Q9UQ88 (CD11A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 11A EC=2.7.11.22 Alternative name(s): Cell division cycle 2-like protein kinase 2 Cell division protein kinase 11A Galactosyltransferase-associated protein kinase p58/GTA PITSLRE serine/threonine-protein kinase CDC2L2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 783 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression. Ref.5 Ref.7 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Phosphorylation at Thr-436 or Tyr-437 inactivates the enzyme, while phosphorylation at Thr-583 activates it By similarity. |
| Subunit structure | The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1. The p58 isoform but not the p110 isoform or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7. Ref.5 Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed ubiquitously. Some evidence of isoform-specific tissue distribution. Ref.1 Ref.2 |
| Induction | The p58 isoform is specifically induced in G2/M phase of the cell cycle. Ref.6 |
| Post-translational modification | During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins. |
| Miscellaneous | Duplicated gene. CDK11A and CDK11B encode almost identical protein kinases of 110 kDa that contain at their C-termini the open reading frame of a smaller 58 kDa isoform which is expressed following IRES-mediated alternative initiation of translation. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
| Caution | Many references talk about 'p110 isoforms' but it is not yet known if this refers to CDK11A and/or CDK11B or one/some of the isoforms of each. |
| Sequence caution | The sequence AAC95297.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC95298.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC95299.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC95300.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC95302.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC95303.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform SV6 (identifier: Q9UQ88-1) Also known as: p110; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SV1 (identifier: Q9UQ88-2) Also known as: Pbeta21; Beta 2-1; The sequence of this isoform differs from the canonical sequence as follows: 109-109: W → CRHHSHSAEGG 240-253: GEARPAPAQKPAQL → V | ||||||
| Isoform SV2 (identifier: Q9UQ88-3) Also known as: Pbeta22; The sequence of this isoform differs from the canonical sequence as follows: 153-153: R → RGNDGFCLFR 240-253: GEARPAPAQKPAQL → V | ||||||
| Isoform SV3 (identifier: Q9UQ88-4) The sequence of this isoform differs from the canonical sequence as follows: 240-253: GEARPAPAQKPAQL → V | ||||||
| Isoform SV7 (identifier: Q9UQ88-5) Also known as: SV8; The sequence of this isoform differs from the canonical sequence as follows: 1-386: Missing. 387-418: SALTEGDYVPDSPALLPIELKQELPKYLPALQ → MKNEKMKTTSWLFQSHGSTEIPGRVKKQRKKW | ||||||
| Isoform SV12 (identifier: Q9UQ88-8) The sequence of this isoform differs from the canonical sequence as follows: 1-616: Missing. 617-658: GELLTQKPLF...IWPGYSELPV → MGKTEEKGNG...QDAGAAEGAA | ||||||
| Isoform SV13 (identifier: Q9UQ88-9) The sequence of this isoform differs from the canonical sequence as follows: 1-57: Missing. 153-153: R → RGNDGFCLFR 240-253: GEARPAPAQKPAQL → V 567-600: GDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA → SPPPSGPSQGDPPGPTHSRPSVVAGG 601-783: Missing. | ||||||
| Isoform 4 (identifier: Q9UQ88-10) Also known as: Beta 1; p58; The sequence of this isoform differs from the canonical sequence as follows: 1-344: Missing. | ||||||
| Note: Produced by alternative initiation at Met-345 of isoform SV6. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 783 | 783 | Cyclin-dependent kinase 11A | PRO_0000024315 | |||||
Regions | |||||||||
| Domain | 427 – 647 | 221 | Protein kinase | ||||||
| Nucleotide binding | 432 – 440 | 9 | ATP By similarity | ||||||
| Compositional bias | 15 – 381 | 367 | Glu-rich | ||||||
Sites | |||||||||
| Active site | 550 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 455 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 470 | 1 | Phosphoserine; by CDK7 By similarity | ||||||
