Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UQ88

- CD11A_HUMAN

UniProt

Q9UQ88 - CD11A_HUMAN

Protein

Cyclin-dependent kinase 11A

Gene

CDK11A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 4 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.2 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Cofactori

    Magnesium.

    Enzyme regulationi

    Phosphorylation at Thr-436 or Tyr-437 inactivates the enzyme, while phosphorylation at Thr-583 activates it.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei455 – 4551ATPPROSITE-ProRule annotation
    Active sitei550 – 5501Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi432 – 4409ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB
    2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
    3. protein kinase activity Source: UniProtKB
    4. protein serine/threonine kinase activity Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: UniProtKB
    2. mitotic nuclear division Source: UniProtKB
    3. protein phosphorylation Source: UniProtKB
    4. regulation of cell growth Source: UniProtKB
    5. regulation of mRNA processing Source: UniProtKB
    6. regulation of transcription, DNA-templated Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Biological processi

    Apoptosis, Cell cycle

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    SignaLinkiQ9UQ88.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase 11A (EC:2.7.11.22)
    Alternative name(s):
    Cell division cycle 2-like protein kinase 2
    Cell division protein kinase 11A
    Galactosyltransferase-associated protein kinase p58/GTA
    PITSLRE serine/threonine-protein kinase CDC2L2
    Gene namesi
    Name:CDK11A
    Synonyms:CDC2L2, CDC2L3, PITSLREB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:1730. CDK11A.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26263.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 783783Cyclin-dependent kinase 11APRO_0000024315Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei470 – 4701Phosphoserine; by CDK7By similarity
    Modified residuei476 – 4761Phosphothreonine; by CDK7By similarity
    Modified residuei577 – 5771PhosphoserineBy similarity
    Modified residuei582 – 5821PhosphotyrosineBy similarity
    Modified residuei583 – 5831PhosphothreonineBy similarity

    Post-translational modificationi

    During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins.

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9UQ88.
    PaxDbiQ9UQ88.
    PRIDEiQ9UQ88.

    PTM databases

    PhosphoSiteiQ9UQ88.

    Expressioni

    Tissue specificityi

    Expressed ubiquitously. Some evidence of isoform-specific tissue distribution.2 Publications

    Inductioni

    The p58 isoform is specifically induced in G2/M phase of the cell cycle.1 Publication

    Gene expression databases

    BgeeiQ9UQ88.
    GenevestigatoriQ9UQ88.

    Organism-specific databases

    HPAiCAB010467.
    HPA025061.

    Interactioni

    Subunit structurei

    The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1. The p58 isoform but not the p110 isoform or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7.2 Publications

    Protein-protein interaction databases

    BioGridi609064. 34 interactions.
    IntActiQ9UQ88. 26 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UQ88.
    SMRiQ9UQ88. Positions 362-753.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini427 – 647221Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi15 – 381367Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG014652.
    InParanoidiQ9UQ88.
    KOiK08818.
    OMAiWKHARVK.
    OrthoDBiEOG74BJS4.
    TreeFamiTF101035.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing and alternative initiation. Align

    Note: Additional isoforms seem to exist.

    Isoform SV6 (identifier: Q9UQ88-1) [UniParc]FASTAAdd to Basket

    Also known as: p110

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDEKDSWKV KTLDEILQEK KRRKEQEEKA EIKRLKNSDD RDSKRDSLEE    50
    GELRDHCMEI TIRNSPYRRE DSMEDRGEED DSLAIKPPQQ MSRKEKVHHR 100
    KDEKRKEKWK HARVKEREHE RRKRHREEQD KARREWERQK RREMAREHSR 150
    RERDRLEQLE RKRERERKMR EQQKEQREQK ERERRAEERR KEREARREVS 200
    AHHRTMREDY SDKVKASHWS RSPPRPPRER FELGDGRKPG EARPAPAQKP 250
    AQLKEEKMEE RDLLSDLQDI SDSERKTSSA ESSSAESGSG SEEEEEEEEE 300
    EEEEGSTSEE SEEEEEEEEE EEEETGSNSE EASEQSAEEV SEEEMSEDEE 350
    RENENHLLVV PESRFDRDSG ESEEAEEEVG EGTPQSSALT EGDYVPDSPA 400
    LLPIELKQEL PKYLPALQGC RSVEEFQCLN RIEEGTYGVV YRAKDKKTDE 450
    IVALKRLKME KEKEGFPITS LREINTILKA QHPNIVTVRE IVVGSNMDKI 500
    YIVMNYVEHD LKSLMETMKQ PFLPGEVKTL MIQLLRGVKH LHDNWILHRD 550
    LKTSNLLLSH AGILKVGDFG LAREYGSPLK AYTPVVVTQW YRAPELLLGA 600
    KEYSTAVDMW SVGCIFGELL TQKPLFPGNS EIDQINKVFK ELGTPSEKIW 650
    PGYSELPVVK KMTFSEHPYN NLRKRFGALL SDQGFDLMNK FLTYFPGRRI 700
    SAEDGLKHEY FRETPLPIDP SMFPTWPAKS EQQRVKRGTS PRPPEGGLGY 750
    SQLGDDDLKE TGFHLTTTNQ GASAAGPGFS LKF 783
    Length:783
    Mass (Da):91,362
    Last modified:January 11, 2011 - v4
    Checksum:i1BCF67EB180F37C6
    GO
    Isoform SV1 (identifier: Q9UQ88-2) [UniParc]FASTAAdd to Basket

