SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UQ88

- CD11A_HUMAN

UniProt

Q9UQ88 - CD11A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cyclin-dependent kinase 11A
Gene
CDK11A, CDC2L2, CDC2L3, PITSLREB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Magnesium.

Enzyme regulationi

Phosphorylation at Thr-436 or Tyr-437 inactivates the enzyme, while phosphorylation at Thr-583 activates it By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei455 – 4551ATP By similarity
Active sitei550 – 5501Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi432 – 4409ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB
  2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
  3. protein kinase activity Source: UniProtKB
  4. protein serine/threonine kinase activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. apoptotic process Source: UniProtKB
  2. mitotic nuclear division Source: UniProtKB
  3. protein phosphorylation Source: UniProtKB
  4. regulation of cell growth Source: UniProtKB
  5. regulation of mRNA processing Source: UniProtKB
  6. regulation of transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Apoptosis, Cell cycle

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
SignaLinkiQ9UQ88.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 11A (EC:2.7.11.22)
Alternative name(s):
Cell division cycle 2-like protein kinase 2
Cell division protein kinase 11A
Galactosyltransferase-associated protein kinase p58/GTA
PITSLRE serine/threonine-protein kinase CDC2L2
Gene namesi
Name:CDK11A
Synonyms:CDC2L2, CDC2L3, PITSLREB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:1730. CDK11A.

Subcellular locationi

Cytoplasm. Nucleus 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 783783Cyclin-dependent kinase 11A
PRO_0000024315Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei470 – 4701Phosphoserine; by CDK7 By similarity
Modified residuei476 – 4761Phosphothreonine; by CDK7 By similarity
Modified residuei577 – 5771Phosphoserine By similarity
Modified residuei582 – 5821Phosphotyrosine By similarity
Modified residuei583 – 5831Phosphothreonine By similarity

Post-translational modificationi

During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9UQ88.
PaxDbiQ9UQ88.
PRIDEiQ9UQ88.

PTM databases

PhosphoSiteiQ9UQ88.

Expressioni

Tissue specificityi

Expressed ubiquitously. Some evidence of isoform-specific tissue distribution.2 Publications

Inductioni

The p58 isoform is specifically induced in G2/M phase of the cell cycle.1 Publication

Gene expression databases

BgeeiQ9UQ88.
GenevestigatoriQ9UQ88.

Organism-specific databases

HPAiCAB010467.
HPA025061.

Interactioni

Subunit structurei

The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1. The p58 isoform but not the p110 isoform or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7.2 Publications

Protein-protein interaction databases

BioGridi609064. 34 interactions.
IntActiQ9UQ88. 25 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9UQ88.
SMRiQ9UQ88. Positions 362-753.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini427 – 647221Protein kinase
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi15 – 381367Glu-rich
Add
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG014652.
InParanoidiQ9UQ88.
KOiK08818.
OMAiWKHARVK.
OrthoDBiEOG74BJS4.
TreeFamiTF101035.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing and alternative initiation. Align

Note: Additional isoforms seem to exist.

