Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulating synaptic membrane exocytosis protein 2

Gene

RIMS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Rab effector involved in exocytosis. May act as scaffold protein. Plays a role in dendrite formation by melanocytes (PubMed:23999003).1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri117 – 173FYVE-typePROSITE-ProRule annotationAdd BLAST57

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Differentiation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Regulating synaptic membrane exocytosis protein 2
Alternative name(s):
Rab-3-interacting molecule 2
Short name:
RIM 2
Rab-3-interacting protein 3
Gene namesi
Name:RIMS2
Synonyms:KIAA0751, RAB3IP3, RIM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:17283. RIMS2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • extracellular exosome Source: UniProtKB
  • intracellular Source: GOC
  • presynaptic active zone Source: ParkinsonsUK-UCL
  • presynaptic membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi9699.
OpenTargetsiENSG00000176406.
PharmGKBiPA38445.

Polymorphism and mutation databases

BioMutaiRIMS2.
DMDMi41019522.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001902011 – 1411Regulating synaptic membrane exocytosis protein 2Add BLAST1411

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei400PhosphoserineCombined sources1
Modified residuei689PhosphothreonineCombined sources1
Modified residuei791PhosphoserineBy similarity1
Modified residuei794PhosphoserineBy similarity1
Modified residuei1148PhosphoserineBy similarity1
Modified residuei1396PhosphoserineCombined sources1
Modified residuei1399PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UQ26.
PeptideAtlasiQ9UQ26.
PRIDEiQ9UQ26.

PTM databases

iPTMnetiQ9UQ26.
PhosphoSitePlusiQ9UQ26.

Expressioni

Tissue specificityi

Expressed in melanocytes (PubMed:23999003).1 Publication

Gene expression databases

BgeeiENSG00000176406.
CleanExiHS_RIMS2.
ExpressionAtlasiQ9UQ26. baseline and differential.
GenevisibleiQ9UQ26. HS.

Organism-specific databases

HPAiHPA046538.
HPA053672.

Interactioni

Subunit structurei

Interacts with RAB3A and RAB3B that have been activated by GTP-binding. Interacts with RAB3C, RAB3D and RAB26. Interacts with TSPOAP1 and RIMBP2. Interacts with PPFIA3 and PPFIA4. Interacts via its zinc finger with the first C2 domain of UNC13A. Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO. Part of a ternary complex involving PCLO and EPAC2 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
NCK1P163332EBI-1756749,EBI-389883

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115051. 5 interactors.
IntActiQ9UQ26. 6 interactors.
MINTiMINT-3083593.

Structurei

Secondary structure

11411
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi646 – 649Combined sources4
Beta strandi651 – 663Combined sources13
Turni677 – 680Combined sources4
Beta strandi681 – 688Combined sources8
Beta strandi690 – 692Combined sources3
Beta strandi694 – 701Combined sources8
Helixi706 – 710Combined sources5
Beta strandi718 – 722Combined sources5
Helixi732 – 741Combined sources10
Beta strandi743 – 754Combined sources12
Beta strandi808 – 816Combined sources9
Turni817 – 820Combined sources4
Beta strandi821 – 831Combined sources11
Beta strandi836 – 838Combined sources3
Beta strandi843 – 846Combined sources4
Beta strandi854 – 857Combined sources4
Helixi885 – 887Combined sources3
Beta strandi890 – 898Combined sources9
Beta strandi900 – 903Combined sources4
Beta strandi910 – 915Combined sources6
Helixi916 – 918Combined sources3
Beta strandi925 – 929Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V27NMR-A807-934[»]
1WFGNMR-A637-754[»]
ProteinModelPortaliQ9UQ26.
SMRiQ9UQ26.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UQ26.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 185RabBDPROSITE-ProRule annotationAdd BLAST160
Domaini668 – 754PDZPROSITE-ProRule annotationAdd BLAST87
Domaini807 – 913C2 1PROSITE-ProRule annotationAdd BLAST107
Domaini1257 – 1359C2 2PROSITE-ProRule annotationAdd BLAST103

Sequence similaritiesi

Contains 2 C2 domains.PROSITE-ProRule annotation
Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RabBD (Rab-binding) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri117 – 173FYVE-typePROSITE-ProRule annotationAdd BLAST57