    Also known as: Pbeta21, Beta 2-1

    The sequence of this isoform differs from the canonical sequence as follows:
         109-109: W → CRHHSHSAEGG
         240-253: GEARPAPAQKPAQL → V

    Show »
    Length:780
    Mass (Da):91,018
    Checksum:i5AA5206CBAFAA15B
    GO
    Isoform SV2 (identifier: Q9UQ88-3) [UniParc]FASTAAdd to Basket

    Also known as: Pbeta22

    The sequence of this isoform differs from the canonical sequence as follows:
         153-153: R → RGNDGFCLFR
         240-253: GEARPAPAQKPAQL → V

    Show »
    Length:779
    Mass (Da):91,055
    Checksum:i519C680FC20A1250
    GO
    Isoform SV3 (identifier: Q9UQ88-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         240-253: GEARPAPAQKPAQL → V

    Show »
    Length:770
    Mass (Da):90,045
    Checksum:i44D5D04CACDB2519
    GO
    Isoform SV7 (identifier: Q9UQ88-5) [UniParc]FASTAAdd to Basket

    Also known as: SV8

    The sequence of this isoform differs from the canonical sequence as follows:
         1-386: Missing.
         387-418: SALTEGDYVPDSPALLPIELKQELPKYLPALQ → MKNEKMKTTSWLFQSHGSTEIPGRVKKQRKKW

    Show »
    Length:397
    Mass (Da):45,229
    Checksum:i36B4BA8EE75D95C6
    GO
    Isoform SV12 (identifier: Q9UQ88-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-616: Missing.
         617-658: GELLTQKPLF...IWPGYSELPV → MGKTEEKGNG...QDAGAAEGAA

    Show »
    Length:167
    Mass (Da):18,110
    Checksum:iF769BDEC242A9044
    GO
    Isoform SV13 (identifier: Q9UQ88-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: Missing.
         153-153: R → RGNDGFCLFR
         240-253: GEARPAPAQKPAQL → V
         567-600: GDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA → SPPPSGPSQGDPPGPTHSRPSVVAGG
         601-783: Missing.

    Show »
    Length:531
    Mass (Da):62,316
    Checksum:i1BAA7CD839B07A06
    GO
    Isoform 4 (identifier: Q9UQ88-10) [UniParc]FASTAAdd to Basket

    Also known as: Beta 1, p58

    The sequence of this isoform differs from the canonical sequence as follows:
         1-344: Missing.

    Note: Produced by alternative initiation at Met-345 of isoform SV6.