Isoform SV6 (identifier: Q9UQ88-1) [UniParc]FASTAAdd to Basket

Also known as: p110

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGDEKDSWKV KTLDEILQEK KRRKEQEEKA EIKRLKNSDD RDSKRDSLEE    50
GELRDHCMEI TIRNSPYRRE DSMEDRGEED DSLAIKPPQQ MSRKEKVHHR 100
KDEKRKEKWK HARVKEREHE RRKRHREEQD KARREWERQK RREMAREHSR 150
RERDRLEQLE RKRERERKMR EQQKEQREQK ERERRAEERR KEREARREVS 200
AHHRTMREDY SDKVKASHWS RSPPRPPRER FELGDGRKPG EARPAPAQKP 250
AQLKEEKMEE RDLLSDLQDI SDSERKTSSA ESSSAESGSG SEEEEEEEEE 300
EEEEGSTSEE SEEEEEEEEE EEEETGSNSE EASEQSAEEV SEEEMSEDEE 350
RENENHLLVV PESRFDRDSG ESEEAEEEVG EGTPQSSALT EGDYVPDSPA 400
LLPIELKQEL PKYLPALQGC RSVEEFQCLN RIEEGTYGVV YRAKDKKTDE 450
IVALKRLKME KEKEGFPITS LREINTILKA QHPNIVTVRE IVVGSNMDKI 500
YIVMNYVEHD LKSLMETMKQ PFLPGEVKTL MIQLLRGVKH LHDNWILHRD 550
LKTSNLLLSH AGILKVGDFG LAREYGSPLK AYTPVVVTQW YRAPELLLGA 600
KEYSTAVDMW SVGCIFGELL TQKPLFPGNS EIDQINKVFK ELGTPSEKIW 650
PGYSELPVVK KMTFSEHPYN NLRKRFGALL SDQGFDLMNK FLTYFPGRRI 700
SAEDGLKHEY FRETPLPIDP SMFPTWPAKS EQQRVKRGTS PRPPEGGLGY 750
SQLGDDDLKE TGFHLTTTNQ GASAAGPGFS LKF 783
Length:783
Mass (Da):91,362
Last modified:January 11, 2011 - v4
Checksum:i1BCF67EB180F37C6
GO
Isoform SV1 (identifier: Q9UQ88-2) [UniParc]FASTAAdd to Basket

Also known as: Pbeta21, Beta 2-1

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: W → CRHHSHSAEGG
     240-253: GEARPAPAQKPAQL → V

Show »
Length:780
Mass (Da):91,018
Checksum:i5AA5206CBAFAA15B
GO
Isoform SV2 (identifier: Q9UQ88-3) [UniParc]FASTAAdd to Basket

Also known as: Pbeta22

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V

Show »
Length:779
Mass (Da):91,055
Checksum:i519C680FC20A1250
GO
Isoform SV3 (identifier: Q9UQ88-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-253: GEARPAPAQKPAQL → V

Show »
Length:770
Mass (Da):90,045
Checksum:i44D5D04CACDB2519
GO
Isoform SV7 (identifier: Q9UQ88-5) [UniParc]FASTAAdd to Basket

Also known as: SV8

The sequence of this isoform differs from the canonical sequence as follows:
     1-386: Missing.
     387-418: SALTEGDYVPDSPALLPIELKQELPKYLPALQ → MKNEKMKTTSWLFQSHGSTEIPGRVKKQRKKW

Show »
Length:397
Mass (Da):45,229
Checksum:i36B4BA8EE75D95C6
GO
Isoform SV12 (identifier: Q9UQ88-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-616: Missing.
     617-658: GELLTQKPLF...IWPGYSELPV → MGKTEEKGNG...QDAGAAEGAA

Show »
Length:167
Mass (Da):18,110
Checksum:iF769BDEC242A9044
GO
Isoform SV13 (identifier: Q9UQ88-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.
     153-153: R → RGNDGFCLFR
     240-253: GEARPAPAQKPAQL → V
     567-600: GDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA → SPPPSGPSQGDPPGPTHSRPSVVAGG
     601-783: Missing.

Show »
Length:531
Mass (Da):62,316
Checksum:i1BAA7CD839B07A06
GO
Isoform 4 (identifier: Q9UQ88-10) [UniParc]FASTAAdd to Basket

Also known as: Beta 1, p58

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.

Note: Produced by alternative initiation at Met-345 of isoform SV6.

Show »
Length:439
Mass (Da):49,624
Checksum:i3DCA65216905266A
GO

Sequence cautioni

The sequence AAC95297.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAC95298.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAC95299.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAC95300.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAC95302.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence AAC95303.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti57 – 571C → R.
Corresponds to variant rs17424353 [ dbSNP | Ensembl ].
VAR_060152
Natural varianti92 – 921S → P.
Corresponds to variant rs7531938 [ dbSNP | Ensembl ].
VAR_062200
Natural varianti93 – 931R → W.2 Publications
Corresponds to variant rs1059831 [ dbSNP | Ensembl ].
VAR_031716
Natural varianti402 – 4021L → S.1 Publication
Corresponds to variant rs1059828 [ dbSNP | Ensembl ].
VAR_031717
Natural varianti658 – 6581V → A.
Corresponds to variant rs1059811 [ dbSNP | Ensembl ].
VAR_060153

