Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B

Gene

MGAT4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.

Catalytic activityi

UDP-N-acetyl-D-glucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R.1 Publication

Cofactori

Kineticsi

  1. KM=0.242 mM for UDP-GlcNAc1 Publication

    Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    GO - Molecular functioni

    GO - Biological processi

    • N-glycan processing Source: ProtInc
    Complete GO annotation...

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Keywords - Ligandi

    Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS08564-MONOMER.
    BRENDAi2.4.1.145. 2681.
    ReactomeiR-HSA-975577. N-Glycan antennae elongation.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGT54. Glycosyltransferase Family 54.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.145)
    Alternative name(s):
    N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
    Short name:
    GlcNAc-T IVb
    Short name:
    GnT-IVb
    Short name:
    N-acetylglucosaminyltransferase IVb
    UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb
    Gene namesi
    Name:MGAT4B
    ORF Names:UNQ906/PRO1927
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:7048. MGAT4B.

    Subcellular locationi

    Topology

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 77CytoplasmicSequence analysis
    Transmembranei8 – 2821Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
    BLAST
    Topological domaini29 – 548520LumenalSequence analysisAdd
    BLAST

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30783.

    Polymorphism and mutation databases

    BioMutaiMGAT4B.
    DMDMi74735195.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 548548Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase BPRO_0000288593Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi87 – 871N-linked (GlcNAc...)Sequence analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    EPDiQ9UQ53.
    MaxQBiQ9UQ53.
    PaxDbiQ9UQ53.
    PRIDEiQ9UQ53.

    PTM databases

    iPTMnetiQ9UQ53.
    PhosphoSiteiQ9UQ53.

    Expressioni

    Tissue specificityi

    Widely expressed. Strongly overexpressed in pancreatic cancer.1 Publication

    Gene expression databases

    BgeeiQ9UQ53.
    CleanExiHS_MGAT4B.
    ExpressionAtlasiQ9UQ53. baseline and differential.
    GenevisibleiQ9UQ53. HS.

    Organism-specific databases

    HPAiHPA052134.

    Interactioni

    Protein-protein interaction databases

    BioGridi116438. 9 interactions.
    IntActiQ9UQ53. 2 interactions.
    MINTiMINT-1377755.
    STRINGi9606.ENSP00000338487.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UQ53.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili36 – 8348Sequence analysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the glycosyltransferase 54 family.Curated

    Keywords - Domaini

    Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiENOG410IEDC. Eukaryota.
    ENOG410XPV0. LUCA.
    GeneTreeiENSGT00550000074578.
    HOGENOMiHOG000015085.
    HOVERGENiHBG053194.
    InParanoidiQ9UQ53.
    KOiK00738.
    OMAiLKLWNIT.
    OrthoDBiEOG70ZZN3.
    PhylomeDBiQ9UQ53.
    TreeFamiTF324570.

    Family and domain databases

    InterProiIPR006759. Glyco_transf_54.
    [Graphical view]
    PANTHERiPTHR12062. PTHR12062. 1 hit.
    PfamiPF04666. Glyco_transf_54. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9UQ53-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MRLRNGTFLT LLLFCLCAFL SLSWYAALSG QKGDVVDVYQ REFLALRDRL
    60 70 80 90 100
    HAAEQESLKR SKELNLVLDE IKRAVSERQA LRDGDGNRTW GRLTEDPRLK
    110 120 130 140 150
    PWNGSHRHVL HLPTVFHHLP HLLAKESSLQ PAVRVGQGRT GVSVVMGIPS
    160 170 180 190 200
    VRREVHSYLT DTLHSLISEL SPQEKEDSVI VVLIAETDSQ YTSAVTENIK
    210 220 230 240 250
    ALFPTEIHSG LLEVISPSPH FYPDFSRLRE SFGDPKERVR WRTKQNLDYC
    260 270 280 290 300
    FLMMYAQSKG IYYVQLEDDI VAKPNYLSTM KNFALQQPSE DWMILEFSQL
    310 320 330 340 350
    GFIGKMFKSL DLSLIVEFIL MFYRDKPIDW LLDHILWVKV CNPEKDAKHC
    360 370 380 390 400
    DRQKANLRIR FKPSLFQHVG THSSLAGKIQ KLKDKDFGKQ ALRKEHVNPP
    410 420 430 440 450
    AEVSTSLKTY QHFTLEKAYL REDFFWAFTP AAGDFIRFRF FQPLRLERFF
    460 470 480 490 500
    FRSGNIEHPE DKLFNTSVEV LPFDNPQSDK EALQEGRTAT LRYPRSPDGY
    510 520 530 540
    LQIGSFYKGV AEGEVDPAFG PLEALRLSIQ TDSPVWVILS EIFLKKAD
    Length:548
    Mass (Da):63,198
    Last modified:May 1, 2000 - v1
    Checksum:i1EFF2E681D683C4D
    GO
    Isoform 2 (identifier: Q9UQ53-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-348: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:547
    Mass (Da):63,070
    Checksum:i20752291F5255E6C
    GO
    Isoform 3 (identifier: Q9UQ53-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQK → MSRVAGTRTD...PLVTACLPPA