    Show »
    Length:439
    Mass (Da):49,624
    Checksum:i3DCA65216905266A
    GO

    Sequence cautioni

    The sequence AAC95297.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAC95298.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAC95299.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAC95300.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAC95302.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AAC95303.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti109 – 1091Missing in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti109 – 1091Missing in AAA19595. (PubMed:8195233)Curated
    Sequence conflicti246 – 2461P → R in AAC72087. (PubMed:9750192)Curated
    Sequence conflicti312 – 3143Missing in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti312 – 3143Missing in AAA19595. (PubMed:8195233)Curated
    Sequence conflicti312 – 3143Missing in AAC72084. (PubMed:9750192)Curated
    Sequence conflicti312 – 3143Missing in AAC72085. (PubMed:9750192)Curated
    Sequence conflicti312 – 3143Missing in AAC72086. (PubMed:9750192)Curated
    Sequence conflicti312 – 3143Missing in AAC72087. (PubMed:9750192)Curated
    Sequence conflicti312 – 3143Missing in AAC72090. (PubMed:9750192)Curated
    Sequence conflicti424 – 4241E → D in AAA19585. (PubMed:8195233)Curated
    Sequence conflicti424 – 4241E → D in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti424 – 4241E → D in AAA19595. (PubMed:8195233)Curated
    Sequence conflicti463 – 4631K → N in AAA19585. (PubMed:8195233)Curated
    Sequence conflicti463 – 4631K → N in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti463 – 4631K → N in AAA19595. (PubMed:8195233)Curated
    Sequence conflicti666 – 6661E → R in AAA19585. (PubMed:8195233)Curated
    Sequence conflicti666 – 6661E → R in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti666 – 6661E → R in AAA19595. (PubMed:8195233)Curated
    Sequence conflicti682 – 6821D → E in AAA19585. (PubMed:8195233)Curated
    Sequence conflicti682 – 6821D → E in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti682 – 6821D → E in AAA19595. (PubMed:8195233)Curated
    Isoform SV1 (identifier: Q9UQ88-2)
    Sequence conflicti109 – 1091C → R in AAA19594. (PubMed:8195233)Curated
    Sequence conflicti112 – 1121H → R in AAA19594. (PubMed:8195233)Curated
    Isoform SV2 (identifier: Q9UQ88-3)
    Sequence conflicti158 – 1581F → V in AAA19595. (PubMed:8195233)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti57 – 571C → R.
    Corresponds to variant rs17424353 [ dbSNP | Ensembl ].
    VAR_060152
    Natural varianti92 – 921S → P.
    Corresponds to variant rs7531938 [ dbSNP | Ensembl ].
    VAR_062200
    Natural varianti93 – 931R → W.2 Publications
    Corresponds to variant rs1059831 [ dbSNP | Ensembl ].
    VAR_031716
    Natural varianti402 – 4021L → S.1 Publication
    Corresponds to variant rs1059828 [ dbSNP | Ensembl ].
    VAR_031717
    Natural varianti658 – 6581V → A.
    Corresponds to variant rs1059811 [ dbSNP | Ensembl ].
    VAR_060153

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 616616Missing in isoform SV12. 1 PublicationVSP_008284Add
    BLAST
    Alternative sequencei1 – 386386Missing in isoform SV7. 2 PublicationsVSP_008283Add
    BLAST
    Alternative sequencei1 – 344344Missing in isoform 4. 1 PublicationVSP_018836Add
    BLAST
    Alternative sequencei1 – 5757Missing in isoform SV13. 1 PublicationVSP_008281Add
    BLAST
    Alternative sequencei109 – 1091W → CRHHSHSAEGG in isoform SV1. 2 PublicationsVSP_008286
    Alternative sequencei153 – 1531R → RGNDGFCLFR in isoform SV2 and isoform SV13. 2 PublicationsVSP_008287
    Alternative sequencei240 – 25314GEARP…KPAQL → V in isoform SV1, isoform SV2, isoform SV3 and isoform SV13. 2 PublicationsVSP_008288Add
    BLAST
    Alternative sequencei387 – 41832SALTE…LPALQ → MKNEKMKTTSWLFQSHGSTE IPGRVKKQRKKW in isoform SV7. 2 PublicationsVSP_008289Add
    BLAST
    Alternative sequencei567 – 60034GDFGL…LLLGA → SPPPSGPSQGDPPGPTHSRP SVVAGG in isoform SV13. 1 PublicationVSP_008290Add
    BLAST
    Alternative sequencei601 – 783183Missing in isoform SV13. 1 PublicationVSP_008291Add
    BLAST
    Alternative sequencei617 – 65842GELLT…SELPV → MGKTEEKGNGKGAFQERKGP LGAVRKEAGAGAQDAGAAEG AA in isoform SV12. 1 PublicationVSP_008292Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04819 mRNA. Translation: AAA19585.1.
    U07704 mRNA. Translation: AAA19594.1.
    U07705 mRNA. Translation: AAA19595.1.
    AF067518 mRNA. Translation: AAC72083.1.
    AF067519 mRNA. Translation: AAC72084.1.
    AF067520 mRNA. Translation: AAC72085.1.
    AF067521 mRNA. Translation: AAC72086.1.
    AF067522 mRNA. Translation: AAC72087.1.
    AF067523 mRNA. Translation: AAC72088.1.
    AF067524 mRNA. Translation: AAC72089.1.
    AF067525 mRNA. Translation: AAC72090.1.
    AF067526 mRNA. Translation: AAC72091.1.
    AF067527 mRNA. Translation: AAC72092.1.
    AF067528 mRNA. Translation: AAC72093.1.
    AF067529 mRNA. Translation: AAC72094.1.
    AF080694
    , AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95297.1. Sequence problems.
    AF080694
    , AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95298.1. Sequence problems.
    AF080694
    , AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95299.1. Sequence problems.
    AF080694
    , AF080695, AF105714, AF080696, AF080697, AF092427, AF092428, AF080689, AF080690, AF080691, AF080692, AF080693 Genomic DNA. Translation: AAC95300.1. Sequence problems.
    AF080697
    , AF080695, AF105714, AF080696 Genomic DNA. Translation: AAC95302.1. Sequence problems.
    AF080697
    , AF080695, AF105714, AF080696 Genomic DNA. Translation: AAC95303.1. Sequence problems.
    AL031282 Genomic DNA. Translation: CAI20032.1.
    AL031282 Genomic DNA. Translation: CAI20033.1.
    AL031282 Genomic DNA. Translation: CAI20034.1.
    BC110905 mRNA. Translation: AAI10906.1.
    CCDSiCCDS44042.1. [Q9UQ88-2]
    CCDS44043.1. [Q9UQ88-4]
    PIRiB54024.
    E54024.
    F54024.
    H54024.
    RefSeqiNP_076916.2. NM_024011.2. [Q9UQ88-2]
    NP_277071.2. NM_033529.2. [Q9UQ88-4]
    UniGeneiHs.651228.
    Hs.709182.