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 616616Missing in isoform SV12.
VSP_008284Add
BLAST
Alternative sequencei1 – 386386Missing in isoform SV7.
VSP_008283Add
BLAST
Alternative sequencei1 – 344344Missing in isoform 4.
VSP_018836Add
BLAST
Alternative sequencei1 – 5757Missing in isoform SV13.
VSP_008281Add
BLAST
Alternative sequencei109 – 1091W → CRHHSHSAEGG in isoform SV1.
VSP_008286
Alternative sequencei153 – 1531R → RGNDGFCLFR in isoform SV2 and isoform SV13.
VSP_008287
Alternative sequencei240 – 25314GEARP…KPAQL → V in isoform SV1, isoform SV2, isoform SV3 and isoform SV13.
VSP_008288Add
BLAST
Alternative sequencei387 – 41832SALTE…LPALQ → MKNEKMKTTSWLFQSHGSTE IPGRVKKQRKKW in isoform SV7.
VSP_008289Add
BLAST
Alternative sequencei567 – 60034GDFGL…LLLGA → SPPPSGPSQGDPPGPTHSRP SVVAGG in isoform SV13.
VSP_008290Add
BLAST
Alternative sequencei601 – 783183Missing in isoform SV13.
VSP_008291Add
BLAST
Alternative sequencei617 – 65842GELLT…SELPV → MGKTEEKGNGKGAFQERKGP LGAVRKEAGAGAQDAGAAEG AA in isoform SV12.
VSP_008292Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti109 – 1091Missing in AAA19594. 1 Publication
Sequence conflicti109 – 1091Missing in AAA19595. 1 Publication
Sequence conflicti246 – 2461P → R in AAC72087. 1 Publication
Sequence conflicti312 – 3143Missing in AAA19594. 1 Publication
Sequence conflicti312 – 3143Missing in AAA19595. 1 Publication
Sequence conflicti312 – 3143Missing in AAC72084. 1 Publication
Sequence conflicti312 – 3143Missing in AAC72085. 1 Publication
Sequence conflicti312 – 3143Missing in AAC72086. 1 Publication
Sequence conflicti312 – 3143Missing in AAC72087. 1 Publication
Sequence conflicti312 – 3143Missing in AAC72090. 1 Publication
Sequence conflicti424 – 4241E → D in AAA19585. 1 Publication
Sequence conflicti424 – 4241E → D in AAA19594. 1 Publication
Sequence conflicti424 – 4241E → D in AAA19595. 1 Publication
Sequence conflicti463 – 4631K → N in AAA19585. 1 Publication
Sequence conflicti463 – 4631K → N in AAA19594. 1 Publication
Sequence conflicti463 – 4631K → N in AAA19595. 1 Publication
Sequence conflicti666 – 6661E → R in AAA19585. 1 Publication
Sequence conflicti666 – 6661E → R in AAA19594. 1 Publication
Sequence conflicti666 – 6661E → R in AAA19595. 1 Publication
Sequence conflicti682 – 6821D → E in AAA19585. 1 Publication
Sequence conflicti682 – 6821D → E in AAA19594. 1 Publication
Sequence conflicti682 – 6821D → E in AAA19595. 1 Publication
Isoform SV1 (identifier: Q9UQ88-2)
Sequence conflicti109 – 1091C → R in AAA19594. 1 Publication
Sequence conflicti112 – 1121H → R in AAA19594. 1 Publication
Isoform SV2 (identifier: Q9UQ88-3)
Sequence conflicti158 – 1581F → V in AAA19595. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U04819 mRNA. Translation: AAA19585.1.
U07704 mRNA. Translation: AAA19594.1.
U07705 mRNA. Translation: AAA19595.1.
AF067518 mRNA. Translation: AAC72083.1.
AF067519 mRNA. Translation: AAC72084.1.
AF067520 mRNA. Translation: AAC72085.1.
AF067521 mRNA. Translation: AAC72086.1.
AF067522 mRNA. Translation: AAC72087.1.
AF067523 mRNA. Translation: AAC72088.1.
AF067524 mRNA. Translation: AAC72089.1.
AF067525 mRNA. Translation: AAC72090.1.
AF067526 mRNA. Translation: AAC72091.1.
AF067527 mRNA. Translation: AAC72092.1.
AF067528 mRNA. Translation: AAC72093.1.
AF067529 mRNA. Translation: AAC72094.1.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95297.1. Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95298.1. Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95299.1. Sequence problems.
AF080694
, AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95300.1. Sequence problems.
AF080697
, AF080695, AF105714, AF080696 Genomic DNA. Translation: AAC95302.1. Sequence problems.
AF080697
, AF080695, AF105714, AF080696 Genomic DNA. Translation: AAC95303.1. Sequence problems.
AL031282 Genomic DNA. Translation: CAI20032.1.
AL031282 Genomic DNA. Translation: CAI20033.1.
AL031282 Genomic DNA. Translation: CAI20034.1.
BC110905 mRNA. Translation: AAI10906.1.
CCDSiCCDS44042.1. [Q9UQ88-2]
CCDS44043.1. [Q9UQ88-4]
PIRiB54024.
E54024.
F54024.
H54024.
RefSeqiNP_076916.2. NM_024011.2. [Q9UQ88-2]
NP_277071.2. NM_033529.2. [Q9UQ88-4]
UniGeneiHs.651228.
Hs.709182.

