNC:947. BAIAP2.
HPAiHPA023310.
HPA027421.
MIMi605475. gene.
neXtProtiNX_Q9UQB8.
OpenTargetsiENSG00000175866.
PharmGKBiPA25251.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKMM. Eukaryota.
ENOG41110CD. LUCA.
GeneTreeiENSGT00390000005995.
HOVERGENiHBG054462.
InParanoidiQ9UQB8.
KOiK05627.
PhylomeDBiQ9UQB8.
TreeFamiTF325648.

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.
SignaLinkiQ9UQB8.
SIGNORiQ9UQB8.

Miscellaneous databases

ChiTaRSiBAIAP2. human.
EvolutionaryTraceiQ9UQB8.
GeneWikiiBAIAP2.
GenomeRNAii10458.
PROiQ9UQB8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175866.
CleanExiHS_BAIAP2.
ExpressionAtlasiQ9UQB8. baseline and differential.
GenevisibleiQ9UQB8. HS.

Family and domain databases

InterProiIPR013606. I-BAR_dom.
IPR030128. IRSp53.
IPR027681. IRSp53/IRTKS/Pinkbar.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR14206. PTHR14206. 1 hit.
PTHR14206:SF3. PTHR14206:SF3. 1 hit.
PfamiPF08397. IMD. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51338. IMD. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBAIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9UQB8
Secondary accession number(s): O43858
, Q53HB1, Q86WC1, Q8N5C0, Q96CR7, Q9UBR3, Q9UQ43
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-59 is the initiator.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.