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00550000074588.
HOGENOMiHOG000082403.
HOVERGENiHBG058147.
InParanoidiQ9UQ26.
KOiK15297.
PhylomeDBiQ9UQ26.
TreeFamiTF321703.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
2.60.40.150. 2 hits.
3.30.40.10. 2 hits.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR010911. Rab_BD.
IPR030631. RIM2.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR12157:SF15. PTHR12157:SF15. 2 hits.
PfamiPF00168. C2. 2 hits.
PF02318. FYVE_2. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF50156. SSF50156. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEiPS50004. C2. 2 hits.
PS50106. PDZ. 1 hit.
PS50916. RABBD. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 6 (identifier: Q9UQ26-6) [UniParc]FASTAAdd to basket
Also known as: RIM2-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPVGPRGR LAPIPAASQP PLQPEMPDLS HLTEEERKII LAVMDRQKKK
60 70 80 90 100
VKEEHKPQLT QWFPFSGITE LVNNVLQPQQ KQQNEKEPQT KLHQQFEMYK
110 120 130 140 150
EQVKKMGEES QQQQEQKGDA PTCGICHKTK FADGCGHNCS YCQTKFCARC
160 170 180 190 200
GGRVSLRSNK VMWVCNLCRK QQEILTKSGA WFYNSGSNTP QQPDQKVLRG
210 220 230 240 250
LRNEEAPQEK KPKLHEQTQF QGPSGDLSVP AVEKSRSHGL TRQHSIKNGS
260 270 280 290 300
GVKHHIASDI ASDRKRSPSV SRDQNRRYDQ REEREEYSQY ATSDTAMPRS
310 320 330 340 350
PSDYADRRSQ HEPQFYEDSD HLSYRDSNRR SHRHSKEYIV DDEDVESRDE
360 370 380 390 400
YERQRREEEY QSRYRSDPNL ARYPVKPQPY EEQMRIHAEV SRARHERRHS
410 420 430 440 450
DVSLANADLE DSRISMLRMD RPSRQRSISE RRAAMENQRS YSMERTREAQ
460 470 480 490 500
GPSSYAQRTT NHSPPTPRRS PLPIDRPDLR RTDSLRKQHH LDPSSAVRKT
510 520 530 540 550
KREKMETMLR NDSLSSDQSE SVRPPPPKPH KSKKGGKMRQ ISLSSSEEEL
560 570 580 590 600
ASTPEYTSCD DVEIESESVS EKGDSQKGKR KTSEQAVLSD SNTRSERQKE
610 620 630 640 650
MMYFGGHSLE EDLEWSEPQI KDSGVDTCSS TTLNEEHSHS DKHPVTWQPS
660 670 680 690 700
KDGDRLIGRI LLNKRLKDGS VPRDSGAMLG LKVVGGKMTE SGRLCAFITK
710 720 730 740 750
VKKGSLADTV GHLRPGDEVL EWNGRLLQGA TFEEVYNIIL ESKPEPQVEL
760 770 780 790 800
VVSRPIGDIP RIPDSTHAQL ESSSSSFESQ KMDRPSISVT SPMSPGMLRD
810 820 830 840 850
VPQFLSGQLS IKLWFDKVGH QLIVTILGAK DLPSREDGRP RNPYVKIYFL
860 870 880 890 900
PDRSDKNKRR TKTVKKTLEP KWNQTFIYSP VHRREFRERM LEITLWDQAR
910 920 930 940 950
VREEESEFLG EILIELETAL LDDEPHWYKL QTHDVSSLPL PHPSPYMPRR
960 970 980 990 1000
QLHGESPTRR LQRSKRISDS EVSDYDCDDG IGVVSDYRHD GRDLQSSTLS
1010 1020 1030 1040 1050
VPEQVMSSNH CSPSGSPHRV DVIGRTRSWS PSVPPPQSRN VEQGLRGTRT
1060 1070 1080 1090 1100
MTGHYNTISR MDRHRVMDDH YSPDRDRDCE AADRQPYHRS RSTEQRPLLE
1110 1120 1130 1140 1150
RTTTRSRSTE RPDTNLMRSM PSLMTGRSAP PSPALSRSHP RTGSVQTSPS
1160 1170 1180 1190 1200
STPVAGRRGR QLPQLPPKGT LDRKAGGKKL RSTVQRSTET GLAVEMRNWM
1210 1220 1230 1240 1250
TRQASRESTD GSMNSYSSEG NLIFPGVRLA SDSQFSDFLD GLGPAQLVGR
1260 1270 1280 1290 1300
QTLATPAMGD IQVGMMDKKG QLEVEIIRAR GLVVKPGSKT LPAPYVKVYL
1310 1320 1330 1340 1350
LDNGVCIAKK KTKVARKTLE PLYQQLLSFE ESPQGKVLQI IVWGDYGRMD
1360 1370 1380 1390 1400
HKSFMGVAQI LLDELELSNM VIGWFKLFPP SSLVDPTLAP LTRRASQSSL
1410
ESSTGPSYSR S
Note: No experimental confirmation available.
Length:1,411
Mass (Da):160,403
Last modified:January 16, 2004 - v2
Checksum:i9D4E83F4CBE4A864
GO
Isoform 1 (identifier: Q9UQ26-1) [UniParc]FASTAAdd to basket
Also known as: RIM2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA

Show »
Length:1,188
Mass (Da):135,250
Checksum:iDD65DB32288055AF
GO
Isoform 2 (identifier: Q9UQ26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1038-1038: S → R
     1039-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:1,038
Mass (Da):119,057
Checksum:i6EFF188912E7C9B7
GO
Isoform 3 (identifier: Q9UQ26-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG

Note: No experimental confirmation available.
Show »
Length:1,163
Mass (Da):132,670
Checksum:i30E1EB86C76B0998
GO
Isoform 4 (identifier: Q9UQ26-4) [UniParc]FASTAAdd to basket
Also known as: RimL3a

The sequence of this isoform differs from the canonical sequence as follows:
     774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK
     802-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:801
Mass (Da):91,941
Checksum:iAC3B759DF8D4640F
GO
Isoform 5 (identifier: Q9UQ26-5) [UniParc]FASTAAdd to basket
Also known as: RimL3c

The sequence of this isoform differs from the canonical sequence as follows:
     811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK
     825-1411: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:824
Mass (Da):94,172
Checksum:i8C1E96D4AA918687
GO
Isoform 7 (identifier: Q9UQ26-7) [UniParc]FASTAAdd to basket
Also known as: RIM2-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.
     1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE

Show »
Length:285
Mass (Da):30,972
Checksum:i6E39DC2A4F246F79
GO
Isoform 8 (identifier: Q9UQ26-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     810-810: S → SSQSLSRRTTPFVPRVQ

Note: No experimental confirmation available.
Show »
Length:1,349
Mass (Da):153,363
Checksum:iD385AB7B1AB598D6
GO

Sequence cautioni

The sequence BAA34471 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti309S → F in AAH43144 (PubMed:15489334).Curated1
Sequence conflicti518Q → R in AAH43144 (PubMed:15489334).Curated1
Sequence conflicti947M → V in BAG54403 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0408641 – 1126Missing in isoform 7. CuratedAdd BLAST1126
Alternative sequenceiVSP_0408651 – 223Missing in isoform 1 and isoform 3. 2 PublicationsAdd BLAST223
Alternative sequenceiVSP_04466150 – 90KVKEE…KEPQT → EEEKEQSVLK in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_040866224 – 263SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_040867575 – 642SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_040868774 – 801SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_040871802 – 1411Missing in isoform 4. 1 PublicationAdd BLAST610
Alternative sequenceiVSP_044662810S → SSQSLSRRTTPFVPRVQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_040869811 – 824IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_040870825 – 1411Missing in isoform 5. 1 PublicationAdd BLAST587
Alternative sequenceiVSP_0408721038S → R in isoform 2. 1 Publication1
Alternative sequenceiVSP_0408731039 – 1411Missing in isoform 2. 1 PublicationAdd BLAST373
Alternative sequenceiVSP_0408741076D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3. 1 Publication1
Alternative sequenceiVSP_0408751127 – 1174RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7. CuratedAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018294 mRNA. Translation: BAA34471.2. Different initiation.
AF007156 mRNA. Translation: AAC19157.1.
AK126939 mRNA. Translation: BAG54403.1.
AC007751 Genomic DNA. No translation available.
AC012213 Genomic DNA. No translation available.
AC090448 Genomic DNA. No translation available.
AC090686 Genomic DNA. No translation available.
AC107933 Genomic DNA. No translation available.
AP001572 Genomic DNA. No translation available.
AP002849 Genomic DNA. No translation available.
BC043144 mRNA. Translation: AAH43144.1.
AY057119 mRNA. Translation: AAL23679.1.
AY057121 mRNA. Translation: AAL23681.1.
CCDSiCCDS43761.1. [Q9UQ26-3]
CCDS55269.1. [Q9UQ26-8]
CCDS64948.1. [Q9UQ26-1]
CCDS64949.1. [Q9UQ26-7]
RefSeqiNP_001093587.1. NM_001100117.2. [Q9UQ26-8]
NP_001269810.1. NM_001282881.1. [Q9UQ26-1]
NP_001269811.1. NM_001282882.1. [Q9UQ26-7]
NP_055492.3. NM_014677.4. [Q9UQ26-3]
UniGeneiHs.655271.
Hs.735969.