    Genome annotation databases

    EnsembliENST00000358779; ENSP00000351629; ENSG00000008128. [Q9UQ88-4]
    ENST00000378633; ENSP00000367900; ENSG00000008128. [Q9UQ88-1]
    ENST00000404249; ENSP00000384442; ENSG00000008128. [Q9UQ88-2]
    GeneIDi728642.
    KEGGihsa:728642.
    UCSCiuc001ahj.4. human. [Q9UQ88-5]
    uc009vkr.3. human. [Q9UQ88-4]
    uc009vks.3. human. [Q9UQ88-2]

    Polymorphism databases

    DMDMi317373559.

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04819 mRNA. Translation: AAA19585.1 .
    U07704 mRNA. Translation: AAA19594.1 .
    U07705 mRNA. Translation: AAA19595.1 .
    AF067518 mRNA. Translation: AAC72083.1 .
    AF067519 mRNA. Translation: AAC72084.1 .
    AF067520 mRNA. Translation: AAC72085.1 .
    AF067521 mRNA. Translation: AAC72086.1 .
    AF067522 mRNA. Translation: AAC72087.1 .
    AF067523 mRNA. Translation: AAC72088.1 .
    AF067524 mRNA. Translation: AAC72089.1 .
    AF067525 mRNA. Translation: AAC72090.1 .
    AF067526 mRNA. Translation: AAC72091.1 .
    AF067527 mRNA. Translation: AAC72092.1 .
    AF067528 mRNA. Translation: AAC72093.1 .
    AF067529 mRNA. Translation: AAC72094.1 .
    AF080694
    , AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95297.1 . Sequence problems.
    AF080694
    , AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95298.1 . Sequence problems.
    AF080694
    , AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95299.1 . Sequence problems.
    AF080694
    , AF080695 , AF105714 , AF080696 , AF080697 , AF092427 , AF092428 , AF080689 , AF080690 , AF080691 , AF080692 , AF080693 Genomic DNA. Translation: AAC95300.1 . Sequence problems.
    AF080697
    , AF080695 , AF105714 , AF080696 Genomic DNA. Translation: AAC95302.1 . Sequence problems.
    AF080697
    , AF080695 , AF105714 , AF080696 Genomic DNA. Translation: AAC95303.1 . Sequence problems.
    AL031282 Genomic DNA. Translation: CAI20032.1 .
    AL031282 Genomic DNA. Translation: CAI20033.1 .
    AL031282 Genomic DNA. Translation: CAI20034.1 .
    BC110905 mRNA. Translation: AAI10906.1 .
    CCDSi CCDS44042.1. [Q9UQ88-2 ]
    CCDS44043.1. [Q9UQ88-4 ]
    PIRi B54024.
    E54024.
    F54024.
    H54024.
    RefSeqi NP_076916.2. NM_024011.2. [Q9UQ88-2 ]
    NP_277071.2. NM_033529.2. [Q9UQ88-4 ]
    UniGenei Hs.651228.
    Hs.709182.