| Modified residue | 476 | 1 | Phosphothreonine; by CDK7 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 616 | 616 | Missing in isoform SV12. | VSP_008284 | |||||
| Alternative sequence | 1 – 386 | 386 | Missing in isoform SV7. | VSP_008283 | |||||
| Alternative sequence | 1 – 344 | 344 | Missing in isoform 4. | VSP_018836 | |||||
| Alternative sequence | 1 – 57 | 57 | Missing in isoform SV13. | VSP_008281 | |||||
| Alternative sequence | 109 | 1 | W → CRHHSHSAEGG in isoform SV1. | VSP_008286 | |||||
| Alternative sequence | 153 | 1 | R → RGNDGFCLFR in isoform SV2 and isoform SV13. | VSP_008287 | |||||
| Alternative sequence | 240 – 253 | 14 | GEARP…KPAQL → V in isoform SV1, isoform SV2, isoform SV3 and isoform SV13. | VSP_008288 | |||||
| Alternative sequence | 387 – 418 | 32 | SALTE…LPALQ → MKNEKMKTTSWLFQSHGSTE IPGRVKKQRKKW in isoform SV7. | VSP_008289 | |||||
| Alternative sequence | 567 – 600 | 34 | GDFGL…LLLGA → SPPPSGPSQGDPPGPTHSRP SVVAGG in isoform SV13. | VSP_008290 | |||||
| Alternative sequence | 601 – 783 | 183 | Missing in isoform SV13. | VSP_008291 | |||||
| Alternative sequence | 617 – 658 | 42 | GELLT…SELPV → MGKTEEKGNGKGAFQERKGP LGAVRKEAGAGAQDAGAAEG AA in isoform SV12. | VSP_008292 | |||||
| Natural variant | 57 | 1 | C → R. Corresponds to variant rs17424353 [ dbSNP | Ensembl ]. | VAR_060152 | |||||
| Natural variant | 92 | 1 | S → P. Corresponds to variant rs7531938 [ dbSNP | Ensembl ]. | VAR_062200 | |||||
| Natural variant | 93 | 1 | R → W. Ref.2 Ref.3 Corresponds to variant rs1059831 [ dbSNP | Ensembl ]. | VAR_031716 | |||||
| Natural variant | 402 | 1 | L → S. Ref.1 Corresponds to variant rs1059828 [ dbSNP | Ensembl ]. | VAR_031717 | |||||
| Natural variant | 658 | 1 | V → A. Corresponds to variant rs1059811 [ dbSNP | Ensembl ]. | VAR_060153 | |||||
Experimental info | |||||||||
| Sequence conflict | 109 | 1 | Missing in AAA19594. Ref.1 | ||||||
| Sequence conflict | 109 | 1 | Missing in AAA19595. Ref.1 | ||||||
| Sequence conflict | 246 | 1 | P → R in AAC72087. Ref.2 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAA19594. Ref.1 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAA19595. Ref.1 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAC72084. Ref.2 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAC72085. Ref.2 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAC72086. Ref.2 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAC72087. Ref.2 | ||||||
| Sequence conflict | 312 – 314 | 3 | Missing in AAC72090. Ref.2 | ||||||
| Sequence conflict | 424 | 1 | E → D in AAA19585. Ref.1 | ||||||
| Sequence conflict | 424 | 1 | E → D in AAA19594. Ref.1 | ||||||
| Sequence conflict | 424 | 1 | E → D in AAA19595. Ref.1 | ||||||
| Sequence conflict | 463 | 1 | K → N in AAA19585. Ref.1 | ||||||
| Sequence conflict | 463 | 1 | K → N in AAA19594. Ref.1 | ||||||
| Sequence conflict | 463 | 1 | K → N in AAA19595. Ref.1 | ||||||
| Sequence conflict | 666 | 1 | E → R in AAA19585. Ref.1 | ||||||
| Sequence conflict | 666 | 1 | E → R in AAA19594. Ref.1 | ||||||
| Sequence conflict | 666 | 1 | E → R in AAA19595. Ref.1 | ||||||
| Sequence conflict | 682 | 1 | D → E in AAA19585. Ref.1 | ||||||
| Sequence conflict | 682 | 1 | D → E in AAA19594. Ref.1 | ||||||
| Sequence conflict | 682 | 1 | D → E in AAA19595. Ref.1 | ||||||
| Isoform SV1: | |||||||||
| Sequence conflict | 109 | 1 | C → R in AAA19594. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | H → R in AAA19594. Ref.1 | ||||||
| Isoform SV2: | |||||||||
| Sequence conflict | 158 | 1 | F → V in AAA19595. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms." Xiang J., Lahti J.M., Grenet J.A., Easton J.B., Kidd V.J. J. Biol. Chem. 269:15786-15794(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2 AND 4), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANT SER-402. Tissue: Cervix carcinoma. |
