Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UQ26 (RIMS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 136. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Regulating synaptic membrane exocytosis protein 2
Alternative name(s):
Rab-3-interacting molecule 2
Short name=RIM 2
Rab-3-interacting protein 3
Gene names
Name:RIMS2
Synonyms:KIAA0751, RAB3IP3, RIM2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1411 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Rab effector involved in exocytosis. May act as scaffold protein.

Subunit structure

Interacts with RAB3A and RAB3B that have been activated by GTP-binding. Interacts with RAB3C, RAB3D and RAB26. Interacts with BZRAP1/RIMBP1 and RIMBP2. Interacts with PPFIA3 and PPFIA4. Interacts via its zinc finger with the first C2 domain of UNC13A. Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO. Part of a ternary complex involving PCLO and EPAC2 By similarity.

Subcellular location

Cell membrane; Peripheral membrane protein By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepresynaptic cell membrane; Peripheral membrane protein By similarity.

Sequence similarities

Contains 2 C2 domains.

Contains 1 FYVE-type zinc finger.

Contains 1 PDZ (DHR) domain.

Contains 1 RabBD (Rab-binding) domain.

Sequence caution

The sequence BAA34471.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

NCK1P163332EBI-1756749,EBI-389883

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 6 (identifier: Q9UQ26-6)

Also known as: RIM2-alpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 1 (identifier: Q9UQ26-1)

Also known as: RIM2-beta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
Isoform 2 (identifier: Q9UQ26-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1038-1038: S → R
     1039-1411: Missing.
Note: May be due to an intron retention. No experimental confirmation available.
Isoform 3 (identifier: Q9UQ26-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9UQ26-4)

Also known as: RimL3a;

The sequence of this isoform differs from the canonical sequence as follows:
     774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK
     802-1411: Missing.
Note: May be due to an intron retention. No experimental confirmation available.
Isoform 5 (identifier: Q9UQ26-5)

Also known as: RimL3c;

The sequence of this isoform differs from the canonical sequence as follows:
     811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK
     825-1411: Missing.
Note: May be due to an intron retention. No experimental confirmation available.
Isoform 7 (identifier: Q9UQ26-7)

Also known as: RIM2-gamma;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.
     1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE
Isoform 8 (identifier: Q9UQ26-8)

The sequence of this isoform differs from the canonical sequence as follows:
     50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK
     575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL
     810-810: S → SSQSLSRRTTPFVPRVQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14111411Regulating synaptic membrane exocytosis protein 2
PRO_0000190201

Regions

Domain26 – 185160RabBD
Domain668 – 75487PDZ
Domain807 – 913107C2 1
Domain1257 – 1359103C2 2
Zinc finger117 – 17357FYVE-type

Amino acid modifications

Modified residue4001Phosphoserine Ref.9
Modified residue6891Phosphothreonine Ref.8
Modified residue6911Phosphoserine Ref.8
Modified residue6991Phosphothreonine Ref.8
Modified residue13961Phosphoserine Ref.9

Natural variations

Alternative sequence1 – 11261126Missing in isoform 7.
VSP_040864
Alternative sequence1 – 223223Missing in isoform 1 and isoform 3.
VSP_040865
Alternative sequence50 – 9041KVKEE…KEPQT → EEEKEQSVLK in isoform 8.
VSP_044661
Alternative sequence224 – 26340SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3.
VSP_040866
Alternative sequence575 – 64268SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8.
VSP_040867
Alternative sequence774 – 80128SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4.
VSP_040868
Alternative sequence802 – 1411610Missing in isoform 4.
VSP_040871
Alternative sequence8101S → SSQSLSRRTTPFVPRVQ in isoform 8.
VSP_044662
Alternative sequence811 – 82414IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5.
VSP_040869
Alternative sequence825 – 1411587Missing in isoform 5.
VSP_040870
Alternative sequence10381S → R in isoform 2.
VSP_040872
Alternative sequence1039 – 1411373Missing in isoform 2.
VSP_040873
Alternative sequence10761D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3.
VSP_040874
Alternative sequence1127 – 117448RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7.
VSP_040875

Experimental info

Sequence conflict3091S → F in AAH43144. Ref.5
Sequence conflict5181Q → R in AAH43144. Ref.5
Sequence conflict9471M → V in BAG54403. Ref.3

Secondary structure

......................................... 1411
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 6 (RIM2-alpha) [UniParc].