Genome annotation databases

EnsembliENST00000262231; ENSP00000262231; ENSG00000176406. [Q9UQ26-1]
ENST00000339750; ENSP00000342051; ENSG00000176406. [Q9UQ26-7]
ENST00000504942; ENSP00000427018; ENSG00000176406. [Q9UQ26-8]
ENST00000507740; ENSP00000423559; ENSG00000176406. [Q9UQ26-3]
GeneIDi9699.
KEGGihsa:9699.
UCSCiuc003ylq.4. human. [Q9UQ26-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018294 mRNA. Translation: BAA34471.2. Different initiation.
AF007156 mRNA. Translation: AAC19157.1.
AK126939 mRNA. Translation: BAG54403.1.
AC007751 Genomic DNA. No translation available.
AC012213 Genomic DNA. No translation available.
AC090448 Genomic DNA. No translation available.
AC090686 Genomic DNA. No translation available.
AC107933 Genomic DNA. No translation available.
AP001572 Genomic DNA. No translation available.
AP002849 Genomic DNA. No translation available.
BC043144 mRNA. Translation: AAH43144.1.
AY057119 mRNA. Translation: AAL23679.1.
AY057121 mRNA. Translation: AAL23681.1.
CCDSiCCDS43761.1. [Q9UQ26-3]
CCDS55269.1. [Q9UQ26-8]
CCDS64948.1. [Q9UQ26-1]
CCDS64949.1. [Q9UQ26-7]
RefSeqiNP_001093587.1. NM_001100117.2. [Q9UQ26-8]
NP_001269810.1. NM_001282881.1. [Q9UQ26-1]
NP_001269811.1. NM_001282882.1. [Q9UQ26-7]
NP_055492.3. NM_014677.4. [Q9UQ26-3]
UniGeneiHs.655271.
Hs.735969.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V27NMR-A807-934[»]
1WFGNMR-A637-754[»]
ProteinModelPortaliQ9UQ26.
SMRiQ9UQ26.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115051. 5 interactors.
IntActiQ9UQ26. 6 interactors.
MINTiMINT-3083593.

PTM databases

iPTMnetiQ9UQ26.
PhosphoSitePlusiQ9UQ26.

Polymorphism and mutation databases

BioMutaiRIMS2.
DMDMi41019522.

Proteomic databases

EPDiQ9UQ26.
PeptideAtlasiQ9UQ26.
PRIDEiQ9UQ26.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262231; ENSP00000262231; ENSG00000176406. [Q9UQ26-1]
ENST00000339750; ENSP00000342051; ENSG00000176406. [Q9UQ26-7]
ENST00000504942; ENSP00000427018; ENSG00000176406. [Q9UQ26-8]
ENST00000507740; ENSP00000423559; ENSG00000176406. [Q9UQ26-3]
GeneIDi9699.
KEGGihsa:9699.
UCSCiuc003ylq.4. human. [Q9UQ26-6]

Organism-specific databases

CTDi9699.
DisGeNETi9699.
GeneCardsiRIMS2.
H-InvDBHIX0020449.
HGNCiHGNC:17283. RIMS2.
HPAiHPA046538.
HPA053672.
MIMi606630. gene.
neXtProtiNX_Q9UQ26.
OpenTargetsiENSG00000176406.
PharmGKBiPA38445.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00550000074588.
HOGENOMiHOG000082403.
HOVERGENiHBG058147.
InParanoidiQ9UQ26.
KOiK15297.
PhylomeDBiQ9UQ26.
TreeFamiTF321703.

Miscellaneous databases

ChiTaRSiRIMS2. human.
EvolutionaryTraceiQ9UQ26.
GeneWikiiRIMS2.
GenomeRNAii9699.
PROiQ9UQ26.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000176406.
CleanExiHS_RIMS2.
ExpressionAtlasiQ9UQ26. baseline and differential.
GenevisibleiQ9UQ26. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
2.60.40.150. 2 hits.
3.30.40.10. 2 hits.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR010911. Rab_BD.
IPR030631. RIM2.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR12157:SF15. PTHR12157:SF15. 2 hits.
PfamiPF00168. C2. 2 hits.
PF02318. FYVE_2. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
SSF50156. SSF50156. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEiPS50004. C2. 2 hits.
PS50106. PDZ. 1 hit.
PS50916. RABBD. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRIMS2_HUMAN
AccessioniPrimary (citable) accession number: Q9UQ26
Secondary accession number(s): B3KX91
, F8WD47, O43413, Q86XL9, Q8IWV9, Q8IWW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 16, 2004
Last modified: November 2, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.