    Note: No experimental confirmation available.
    Show »
    Length:563
    Mass (Da):64,845
    Checksum:iBBEB51190B4F1873
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti257 – 2571Q → H.
    Corresponds to variant rs190631 [ dbSNP | Ensembl ].
    VAR_053913
    Natural varianti491 – 4911L → F.1 Publication
    Corresponds to variant rs17854722 [ dbSNP | Ensembl ].
    VAR_032446

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232MRLRN…LSGQK → MSRVAGTRTDVNELLQRWTP RCVRWHTGGARRVALDRPLV TACLPPA in isoform 3. 1 PublicationVSP_043231Add
    BLAST
    Alternative sequencei348 – 3481Missing in isoform 2. 1 PublicationVSP_025716

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB000624 mRNA. Translation: BAA83464.1.
    AY358984 mRNA. Translation: AAQ89343.1.
    AK023137 mRNA. Translation: BAG51162.1.
    AC008393 Genomic DNA. No translation available.
    CH471165 Genomic DNA. Translation: EAW53791.1.
    BC009464 mRNA. Translation: AAH09464.2.
    BC051835 mRNA. Translation: AAH51835.1.
    AL162067 mRNA. Translation: CAB82404.2.
    CCDSiCCDS4448.1. [Q9UQ53-1]
    CCDS4449.1. [Q9UQ53-3]
    PIRiT47170.
    RefSeqiNP_055090.1. NM_014275.4. [Q9UQ53-1]
    NP_463459.1. NM_054013.3. [Q9UQ53-3]
    UniGeneiHs.567419.

    Genome annotation databases

    EnsembliENST00000292591; ENSP00000292591; ENSG00000161013. [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013. [Q9UQ53-3]
    GeneIDi11282.
    KEGGihsa:11282.
    UCSCiuc003mkr.4. human. [Q9UQ53-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB000624 mRNA. Translation: BAA83464.1.
    AY358984 mRNA. Translation: AAQ89343.1.
    AK023137 mRNA. Translation: BAG51162.1.
    AC008393 Genomic DNA. No translation available.
    CH471165 Genomic DNA. Translation: EAW53791.1.
    BC009464 mRNA. Translation: AAH09464.2.
    BC051835 mRNA. Translation: AAH51835.1.
    AL162067 mRNA. Translation: CAB82404.2.
    CCDSiCCDS4448.1. [Q9UQ53-1]
    CCDS4449.1. [Q9UQ53-3]
    PIRiT47170.
    RefSeqiNP_055090.1. NM_014275.4. [Q9UQ53-1]
    NP_463459.1. NM_054013.3. [Q9UQ53-3]
    UniGeneiHs.567419.

    3D structure databases

    ProteinModelPortaliQ9UQ53.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi116438. 9 interactions.
    IntActiQ9UQ53. 2 interactions.
    MINTiMINT-1377755.
    STRINGi9606.ENSP00000338487.

    Protein family/group databases

    CAZyiGT54. Glycosyltransferase Family 54.