Last modified January 16, 2004. Version 2.
Checksum: 9D4E83F4CBE4A864

FASTA1,411160,403
        10         20         30         40         50         60 
MSAPVGPRGR LAPIPAASQP PLQPEMPDLS HLTEEERKII LAVMDRQKKK VKEEHKPQLT 

        70         80         90        100        110        120 
QWFPFSGITE LVNNVLQPQQ KQQNEKEPQT KLHQQFEMYK EQVKKMGEES QQQQEQKGDA 

       130        140        150        160        170        180 
PTCGICHKTK FADGCGHNCS YCQTKFCARC GGRVSLRSNK VMWVCNLCRK QQEILTKSGA 

       190        200        210        220        230        240 
WFYNSGSNTP QQPDQKVLRG LRNEEAPQEK KPKLHEQTQF QGPSGDLSVP AVEKSRSHGL 

       250        260        270        280        290        300 
TRQHSIKNGS GVKHHIASDI ASDRKRSPSV SRDQNRRYDQ REEREEYSQY ATSDTAMPRS 

       310        320        330        340        350        360 
PSDYADRRSQ HEPQFYEDSD HLSYRDSNRR SHRHSKEYIV DDEDVESRDE YERQRREEEY 

       370        380        390        400        410        420 
QSRYRSDPNL ARYPVKPQPY EEQMRIHAEV SRARHERRHS DVSLANADLE DSRISMLRMD 

       430        440        450        460        470        480 
RPSRQRSISE RRAAMENQRS YSMERTREAQ GPSSYAQRTT NHSPPTPRRS PLPIDRPDLR 

       490        500        510        520        530        540 
RTDSLRKQHH LDPSSAVRKT KREKMETMLR NDSLSSDQSE SVRPPPPKPH KSKKGGKMRQ 

       550        560        570        580        590        600 
ISLSSSEEEL ASTPEYTSCD DVEIESESVS EKGDSQKGKR KTSEQAVLSD SNTRSERQKE 

       610        620        630        640        650        660 
MMYFGGHSLE EDLEWSEPQI KDSGVDTCSS TTLNEEHSHS DKHPVTWQPS KDGDRLIGRI 

       670        680        690        700        710        720 
LLNKRLKDGS VPRDSGAMLG LKVVGGKMTE SGRLCAFITK VKKGSLADTV GHLRPGDEVL 

       730        740        750        760        770        780 
EWNGRLLQGA TFEEVYNIIL ESKPEPQVEL VVSRPIGDIP RIPDSTHAQL ESSSSSFESQ 

       790        800        810        820        830        840 
KMDRPSISVT SPMSPGMLRD VPQFLSGQLS IKLWFDKVGH QLIVTILGAK DLPSREDGRP 

       850        860        870        880        890        900 
RNPYVKIYFL PDRSDKNKRR TKTVKKTLEP KWNQTFIYSP VHRREFRERM LEITLWDQAR 

       910        920        930        940        950        960 
VREEESEFLG EILIELETAL LDDEPHWYKL QTHDVSSLPL PHPSPYMPRR QLHGESPTRR 

       970        980        990       1000       1010       1020 
LQRSKRISDS EVSDYDCDDG IGVVSDYRHD GRDLQSSTLS VPEQVMSSNH CSPSGSPHRV 

      1030       1040       1050       1060       1070       1080 
DVIGRTRSWS PSVPPPQSRN VEQGLRGTRT MTGHYNTISR MDRHRVMDDH YSPDRDRDCE 

      1090       1100       1110       1120       1130       1140 
AADRQPYHRS RSTEQRPLLE RTTTRSRSTE RPDTNLMRSM PSLMTGRSAP PSPALSRSHP 

      1150       1160       1170       1180       1190       1200 
RTGSVQTSPS STPVAGRRGR QLPQLPPKGT LDRKAGGKKL RSTVQRSTET GLAVEMRNWM 

      1210       1220       1230       1240       1250       1260 
TRQASRESTD GSMNSYSSEG NLIFPGVRLA SDSQFSDFLD GLGPAQLVGR QTLATPAMGD 

      1270       1280       1290       1300       1310       1320 
IQVGMMDKKG QLEVEIIRAR GLVVKPGSKT LPAPYVKVYL LDNGVCIAKK KTKVARKTLE 

      1330       1340       1350       1360       1370       1380 
PLYQQLLSFE ESPQGKVLQI IVWGDYGRMD HKSFMGVAQI LLDELELSNM VIGWFKLFPP 

      1390       1400       1410 
SSLVDPTLAP LTRRASQSSL ESSTGPSYSR S 

« Hide

Isoform 1 (RIM2-beta) [UniParc].

Checksum: DD65DB32288055AF
Show »

FASTA1,188135,250
Isoform 2 [UniParc].

Checksum: 6EFF188912E7C9B7
Show »

FASTA1,038119,057
Isoform 3 [UniParc].

Checksum: 30E1EB86C76B0998
Show »

FASTA1,163132,670
Isoform 4 (RimL3a) [UniParc].

Checksum: AC3B759DF8D4640F
Show »

FASTA80191,941
Isoform 5 (RimL3c) [UniParc].