Genome annotation databases

EnsembliENST00000358779; ENSP00000351629; ENSG00000008128. [Q9UQ88-4]
ENST00000378633; ENSP00000367900; ENSG00000008128. [Q9UQ88-1]
ENST00000404249; ENSP00000384442; ENSG00000008128. [Q9UQ88-2]
GeneIDi728642.
KEGGihsa:728642.
UCSCiuc001ahj.4. human. [Q9UQ88-5]
uc009vkr.3. human. [Q9UQ88-4]
uc009vks.3. human. [Q9UQ88-2]

Polymorphism databases

DMDMi317373559.

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U04819 mRNA. Translation: AAA19585.1 .
U07704 mRNA. Translation: AAA19594.1 .
U07705 mRNA. Translation: AAA19595.1 .
AF067518 mRNA. Translation: AAC72083.1 .
AF067519 mRNA. Translation: AAC72084.1 .
AF067520 mRNA. Translation: AAC72085.1 .
AF067521 mRNA. Translation: AAC72086.1 .
AF067522 mRNA. Translation: AAC72087.1 .
AF067523 mRNA. Translation: AAC72088.1 .
AF067524 mRNA. Translation: AAC72089.1 .
AF067525 mRNA. Translation: AAC72090.1 .
AF067526 mRNA. Translation: AAC72091.1 .
AF067527 mRNA. Translation: AAC72092.1 .
AF067528 mRNA. Translation: AAC72093.1 .
AF067529 mRNA. Translation: AAC72094.1 .
AF080694
, AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95297.1 . Sequence problems.
AF080694
, AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95298.1 . Sequence problems.
AF080694
, AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95299.1 . Sequence problems.
AF080694
, AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95300.1 . Sequence problems.
AF080697
, AF080695 , AF105714 , AF080696 Genomic DNA. Translation: AAC95302.1 . Sequence problems.
AF080697
, AF080695 , AF105714 , AF080696 Genomic DNA. Translation: AAC95303.1 . Sequence problems.
AL031282 Genomic DNA. Translation: CAI20032.1 .
AL031282 Genomic DNA. Translation: CAI20033.1 .
AL031282 Genomic DNA. Translation: CAI20034.1 .
BC110905 mRNA. Translation: AAI10906.1 .
CCDSi CCDS44042.1. [Q9UQ88-2 ]
CCDS44043.1. [Q9UQ88-4 ]
PIRi B54024.
E54024.
F54024.
H54024.
RefSeqi NP_076916.2. NM_024011.2. [Q9UQ88-2 ]
NP_277071.2. NM_033529.2. [Q9UQ88-4 ]
UniGenei Hs.651228.
Hs.709182.

3D structure databases

ProteinModelPortali Q9UQ88.
SMRi Q9UQ88. Positions 362-753.
ModBasei Search...