    PTM databases

    iPTMnetiQ9UQ53.
    PhosphoSiteiQ9UQ53.

    Polymorphism and mutation databases

    BioMutaiMGAT4B.
    DMDMi74735195.

    Proteomic databases

    EPDiQ9UQ53.
    MaxQBiQ9UQ53.
    PaxDbiQ9UQ53.
    PRIDEiQ9UQ53.

    Protocols and materials databases

    DNASUi11282.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000292591; ENSP00000292591; ENSG00000161013. [Q9UQ53-1]
    ENST00000337755; ENSP00000338487; ENSG00000161013. [Q9UQ53-3]
    GeneIDi11282.
    KEGGihsa:11282.
    UCSCiuc003mkr.4. human. [Q9UQ53-1]

    Organism-specific databases

    CTDi11282.
    GeneCardsiMGAT4B.
    HGNCiHGNC:7048. MGAT4B.
    HPAiHPA052134.
    MIMi604561. gene.
    neXtProtiNX_Q9UQ53.
    PharmGKBiPA30783.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiENOG410IEDC. Eukaryota.
    ENOG410XPV0. LUCA.
    GeneTreeiENSGT00550000074578.
    HOGENOMiHOG000015085.
    HOVERGENiHBG053194.
    InParanoidiQ9UQ53.
    KOiK00738.
    OMAiLKLWNIT.
    OrthoDBiEOG70ZZN3.
    PhylomeDBiQ9UQ53.
    TreeFamiTF324570.

    Enzyme and pathway databases

    UniPathwayiUPA00378.
    BioCyciMetaCyc:HS08564-MONOMER.
    BRENDAi2.4.1.145. 2681.
    ReactomeiR-HSA-975577. N-Glycan antennae elongation.

    Miscellaneous databases

    ChiTaRSiMGAT4B. human.
    GeneWikiiMGAT4B.
    GenomeRNAii11282.
    PROiQ9UQ53.
    SOURCEiSearch...

    Gene expression databases

    BgeeiQ9UQ53.
    CleanExiHS_MGAT4B.
    ExpressionAtlasiQ9UQ53. baseline and differential.
    GenevisibleiQ9UQ53. HS.

    Family and domain databases

    InterProiIPR006759. Glyco_transf_54.
    [Graphical view]
    PANTHERiPTHR12062. PTHR12062. 1 hit.
    PfamiPF04666. Glyco_transf_54. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Publicationsi

    « Hide 'large scale' publications
    1. "A novel second isoenzyme of the human UDP-N-acetylglucosamine:alpha1,3-D-mannoside beta1,4-N-acetylglucosaminyltransferase family: cDNA cloning, expression, and chromosomal assignment."
      Yoshida A., Minowa M.T., Takamatsu S., Hara T., Ikenaga H., Takeuchi M.
      Glycoconj. J. 15:1115-1123(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Lung.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PHE-491.
      Tissue: PNS and Uterus.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 176-548 (ISOFORM 2).
      Tissue: Melanoma.
    8. "Aberrant expression of N-acetylglucosaminyltransferase-IVa and IVb (GnT-IVa and b) in pancreatic cancer."
      Ide Y., Miyoshi E., Nakagawa T., Gu J., Tanemura M., Nishida T., Ito T., Yamamoto H., Kozutsumi Y., Taniguchi N.
      Biochem. Biophys. Res. Commun. 341:478-482(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: OVEREXPRESSION IN PANCREATIC CANCER.
    9. "Kinetic properties and substrate specificities of two recombinant human N-acetylglucosaminyltransferase-IV isozymes."
      Oguri S., Yoshida A., Minowa M.T., Takeuchi M.
      Glycoconj. J. 23:473-480(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: ENZYME ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.

    Entry informationi

    Entry nameiMGT4B_HUMAN
    AccessioniPrimary (citable) accession number: Q9UQ53
    Secondary accession number(s): A8MPR0
    , Q86TF1, Q96GH4, Q9NSK6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 1, 2000
    Last modified: June 8, 2016
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.