Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UQ26

- RIMS2_HUMAN

UniProt

Q9UQ26 - RIMS2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Regulating synaptic membrane exocytosis protein 2

Gene

RIMS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Rab effector involved in exocytosis. May act as scaffold protein.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri117 – 17357FYVE-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. calcium ion-dependent exocytosis Source: Ensembl
  2. calcium ion-dependent exocytosis of neurotransmitter Source: Ensembl
  3. cAMP-mediated signaling Source: Ensembl
  4. insulin secretion Source: Ensembl
  5. intracellular protein transport Source: InterPro
  6. positive regulation of gene expression Source: ParkinsonsUK-UCL
  7. positive regulation of inhibitory postsynaptic membrane potential Source: ParkinsonsUK-UCL
  8. regulation of exocytosis Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Regulating synaptic membrane exocytosis protein 2
Alternative name(s):
Rab-3-interacting molecule 2
Short name:
RIM 2
Rab-3-interacting protein 3
Gene namesi
Name:RIMS2
Synonyms:KIAA0751, RAB3IP3, RIM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:17283. RIMS2.

Subcellular locationi

Cell membrane By similarity; Peripheral membrane protein By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepresynaptic cell membrane By similarity; Peripheral membrane protein By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
  3. presynaptic active zone Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38445.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14111411Regulating synaptic membrane exocytosis protein 2PRO_0000190201Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei400 – 4001Phosphoserine1 Publication
Modified residuei689 – 6891Phosphothreonine1 Publication
Modified residuei691 – 6911Phosphoserine1 Publication
Modified residuei699 – 6991Phosphothreonine1 Publication
Modified residuei1396 – 13961Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9UQ26.
PaxDbiQ9UQ26.
PRIDEiQ9UQ26.

PTM databases

PhosphoSiteiQ9UQ26.

Expressioni

Gene expression databases

BgeeiQ9UQ26.
CleanExiHS_RIMS2.
ExpressionAtlasiQ9UQ26. baseline and differential.
GenevestigatoriQ9UQ26.

Organism-specific databases

HPAiHPA046538.
HPA053672.

Interactioni

Subunit structurei

Interacts with RAB3A and RAB3B that have been activated by GTP-binding. Interacts with RAB3C, RAB3D and RAB26. Interacts with BZRAP1/RIMBP1 and RIMBP2. Interacts with PPFIA3 and PPFIA4. Interacts via its zinc finger with the first C2 domain of UNC13A. Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO. Part of a ternary complex involving PCLO and EPAC2 By similarity.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
NCK1P163332EBI-1756749,EBI-389883

Protein-protein interaction databases

BioGridi115051. 10 interactions.
IntActiQ9UQ26. 6 interactions.
MINTiMINT-3083593.
STRINGi9606.ENSP00000386228.

Structurei

Secondary structure

1
1411
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi646 – 6494Combined sources
Beta strandi651 – 66313Combined sources
Turni677 – 6804Combined sources
Beta strandi681 – 6888Combined sources
Beta strandi690 – 6923Combined sources
Beta strandi694 – 7018Combined sources
Helixi706 – 7105Combined sources
Beta strandi718 – 7225Combined sources
Helixi732 – 74110Combined sources
Beta strandi743 – 75412Combined sources
Beta strandi808 – 8169Combined sources
Turni817 – 8204Combined sources
Beta strandi821 – 83111Combined sources
Beta strandi836 – 8383Combined sources
Beta strandi843 – 8464Combined sources
Beta strandi854 – 8574Combined sources
Helixi885 – 8873Combined sources
Beta strandi890 – 8989Combined sources
Beta strandi900 – 9034Combined sources
Beta strandi910 – 9156Combined sources
Helixi916 – 9183Combined sources
Beta strandi925 – 9295Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1V27NMR-A807-934[»]
1WFGNMR-A637-754[»]
ProteinModelPortaliQ9UQ26.
SMRiQ9UQ26. Positions 114-173, 641-754, 808-934, 1243-1390.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UQ26.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 185160RabBDPROSITE-ProRule annotationAdd
BLAST
Domaini668 – 75487PDZPROSITE-ProRule annotationAdd
BLAST
Domaini807 – 913107C2 1PROSITE-ProRule annotationAdd
BLAST
Domaini1257 – 1359103C2 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 C2 domains.PROSITE-ProRule annotation
Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RabBD (Rab-binding) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri117 – 17357FYVE-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG286957.
GeneTreeiENSGT00550000074588.
HOGENOMiHOG000082403.
HOVERGENiHBG058147.
InParanoidiQ9UQ26.
KOiK15297.
PhylomeDBiQ9UQ26.
TreeFamiTF321703.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
2.60.40.150. 2 hits.
3.30.40.10. 2 hits.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR017455. Znf_FYVE-rel.
IPR010911. Znf_FYVE-typ.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF02318. FYVE_2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF50156. SSF50156. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEiPS50004. C2. 2 hits.
PS50106. PDZ. 1 hit.
PS50916. RABBD. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 6 (identifier: Q9UQ26-6) [UniParc]FASTAAdd to Basket