    3D structure databases

    ProteinModelPortali Q9UQ88.
    SMRi Q9UQ88. Positions 362-753.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 609064. 34 interactions.
    IntActi Q9UQ88. 26 interactions.

    Chemistry

    BindingDBi Q9UQ88.
    ChEMBLi CHEMBL5416.
    GuidetoPHARMACOLOGYi 1963.

    PTM databases

    PhosphoSitei Q9UQ88.

    Polymorphism databases

    DMDMi 317373559.

    Proteomic databases

    MaxQBi Q9UQ88.
    PaxDbi Q9UQ88.
    PRIDEi Q9UQ88.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358779 ; ENSP00000351629 ; ENSG00000008128 . [Q9UQ88-4 ]
    ENST00000378633 ; ENSP00000367900 ; ENSG00000008128 . [Q9UQ88-1 ]
    ENST00000404249 ; ENSP00000384442 ; ENSG00000008128 . [Q9UQ88-2 ]
    GeneIDi 728642.
    KEGGi hsa:728642.
    UCSCi uc001ahj.4. human. [Q9UQ88-5 ]
    uc009vkr.3. human. [Q9UQ88-4 ]
    uc009vks.3. human. [Q9UQ88-2 ]

    Organism-specific databases

    CTDi 728642.
    GeneCardsi GC01M001634.
    HGNCi HGNC:1730. CDK11A.
    HPAi CAB010467.
    HPA025061.
    MIMi 116951. gene.
    neXtProti NX_Q9UQ88.
    PharmGKBi PA26263.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG014652.
    InParanoidi Q9UQ88.
    KOi K08818.
    OMAi WKHARVK.
    OrthoDBi EOG74BJS4.
    TreeFami TF101035.

    Enzyme and pathway databases

    Reactomei REACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    SignaLinki Q9UQ88.

    Miscellaneous databases

    GeneWikii CDC2L2.
    GenomeRNAii 728642.
    NextBioi 127852.
    PROi Q9UQ88.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9UQ88.
    Genevestigatori Q9UQ88.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms."
      Xiang J., Lahti J.M., Grenet J.A., Easton J.B., Kidd V.J.
      J. Biol. Chem. 269:15786-15794(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2 AND 4), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANT SER-402.
      Tissue: Cervix carcinoma.
    2. "Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2."
      Gururajan R., Lahti J.M., Grenet J.A., Easton J., Gruber I., Ambros P.F., Kidd V.J.
      Genome Res. 8:929-939(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2; SV3; SV6; SV7; SV12 AND SV13), TISSUE SPECIFICITY, VARIANT TRP-93.
      Tissue: Cervix carcinoma.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TRP-93.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SV7).
      Tissue: Skin.
    5. Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CCNL1 AND SFRS7.
    6. "Identification and characterization of a novel cell cycle-regulated internal ribosome entry site."
      Cornelis S., Bruynooghe Y., Denecker G., Van Huffel S., Tinton S., Beyaert R.
      Mol. Cell 5:597-605(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE INITIATION (ISOFORM 4), INDUCTION.
    7. "The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis."
      Chen S., Yin X., Zhu X., Yan J., Ji S., Chen C., Cai M., Zhang S., Zong H., Hu Y., Yuan Z., Shen Z., Gu J.
      J. Biol. Chem. 278:20029-20036(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH PAK1.

    Entry informationi

    Entry nameiCD11A_HUMAN
    AccessioniPrimary (citable) accession number: Q9UQ88
    Secondary accession number(s): O95227
    , O95228, O96012, Q12821, Q12853, Q12854, Q2TAJ0, Q5QPR0, Q5QPR1, Q5QPR2, Q9UBC4, Q9UBI3, Q9UEI1, Q9UEI2, Q9UP53, Q9UP54, Q9UP55, Q9UP56, Q9UQ86, Q9UQ87, Q9UQ89
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2003
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 139 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Duplicated gene. CDK11A and CDK11B encode almost identical protein kinases of 110 kDa that contain at their C-termini the open reading frame of a smaller 58 kDa isoform which is expressed following IRES-mediated alternative initiation of translation.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3