Protein-protein interaction databases

BioGridi 609064. 34 interactions.
IntActi Q9UQ88. 25 interactions.

Chemistry

BindingDBi Q9UQ88.
ChEMBLi CHEMBL5416.
GuidetoPHARMACOLOGYi 1963.

PTM databases

PhosphoSitei Q9UQ88.

Polymorphism databases

DMDMi 317373559.

Proteomic databases

MaxQBi Q9UQ88.
PaxDbi Q9UQ88.
PRIDEi Q9UQ88.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358779 ; ENSP00000351629 ; ENSG00000008128 . [Q9UQ88-4 ]
ENST00000378633 ; ENSP00000367900 ; ENSG00000008128 . [Q9UQ88-1 ]
ENST00000404249 ; ENSP00000384442 ; ENSG00000008128 . [Q9UQ88-2 ]
GeneIDi 728642.
KEGGi hsa:728642.
UCSCi uc001ahj.4. human. [Q9UQ88-5 ]
uc009vkr.3. human. [Q9UQ88-4 ]
uc009vks.3. human. [Q9UQ88-2 ]

Organism-specific databases

CTDi 728642.
GeneCardsi GC01M001634.
HGNCi HGNC:1730. CDK11A.
HPAi CAB010467.
HPA025061.
MIMi 116951. gene.
neXtProti NX_Q9UQ88.
PharmGKBi PA26263.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG014652.
InParanoidi Q9UQ88.
KOi K08818.
OMAi WKHARVK.
OrthoDBi EOG74BJS4.
TreeFami TF101035.

Enzyme and pathway databases

Reactomei REACT_15296. Recruitment of mitotic centrosome proteins and complexes.
SignaLinki Q9UQ88.

Miscellaneous databases

GeneWikii CDC2L2.
GenomeRNAii 728642.
NextBioi 127852.
PROi Q9UQ88.
SOURCEi Search...

Gene expression databases

Bgeei Q9UQ88.
Genevestigatori Q9UQ88.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms."
    Xiang J., Lahti J.M., Grenet J.A., Easton J.B., Kidd V.J.
    J. Biol. Chem. 269:15786-15794(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2 AND 4), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANT SER-402.
    Tissue: Cervix carcinoma.
  2. "Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2."
    Gururajan R., Lahti J.M., Grenet J.A., Easton J., Gruber I., Ambros P.F., Kidd V.J.
    Genome Res. 8:929-939(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2; SV3; SV6; SV7; SV12 AND SV13), TISSUE SPECIFICITY, VARIANT TRP-93.
    Tissue: Cervix carcinoma.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TRP-93.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SV7).
    Tissue: Skin.
  5. Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CCNL1 AND SFRS7.
  6. "Identification and characterization of a novel cell cycle-regulated internal ribosome entry site."
    Cornelis S., Bruynooghe Y., Denecker G., Van Huffel S., Tinton S., Beyaert R.
    Mol. Cell 5:597-605(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE INITIATION (ISOFORM 4), INDUCTION.
  7. "The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis."
    Chen S., Yin X., Zhu X., Yan J., Ji S., Chen C., Cai M., Zhang S., Zong H., Hu Y., Yuan Z., Shen Z., Gu J.
    J. Biol. Chem. 278:20029-20036(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH PAK1.

Entry informationi

Entry nameiCD11A_HUMAN
AccessioniPrimary (citable) accession number: Q9UQ88
Secondary accession number(s): O95227
, O95228, O96012, Q12821, Q12853, Q12854, Q2TAJ0, Q5QPR0, Q5QPR1, Q5QPR2, Q9UBC4, Q9UBI3, Q9UEI1, Q9UEI2, Q9UP53, Q9UP54, Q9UP55, Q9UP56, Q9UQ86, Q9UQ87, Q9UQ89
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 11, 2011
Last modified: September 3, 2014
This is version 138 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Duplicated gene. CDK11A and CDK11B encode almost identical protein kinases of 110 kDa that contain at their C-termini the open reading frame of a smaller 58 kDa isoform which is expressed following IRES-mediated alternative initiation of translation.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi