Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UQ26

- RIMS2_HUMAN

UniProt

Q9UQ26 - RIMS2_HUMAN

Protein

Regulating synaptic membrane exocytosis protein 2

Gene

RIMS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 2 (16 Jan 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Rab effector involved in exocytosis. May act as scaffold protein.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri117 – 17357FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein binding Source: IntAct

    GO - Biological processi

    1. calcium ion-dependent exocytosis Source: Ensembl
    2. calcium ion-dependent exocytosis of neurotransmitter Source: Ensembl
    3. cAMP-mediated signaling Source: Ensembl
    4. insulin secretion Source: Ensembl
    5. intracellular protein transport Source: InterPro
    6. regulation of exocytosis Source: Ensembl
    7. regulation of membrane potential Source: Ensembl

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Regulating synaptic membrane exocytosis protein 2
    Alternative name(s):
    Rab-3-interacting molecule 2
    Short name:
    RIM 2
    Rab-3-interacting protein 3
    Gene namesi
    Name:RIMS2
    Synonyms:KIAA0751, RAB3IP3, RIM2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:17283. RIMS2.

    Subcellular locationi

    Cell membrane By similarity; Peripheral membrane protein By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepresynaptic cell membrane By similarity; Peripheral membrane protein By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. presynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38445.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14111411Regulating synaptic membrane exocytosis protein 2PRO_0000190201Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei400 – 4001Phosphoserine1 Publication
    Modified residuei689 – 6891Phosphothreonine1 Publication
    Modified residuei691 – 6911Phosphoserine1 Publication
    Modified residuei699 – 6991Phosphothreonine1 Publication
    Modified residuei1396 – 13961Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9UQ26.
    PaxDbiQ9UQ26.
    PRIDEiQ9UQ26.

    PTM databases

    PhosphoSiteiQ9UQ26.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9UQ26.
    BgeeiQ9UQ26.
    CleanExiHS_RIMS2.
    GenevestigatoriQ9UQ26.

    Organism-specific databases

    HPAiHPA046538.
    HPA053672.

    Interactioni

    Subunit structurei

    Interacts with RAB3A and RAB3B that have been activated by GTP-binding. Interacts with RAB3C, RAB3D and RAB26. Interacts with BZRAP1/RIMBP1 and RIMBP2. Interacts with PPFIA3 and PPFIA4. Interacts via its zinc finger with the first C2 domain of UNC13A. Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO. Part of a ternary complex involving PCLO and EPAC2 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    NCK1P163332EBI-1756749,EBI-389883

    Protein-protein interaction databases

    BioGridi115051. 10 interactions.
    IntActiQ9UQ26. 6 interactions.
    MINTiMINT-3083593.
    STRINGi9606.ENSP00000386228.

    Structurei

    Secondary structure

    1
    1411
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi646 – 6494
    Beta strandi651 – 66313
    Turni677 – 6804
    Beta strandi681 – 6888
    Beta strandi690 – 6923
    Beta strandi694 – 7018
    Helixi706 – 7105
    Beta strandi718 – 7225
    Helixi732 – 74110
    Beta strandi743 – 75412
    Beta strandi808 – 8169
    Turni817 – 8204
    Beta strandi821 – 83111
    Beta strandi836 – 8383
    Beta strandi843 – 8464
    Beta strandi854 – 8574
    Helixi885 – 8873
    Beta strandi890 – 8989
    Beta strandi900 – 9034
    Beta strandi910 – 9156
    Helixi916 – 9183
    Beta strandi925 – 9295

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1V27NMR-A807-934[»]
    1WFGNMR-A637-754[»]
    ProteinModelPortaliQ9UQ26.
    SMRiQ9UQ26. Positions 114-173, 641-754, 808-934, 1243-1390.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9UQ26.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini26 – 185160RabBDPROSITE-ProRule annotationAdd
    BLAST
    Domaini668 – 75487PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini807 – 913107C2 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1257 – 1359103C2 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 C2 domains.PROSITE-ProRule annotation
    Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 RabBD (Rab-binding) domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri117 – 17357FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG286957.
    HOGENOMiHOG000082403.
    HOVERGENiHBG058147.
    InParanoidiQ9UQ26.
    KOiK15297.
    PhylomeDBiQ9UQ26.
    TreeFamiTF321703.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    2.60.40.150. 2 hits.
    3.30.40.10. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR001478. PDZ.
    IPR017455. Znf_FYVE-rel.
    IPR010911. Znf_FYVE-typ.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF00168. C2. 2 hits.
    PF02318. FYVE_2. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00239. C2. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 2 hits.
    SSF50156. SSF50156. 1 hit.
    SSF57903. SSF57903. 2 hits.
    PROSITEiPS50004. C2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50916. RABBD. 1 hit.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 6 (identifier: Q9UQ26-6) [UniParc]FASTAAdd to Basket

    Also known as: RIM2-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAPVGPRGR LAPIPAASQP PLQPEMPDLS HLTEEERKII LAVMDRQKKK     50
    VKEEHKPQLT QWFPFSGITE LVNNVLQPQQ KQQNEKEPQT KLHQQFEMYK 100
    EQVKKMGEES QQQQEQKGDA PTCGICHKTK FADGCGHNCS YCQTKFCARC 150
    GGRVSLRSNK VMWVCNLCRK QQEILTKSGA WFYNSGSNTP QQPDQKVLRG 200
    LRNEEAPQEK KPKLHEQTQF QGPSGDLSVP AVEKSRSHGL TRQHSIKNGS 250
    GVKHHIASDI ASDRKRSPSV SRDQNRRYDQ REEREEYSQY ATSDTAMPRS 300
    PSDYADRRSQ HEPQFYEDSD HLSYRDSNRR SHRHSKEYIV DDEDVESRDE 350
    YERQRREEEY QSRYRSDPNL ARYPVKPQPY EEQMRIHAEV SRARHERRHS 400
    DVSLANADLE DSRISMLRMD RPSRQRSISE RRAAMENQRS YSMERTREAQ 450
    GPSSYAQRTT NHSPPTPRRS PLPIDRPDLR RTDSLRKQHH LDPSSAVRKT 500
    KREKMETMLR NDSLSSDQSE SVRPPPPKPH KSKKGGKMRQ ISLSSSEEEL 550
    ASTPEYTSCD DVEIESESVS EKGDSQKGKR KTSEQAVLSD SNTRSERQKE 600
    MMYFGGHSLE EDLEWSEPQI KDSGVDTCSS TTLNEEHSHS DKHPVTWQPS 650
    KDGDRLIGRI LLNKRLKDGS VPRDSGAMLG LKVVGGKMTE SGRLCAFITK 700
    VKKGSLADTV GHLRPGDEVL EWNGRLLQGA TFEEVYNIIL ESKPEPQVEL 750
    VVSRPIGDIP RIPDSTHAQL ESSSSSFESQ KMDRPSISVT SPMSPGMLRD 800
    VPQFLSGQLS IKLWFDKVGH QLIVTILGAK DLPSREDGRP RNPYVKIYFL 850
    PDRSDKNKRR TKTVKKTLEP KWNQTFIYSP VHRREFRERM LEITLWDQAR 900
    VREEESEFLG EILIELETAL LDDEPHWYKL QTHDVSSLPL PHPSPYMPRR 950
    QLHGESPTRR LQRSKRISDS EVSDYDCDDG IGVVSDYRHD GRDLQSSTLS 1000
    VPEQVMSSNH CSPSGSPHRV DVIGRTRSWS PSVPPPQSRN VEQGLRGTRT 1050
    MTGHYNTISR MDRHRVMDDH YSPDRDRDCE AADRQPYHRS RSTEQRPLLE 1100
    RTTTRSRSTE RPDTNLMRSM PSLMTGRSAP PSPALSRSHP RTGSVQTSPS 1150
    STPVAGRRGR QLPQLPPKGT LDRKAGGKKL RSTVQRSTET GLAVEMRNWM 1200
    TRQASRESTD GSMNSYSSEG NLIFPGVRLA SDSQFSDFLD GLGPAQLVGR 1250
    QTLATPAMGD IQVGMMDKKG QLEVEIIRAR GLVVKPGSKT LPAPYVKVYL 1300
    LDNGVCIAKK KTKVARKTLE PLYQQLLSFE ESPQGKVLQI IVWGDYGRMD 1350
    HKSFMGVAQI LLDELELSNM VIGWFKLFPP SSLVDPTLAP LTRRASQSSL 1400
    ESSTGPSYSR S 1411

    Note: No experimental confirmation available.

    Length:1,411
    Mass (Da):160,403
    Last modified:January 16, 2004 - v2
    Checksum:i9D4E83F4CBE4A864
    GO
    Isoform 1 (identifier: Q9UQ26-1) [UniParc]FASTAAdd to Basket

    Also known as: RIM2-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-223: Missing.
         224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA

    Show »
    Length:1,188
    Mass (Da):135,250
    Checksum:iDD65DB32288055AF
    GO
    Isoform 2 (identifier: Q9UQ26-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1038-1038: S → R
         1039-1411: Missing.

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:1,038
    Mass (Da):119,057
    Checksum:i6EFF188912E7C9B7
    GO
    Isoform 3 (identifier: Q9UQ26-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-223: Missing.
         224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
         575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
         1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG

    Note: No experimental confirmation available.

    Show »
    Length:1,163
    Mass (Da):132,670
    Checksum:i30E1EB86C76B0998
    GO
    Isoform 4 (identifier: Q9UQ26-4) [UniParc]FASTAAdd to Basket

    Also known as: RimL3a

    The sequence of this isoform differs from the canonical sequence as follows:
         774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK
         802-1411: Missing.

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:801
    Mass (Da):91,941
    Checksum:iAC3B759DF8D4640F
    GO
    Isoform 5 (identifier: Q9UQ26-5) [UniParc]FASTAAdd to Basket

    Also known as: RimL3c

    The sequence of this isoform differs from the canonical sequence as follows:
         811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK
         825-1411: Missing.

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:824
    Mass (Da):94,172
    Checksum:i8C1E96D4AA918687
    GO
    Isoform 7 (identifier: Q9UQ26-7) [UniParc]FASTAAdd to Basket

    Also known as: RIM2-gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1126: Missing.
         1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE

    Show »
    Length:285
    Mass (Da):30,972
    Checksum:i6E39DC2A4F246F79
    GO
    Isoform 8 (identifier: Q9UQ26-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK
         575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
         810-810: S → SSQSLSRRTTPFVPRVQ

    Note: No experimental confirmation available.

    Show »
    Length:1,349
    Mass (Da):153,363
    Checksum:iD385AB7B1AB598D6
    GO

    Sequence cautioni

    The sequence BAA34471.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti309 – 3091S → F in AAH43144. (PubMed:15489334)Curated
    Sequence conflicti518 – 5181Q → R in AAH43144. (PubMed:15489334)Curated
    Sequence conflicti947 – 9471M → V in BAG54403. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11261126Missing in isoform 7. CuratedVSP_040864Add
    BLAST
    Alternative sequencei1 – 223223Missing in isoform 1 and isoform 3. 2 PublicationsVSP_040865Add
    BLAST
    Alternative sequencei50 – 9041KVKEE…KEPQT → EEEKEQSVLK in isoform 8. 1 PublicationVSP_044661Add
    BLAST
    Alternative sequencei224 – 26340SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3. 2 PublicationsVSP_040866Add
    BLAST
    Alternative sequencei575 – 64268SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8. 2 PublicationsVSP_040867Add
    BLAST
    Alternative sequencei774 – 80128SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4. 1 PublicationVSP_040868Add
    BLAST
    Alternative sequencei802 – 1411610Missing in isoform 4. 1 PublicationVSP_040871Add
    BLAST
    Alternative sequencei810 – 8101S → SSQSLSRRTTPFVPRVQ in isoform 8. 1 PublicationVSP_044662
    Alternative sequencei811 – 82414IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5. 1 PublicationVSP_040869Add
    BLAST
    Alternative sequencei825 – 1411587Missing in isoform 5. 1 PublicationVSP_040870Add
    BLAST
    Alternative sequencei1038 – 10381S → R in isoform 2. 1 PublicationVSP_040872
    Alternative sequencei1039 – 1411373Missing in isoform 2. 1 PublicationVSP_040873Add
    BLAST
    Alternative sequencei1076 – 10761D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3. 1 PublicationVSP_040874
    Alternative sequencei1127 – 117448RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7. CuratedVSP_040875Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018294 mRNA. Translation: BAA34471.2. Different initiation.
    AF007156 mRNA. Translation: AAC19157.1.
    AK126939 mRNA. Translation: BAG54403.1.
    AC007751 Genomic DNA. No translation available.
    AC012213 Genomic DNA. No translation available.
    AC090448 Genomic DNA. No translation available.
    AC090686 Genomic DNA. No translation available.
    AC107933 Genomic DNA. No translation available.
    AP001572 Genomic DNA. No translation available.
    AP002849 Genomic DNA. No translation available.
    BC043144 mRNA. Translation: AAH43144.1.
    AY057119 mRNA. Translation: AAL23679.1.
    AY057121 mRNA. Translation: AAL23681.1.
    CCDSiCCDS43761.1. [Q9UQ26-3]
    CCDS55269.1. [Q9UQ26-8]
    CCDS64948.1. [Q9UQ26-1]
    CCDS64949.1. [Q9UQ26-7]
    RefSeqiNP_001093587.1. NM_001100117.2. [Q9UQ26-8]
    NP_001269810.1. NM_001282881.1. [Q9UQ26-1]
    NP_001269811.1. NM_001282882.1. [Q9UQ26-7]
    NP_055492.3. NM_014677.4. [Q9UQ26-3]
    UniGeneiHs.655271.
    Hs.735969.

    Genome annotation databases

    GeneIDi9699.
    KEGGihsa:9699.
    UCSCiuc003ylq.3. human. [Q9UQ26-3]
    uc003ylr.3. human. [Q9UQ26-1]

    Polymorphism databases

    DMDMi41019522.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018294 mRNA. Translation: BAA34471.2 . Different initiation.
    AF007156 mRNA. Translation: AAC19157.1 .
    AK126939 mRNA. Translation: BAG54403.1 .
    AC007751 Genomic DNA. No translation available.
    AC012213 Genomic DNA. No translation available.
    AC090448 Genomic DNA. No translation available.
    AC090686 Genomic DNA. No translation available.
    AC107933 Genomic DNA. No translation available.
    AP001572 Genomic DNA. No translation available.
    AP002849 Genomic DNA. No translation available.
    BC043144 mRNA. Translation: AAH43144.1 .
    AY057119 mRNA. Translation: AAL23679.1 .
    AY057121 mRNA. Translation: AAL23681.1 .
    CCDSi CCDS43761.1. [Q9UQ26-3 ]
    CCDS55269.1. [Q9UQ26-8 ]
    CCDS64948.1. [Q9UQ26-1 ]
    CCDS64949.1. [Q9UQ26-7 ]
    RefSeqi NP_001093587.1. NM_001100117.2. [Q9UQ26-8 ]
    NP_001269810.1. NM_001282881.1. [Q9UQ26-1 ]
    NP_001269811.1. NM_001282882.1. [Q9UQ26-7 ]
    NP_055492.3. NM_014677.4. [Q9UQ26-3 ]
    UniGenei Hs.655271.
    Hs.735969.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1V27 NMR - A 807-934 [» ]
    1WFG NMR - A 637-754 [» ]
    ProteinModelPortali Q9UQ26.
    SMRi Q9UQ26. Positions 114-173, 641-754, 808-934, 1243-1390.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115051. 10 interactions.
    IntActi Q9UQ26. 6 interactions.
    MINTi MINT-3083593.
    STRINGi 9606.ENSP00000386228.

    PTM databases

    PhosphoSitei Q9UQ26.

    Polymorphism databases

    DMDMi 41019522.

    Proteomic databases

    MaxQBi Q9UQ26.
    PaxDbi Q9UQ26.
    PRIDEi Q9UQ26.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 9699.
    KEGGi hsa:9699.
    UCSCi uc003ylq.3. human. [Q9UQ26-3 ]
    uc003ylr.3. human. [Q9UQ26-1 ]

    Organism-specific databases

    CTDi 9699.
    GeneCardsi GC08P104582.
    H-InvDB HIX0020449.
    HGNCi HGNC:17283. RIMS2.
    HPAi HPA046538.
    HPA053672.
    MIMi 606630. gene.
    neXtProti NX_Q9UQ26.
    PharmGKBi PA38445.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG286957.
    HOGENOMi HOG000082403.
    HOVERGENi HBG058147.
    InParanoidi Q9UQ26.
    KOi K15297.
    PhylomeDBi Q9UQ26.
    TreeFami TF321703.

    Miscellaneous databases

    EvolutionaryTracei Q9UQ26.
    GeneWikii RIMS2.
    GenomeRNAii 9699.
    NextBioi 36445.
    PROi Q9UQ26.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UQ26.
    Bgeei Q9UQ26.
    CleanExi HS_RIMS2.
    Genevestigatori Q9UQ26.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    2.60.40.150. 2 hits.
    3.30.40.10. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR001478. PDZ.
    IPR017455. Znf_FYVE-rel.
    IPR010911. Znf_FYVE-typ.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF00168. C2. 2 hits.
    PF02318. FYVE_2. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00239. C2. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 2 hits.
    SSF50156. SSF50156. 1 hit.
    SSF57903. SSF57903. 2 hits.
    PROSITEi PS50004. C2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50916. RABBD. 1 hit.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Yu W., Sarginson J., Gibbs R.A.
      Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
      Tissue: Brain.
    4. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Hypothalamus.
    6. Ho H.C.
      Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 689-1411 (ISOFORMS 4 AND 5).
    7. "Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins."
      Wang Y., Suedhof T.C.
      Genomics 81:126-137(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, GENOMIC ORGANIZATION.
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-689; SER-691 AND THR-699, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400 AND SER-1396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "PDZ domain and the first C2 domain of human RIM2B."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 637-934.

    Entry informationi

    Entry nameiRIMS2_HUMAN
    AccessioniPrimary (citable) accession number: Q9UQ26
    Secondary accession number(s): B3KX91
    , F8WD47, O43413, Q86XL9, Q8IWV9, Q8IWW1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 29, 2003
    Last sequence update: January 16, 2004
    Last modified: October 1, 2014
    This is version 137 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3