Also known as: RIM2-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPVGPRGR LAPIPAASQP PLQPEMPDLS HLTEEERKII LAVMDRQKKK
60 70 80 90 100
VKEEHKPQLT QWFPFSGITE LVNNVLQPQQ KQQNEKEPQT KLHQQFEMYK
110 120 130 140 150
EQVKKMGEES QQQQEQKGDA PTCGICHKTK FADGCGHNCS YCQTKFCARC
160 170 180 190 200
GGRVSLRSNK VMWVCNLCRK QQEILTKSGA WFYNSGSNTP QQPDQKVLRG
210 220 230 240 250
LRNEEAPQEK KPKLHEQTQF QGPSGDLSVP AVEKSRSHGL TRQHSIKNGS
260 270 280 290 300
GVKHHIASDI ASDRKRSPSV SRDQNRRYDQ REEREEYSQY ATSDTAMPRS
310 320 330 340 350
PSDYADRRSQ HEPQFYEDSD HLSYRDSNRR SHRHSKEYIV DDEDVESRDE
360 370 380 390 400
YERQRREEEY QSRYRSDPNL ARYPVKPQPY EEQMRIHAEV SRARHERRHS
410 420 430 440 450
DVSLANADLE DSRISMLRMD RPSRQRSISE RRAAMENQRS YSMERTREAQ
460 470 480 490 500
GPSSYAQRTT NHSPPTPRRS PLPIDRPDLR RTDSLRKQHH LDPSSAVRKT
510 520 530 540 550
KREKMETMLR NDSLSSDQSE SVRPPPPKPH KSKKGGKMRQ ISLSSSEEEL
560 570 580 590 600
ASTPEYTSCD DVEIESESVS EKGDSQKGKR KTSEQAVLSD SNTRSERQKE
610 620 630 640 650
MMYFGGHSLE EDLEWSEPQI KDSGVDTCSS TTLNEEHSHS DKHPVTWQPS
660 670 680 690 700
KDGDRLIGRI LLNKRLKDGS VPRDSGAMLG LKVVGGKMTE SGRLCAFITK
710 720 730 740 750
VKKGSLADTV GHLRPGDEVL EWNGRLLQGA TFEEVYNIIL ESKPEPQVEL
760 770 780 790 800
VVSRPIGDIP RIPDSTHAQL ESSSSSFESQ KMDRPSISVT SPMSPGMLRD
810 820 830 840 850
VPQFLSGQLS IKLWFDKVGH QLIVTILGAK DLPSREDGRP RNPYVKIYFL
860 870 880 890 900
PDRSDKNKRR TKTVKKTLEP KWNQTFIYSP VHRREFRERM LEITLWDQAR
910 920 930 940 950
VREEESEFLG EILIELETAL LDDEPHWYKL QTHDVSSLPL PHPSPYMPRR
960 970 980 990 1000
QLHGESPTRR LQRSKRISDS EVSDYDCDDG IGVVSDYRHD GRDLQSSTLS
1010 1020 1030 1040 1050
VPEQVMSSNH CSPSGSPHRV DVIGRTRSWS PSVPPPQSRN VEQGLRGTRT
1060 1070 1080 1090 1100
MTGHYNTISR MDRHRVMDDH YSPDRDRDCE AADRQPYHRS RSTEQRPLLE
1110 1120 1130 1140 1150
RTTTRSRSTE RPDTNLMRSM PSLMTGRSAP PSPALSRSHP RTGSVQTSPS
1160 1170 1180 1190 1200
STPVAGRRGR QLPQLPPKGT LDRKAGGKKL RSTVQRSTET GLAVEMRNWM
1210 1220 1230 1240 1250
TRQASRESTD GSMNSYSSEG NLIFPGVRLA SDSQFSDFLD GLGPAQLVGR
1260 1270 1280 1290 1300
QTLATPAMGD IQVGMMDKKG QLEVEIIRAR GLVVKPGSKT LPAPYVKVYL
1310 1320 1330 1340 1350
LDNGVCIAKK KTKVARKTLE PLYQQLLSFE ESPQGKVLQI IVWGDYGRMD
1360 1370 1380 1390 1400
HKSFMGVAQI LLDELELSNM VIGWFKLFPP SSLVDPTLAP LTRRASQSSL
1410
ESSTGPSYSR S

Note: No experimental confirmation available.

Length:1,411
Mass (Da):160,403
Last modified:January 16, 2004 - v2
Checksum:i9D4E83F4CBE4A864
GO
Isoform 1 (identifier: Q9UQ26-1) [UniParc]FASTAAdd to Basket

Also known as: RIM2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA

Show »
Length:1,188
Mass (Da):135,250
Checksum:iDD65DB32288055AF
GO
Isoform 2 (identifier: Q9UQ26-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1038-1038: S → R
     1039-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:1,038
Mass (Da):119,057
Checksum:i6EFF188912E7C9B7
GO
Isoform 3 (identifier: Q9UQ26-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG

Note: No experimental confirmation available.

Show »
Length:1,163
Mass (Da):132,670
Checksum:i30E1EB86C76B0998
GO
Isoform 4 (identifier: Q9UQ26-4) [UniParc]FASTAAdd to Basket

Also known as: RimL3a

The sequence of this isoform differs from the canonical sequence as follows:
     774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK
     802-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:801
Mass (Da):91,941
Checksum:iAC3B759DF8D4640F
GO
Isoform 5 (identifier: Q9UQ26-5) [UniParc]FASTAAdd to Basket

Also known as: RimL3c

The sequence of this isoform differs from the canonical sequence as follows:
     811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK
     825-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:824
Mass (Da):94,172
Checksum:i8C1E96D4AA918687
GO
Isoform 7 (identifier: Q9UQ26-7) [UniParc]FASTAAdd to Basket

Also known as: RIM2-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.
     1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE

Show »
Length:285
Mass (Da):30,972
Checksum:i6E39DC2A4F246F79
GO
Isoform 8 (identifier: Q9UQ26-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     810-810: S → SSQSLSRRTTPFVPRVQ

Note: No experimental confirmation available.

Show »
Length:1,349
Mass (Da):153,363
Checksum:iD385AB7B1AB598D6
GO

Sequence cautioni

The sequence BAA34471.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti309 – 3091S → F in AAH43144. (PubMed:15489334)Curated
Sequence conflicti518 – 5181Q → R in AAH43144. (PubMed:15489334)Curated
Sequence conflicti947 – 9471M → V in BAG54403. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11261126Missing in isoform 7. CuratedVSP_040864Add
BLAST
Alternative sequencei1 – 223223Missing in isoform 1 and isoform 3. 2 PublicationsVSP_040865Add
BLAST
Alternative sequencei50 – 9041KVKEE…KEPQT → EEEKEQSVLK in isoform 8. 1 PublicationVSP_044661Add
BLAST
Alternative sequencei224 – 26340SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3. 2 PublicationsVSP_040866Add
BLAST
Alternative sequencei575 – 64268SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8. 2 PublicationsVSP_040867Add
BLAST
Alternative sequencei774 – 80128SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4. 1 PublicationVSP_040868Add
BLAST
Alternative sequencei802 – 1411610Missing in isoform 4. 1 PublicationVSP_040871Add
BLAST
Alternative sequencei810 – 8101S → SSQSLSRRTTPFVPRVQ in isoform 8. 1 PublicationVSP_044662
Alternative sequencei811 – 82414IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5. 1 PublicationVSP_040869Add
BLAST
Alternative sequencei825 – 1411587Missing in isoform 5. 1 PublicationVSP_040870Add
BLAST
Alternative sequencei1038 – 10381S → R in isoform 2. 1 PublicationVSP_040872
Alternative sequencei1039 – 1411373Missing in isoform 2. 1 PublicationVSP_040873Add
BLAST
Alternative sequencei1076 – 10761D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3. 1 PublicationVSP_040874
Alternative sequencei1127 – 117448RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7. CuratedVSP_040875Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB018294 mRNA. Translation: BAA34471.2. Different initiation.
AF007156 mRNA. Translation: AAC19157.1.
AK126939 mRNA. Translation: BAG54403.1.
AC007751 Genomic DNA. No translation available.
AC012213 Genomic DNA. No translation available.
AC090448 Genomic DNA. No translation available.
AC090686 Genomic DNA. No translation available.
AC107933 Genomic DNA. No translation available.
AP001572 Genomic DNA. No translation available.
AP002849 Genomic DNA. No translation available.
BC043144 mRNA. Translation: AAH43144.1.
AY057119 mRNA. Translation: AAL23679.1.
AY057121 mRNA. Translation: AAL23681.1.
CCDSiCCDS43761.1. [Q9UQ26-3]
CCDS64948.1. [Q9UQ26-1]
CCDS64949.1. [Q9UQ26-7]
RefSeqiNP_001093587.1. NM_001100117.2. [Q9UQ26-8]
NP_001269810.1. NM_001282881.1. [Q9UQ26-1]
NP_001269811.1. NM_001282882.1. [Q9UQ26-7]
NP_055492.3. NM_014677.4. [Q9UQ26-3]
UniGeneiHs.655271.
Hs.735969.