| [2] | "Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2." Gururajan R., Lahti J.M., Grenet J.A., Easton J., Gruber I., Ambros P.F., Kidd V.J. Genome Res. 8:929-939(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SV1; SV2; SV3; SV6; SV7; SV12 AND SV13), TISSUE SPECIFICITY, VARIANT TRP-93. Tissue: Cervix carcinoma. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TRP-93. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SV7). Tissue: Skin. |
| [5] | "CDK11 complexes promote pre-mRNA splicing." Hu D., Mayeda A., Trembley J.H., Lahti J.M., Kidd V.J. J. Biol. Chem. 278:8623-8629(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CCNL1 AND SFRS7. |
| [6] | "Identification and characterization of a novel cell cycle-regulated internal ribosome entry site." Cornelis S., Bruynooghe Y., Denecker G., Van Huffel S., Tinton S., Beyaert R. Mol. Cell 5:597-605(2000) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE INITIATION (ISOFORM 4), INDUCTION. |
| [7] | "The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis." Chen S., Yin X., Zhu X., Yan J., Ji S., Chen C., Cai M., Zhang S., Zong H., Hu Y., Yuan Z., Shen Z., Gu J. J. Biol. Chem. 278:20029-20036(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PAK1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U04819 mRNA. Translation: AAA19585.1. U07704 mRNA. Translation: AAA19594.1. U07705 mRNA. Translation: AAA19595.1. AF067518 mRNA. Translation: AAC72083.1. AF067519 mRNA. Translation: AAC72084.1. AF067520 mRNA. Translation: AAC72085.1. AF067521 mRNA. Translation: AAC72086.1. AF067522 mRNA. Translation: AAC72087.1. AF067523 mRNA. Translation: AAC72088.1. AF067524 mRNA. Translation: AAC72089.1. AF067525 mRNA. Translation: AAC72090.1. AF067526 mRNA. Translation: AAC72091.1. AF067527 mRNA. Translation: AAC72092.1. AF067528 mRNA. Translation: AAC72093.1. AF067529 mRNA. Translation: AAC72094.1. AF080694 AF080693 Genomic DNA. Translation: AAC95297.1. Sequence problems.AF080694 AF080693 Genomic DNA. Translation: AAC95298.1. Sequence problems.AF080694 AF080693 Genomic DNA. Translation: AAC95299.1. Sequence problems.AF080694 AF080693 Genomic DNA. Translation: AAC95300.1. Sequence problems.AF080697 AF080696 Genomic DNA. Translation: AAC95302.1. Sequence problems.AF080697 AF080696 Genomic DNA. Translation: AAC95303.1. Sequence problems.AL031282 Genomic DNA. Translation: CAI20032.1. AL031282 Genomic DNA. Translation: CAI20033.1. AL031282 Genomic DNA. Translation: CAI20034.1. BC110905 mRNA. Translation: AAI10906.1. |
| IPI | IPI00024413. IPI00024414. IPI00070809. IPI00099746. IPI00219508. IPI00294006. IPI00334381. IPI00954484. |
| PIR | B54024. E54024. F54024. H54024. |
| RefSeq | NP_076916.2. NM_024011.2. NP_277071.2. NM_033529.2. |
| UniGene | Hs.651228. Hs.709182. |
3D structure databases | |
| ProteinModelPortal | Q9UQ88. |
| SMR | Q9UQ88. Positions 374-753. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UQ88. 7 interactions. |
PTM databases | |
| PhosphoSite | Q9UQ88. |
Polymorphism databases | |
| DMDM | 145559452. |
Proteomic databases | |
| PaxDb | Q9UQ88. |
| PRIDE | Q9UQ88. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358779; ENSP00000351629; ENSG00000008128. ENST00000378633; ENSP00000367900; ENSG00000008128. ENST00000404249; ENSP00000384442; ENSG00000008128. |
| GeneID | 728642. |
| KEGG | hsa:728642. |
| UCSC | uc001ahj.4. human. uc009vkr.3. human. uc009vks.3. human. |
Organism-specific databases | |
| CTD | 728642. |
| GeneCards | GC01M001634. |
| HGNC | HGNC:1730. CDK11A. |
| HPA | CAB010467. HPA025061. |
| MIM | 116951. gene. |
| neXtProt | NX_Q9UQ88. |
| PharmGKB | PA26263. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG014652. |
| InParanoid | Q9UQ88. |
| KO | K08818. |
| OMA | DGRKPVK. |
| PhylomeDB | Q9UQ88. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. |
Gene expression databases | |
| ArrayExpress | Q9UQ88. |
| Bgee | Q9UQ88. |
| Genevestigator | Q9UQ88. |
| GermOnline | ENSG00000008128. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9UQ88. |
| ChEMBL | CHEMBL5416. |
| GenomeRNAi | 728642. |
| NextBio | 127852. |
| SOURCE | Search... |
Entry information
| Entry name | CD11A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UQ88 Secondary accession number(s): O95227 Q9UQ89 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