Genome annotation databases

GeneIDi9699.
KEGGihsa:9699.
UCSCiuc003ylq.3. human. [Q9UQ26-3]
uc003ylr.3. human. [Q9UQ26-1]

Polymorphism databases

DMDMi41019522.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB018294 mRNA. Translation: BAA34471.2 . Different initiation.
AF007156 mRNA. Translation: AAC19157.1 .
AK126939 mRNA. Translation: BAG54403.1 .
AC007751 Genomic DNA. No translation available.
AC012213 Genomic DNA. No translation available.
AC090448 Genomic DNA. No translation available.
AC090686 Genomic DNA. No translation available.
AC107933 Genomic DNA. No translation available.
AP001572 Genomic DNA. No translation available.
AP002849 Genomic DNA. No translation available.
BC043144 mRNA. Translation: AAH43144.1 .
AY057119 mRNA. Translation: AAL23679.1 .
AY057121 mRNA. Translation: AAL23681.1 .
CCDSi CCDS43761.1. [Q9UQ26-3 ]
CCDS64948.1. [Q9UQ26-1 ]
CCDS64949.1. [Q9UQ26-7 ]
RefSeqi NP_001093587.1. NM_001100117.2. [Q9UQ26-8 ]
NP_001269810.1. NM_001282881.1. [Q9UQ26-1 ]
NP_001269811.1. NM_001282882.1. [Q9UQ26-7 ]
NP_055492.3. NM_014677.4. [Q9UQ26-3 ]
UniGenei Hs.655271.
Hs.735969.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1V27 NMR - A 807-934 [» ]
1WFG NMR - A 637-754 [» ]
ProteinModelPortali Q9UQ26.
SMRi Q9UQ26. Positions 114-173, 641-754, 808-934, 1243-1390.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115051. 10 interactions.
IntActi Q9UQ26. 6 interactions.
MINTi MINT-3083593.
STRINGi 9606.ENSP00000386228.

PTM databases

PhosphoSitei Q9UQ26.

Polymorphism databases

DMDMi 41019522.

Proteomic databases

MaxQBi Q9UQ26.
PaxDbi Q9UQ26.
PRIDEi Q9UQ26.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 9699.
KEGGi hsa:9699.
UCSCi uc003ylq.3. human. [Q9UQ26-3 ]
uc003ylr.3. human. [Q9UQ26-1 ]

Organism-specific databases

CTDi 9699.
GeneCardsi GC08P104582.
H-InvDB HIX0020449.
HGNCi HGNC:17283. RIMS2.
HPAi HPA046538.
HPA053672.
MIMi 606630. gene.
neXtProti NX_Q9UQ26.
PharmGKBi PA38445.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG286957.
GeneTreei ENSGT00550000074588.
HOGENOMi HOG000082403.
HOVERGENi HBG058147.
InParanoidi Q9UQ26.
KOi K15297.
PhylomeDBi Q9UQ26.
TreeFami TF321703.

Miscellaneous databases

EvolutionaryTracei Q9UQ26.
GeneWikii RIMS2.
GenomeRNAii 9699.
NextBioi 36445.
PROi Q9UQ26.
SOURCEi Search...

Gene expression databases

Bgeei Q9UQ26.
CleanExi HS_RIMS2.
ExpressionAtlasi Q9UQ26. baseline and differential.
Genevestigatori Q9UQ26.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
2.60.40.150. 2 hits.
3.30.40.10. 2 hits.
InterProi IPR000008. C2_dom.
IPR001478. PDZ.
IPR017455. Znf_FYVE-rel.
IPR010911. Znf_FYVE-typ.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF00168. C2. 2 hits.
PF02318. FYVE_2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00239. C2. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 2 hits.
SSF50156. SSF50156. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEi PS50004. C2. 2 hits.
PS50106. PDZ. 1 hit.
PS50916. RABBD. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Yu W., Sarginson J., Gibbs R.A.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
    Tissue: Brain.
  4. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Hypothalamus.
  6. Ho H.C.
    Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 689-1411 (ISOFORMS 4 AND 5).
  7. "Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins."
    Wang Y., Suedhof T.C.
    Genomics 81:126-137(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, GENOMIC ORGANIZATION.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-689; SER-691 AND THR-699, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400 AND SER-1396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "PDZ domain and the first C2 domain of human RIM2B."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 637-934.

Entry informationi

Entry nameiRIMS2_HUMAN
AccessioniPrimary (citable) accession number: Q9UQ26
Secondary accession number(s): B3KX91
, F8WD47, O43413, Q86XL9, Q8IWV9, Q8IWW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 16, 2004
Last modified: October 29, 2014
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3