Checksum: 8C1E96D4AA918687
Show »

FASTA82494,172
Isoform 7 (RIM2-gamma) [UniParc].

Checksum: 6E39DC2A4F246F79
Show »

FASTA28530,972
Isoform 8 [UniParc].

Checksum: D385AB7B1AB598D6
Show »

FASTA1,349153,363

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]Yu W., Sarginson J., Gibbs R.A.
Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
Tissue: Brain.
[4]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Hypothalamus.
[6]Ho H.C.
Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 689-1411 (ISOFORMS 4 AND 5).
[7]"Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins."
Wang Y., Suedhof T.C.
Genomics 81:126-137(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, GENOMIC ORGANIZATION.
[8]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-689; SER-691 AND THR-699, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[9]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400 AND SER-1396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"PDZ domain and the first C2 domain of human RIM2B."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2004) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 637-934.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB018294 mRNA. Translation: BAA34471.2. Different initiation.
AF007156 mRNA. Translation: AAC19157.1.
AK126939 mRNA. Translation: BAG54403.1.
AC007751 Genomic DNA. No translation available.
AC012213 Genomic DNA. No translation available.
AC090448 Genomic DNA. No translation available.
AC090686 Genomic DNA. No translation available.
AC107933 Genomic DNA. No translation available.
AP001572 Genomic DNA. No translation available.
AP002849 Genomic DNA. No translation available.
BC043144 mRNA. Translation: AAH43144.1.
AY057119 mRNA. Translation: AAL23679.1.
AY057121 mRNA. Translation: AAL23681.1.
CCDSCCDS43761.1. [Q9UQ26-3]
CCDS55269.1. [Q9UQ26-8]
CCDS64948.1. [Q9UQ26-1]
CCDS64949.1. [Q9UQ26-7]
RefSeqNP_001093587.1. NM_001100117.2. [Q9UQ26-8]
NP_001269810.1. NM_001282881.1. [Q9UQ26-1]
NP_001269811.1. NM_001282882.1. [Q9UQ26-7]
NP_055492.3. NM_014677.4. [Q9UQ26-3]
UniGeneHs.655271.
Hs.735969.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1V27NMR-A807-934[»]
1WFGNMR-A637-754[»]
ProteinModelPortalQ9UQ26.
SMRQ9UQ26. Positions 114-173, 641-754, 808-934, 1243-1390.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115051. 10 interactions.
IntActQ9UQ26. 6 interactions.
MINTMINT-3083593.
STRING9606.ENSP00000386228.

PTM databases

PhosphoSiteQ9UQ26.

Polymorphism databases

DMDM41019522.

Proteomic databases

MaxQBQ9UQ26.
PaxDbQ9UQ26.
PRIDEQ9UQ26.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262231; ENSP00000262231; ENSG00000176406. [Q9UQ26-1]
ENST00000339750; ENSP00000342051; ENSG00000176406. [Q9UQ26-7]
ENST00000406091; ENSP00000384892; ENSG00000176406. [Q9UQ26-8]
ENST00000507740; ENSP00000423559; ENSG00000176406. [Q9UQ26-3]
GeneID9699.
KEGGhsa:9699.
UCSCuc003ylq.3. human. [Q9UQ26-3]
uc003ylr.3. human. [Q9UQ26-1]

Organism-specific databases

CTD9699.
GeneCardsGC08P104582.
H-InvDBHIX0020449.
HGNCHGNC:17283. RIMS2.
HPAHPA046538.
HPA053672.
MIM606630. gene.
neXtProtNX_Q9UQ26.
PharmGKBPA38445.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG286957.
HOGENOMHOG000082403.
HOVERGENHBG058147.
InParanoidQ9UQ26.
KOK15297.
PhylomeDBQ9UQ26.
TreeFamTF321703.

Gene expression databases

ArrayExpressQ9UQ26.
BgeeQ9UQ26.
CleanExHS_RIMS2.
GenevestigatorQ9UQ26.

Family and domain databases

Gene3D2.30.42.10. 1 hit.
2.60.40.150. 2 hits.
3.30.40.10. 2 hits.
InterProIPR000008. C2_dom.
IPR001478. PDZ.
IPR017455. Znf_FYVE-rel.
IPR010911. Znf_FYVE-typ.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamPF00168. C2. 2 hits.
PF02318. FYVE_2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTSM00239. C2. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 2 hits.
SSF50156. SSF50156. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEPS50004. C2. 2 hits.
PS50106. PDZ. 1 hit.
PS50916. RABBD. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9UQ26.
GeneWikiRIMS2.
GenomeRNAi9699.
NextBio36445.
PROQ9UQ26.
SOURCESearch...

Entry information

Entry nameRIMS2_HUMAN
AccessionPrimary (citable) accession number: Q9UQ26
Secondary accession number(s): B3KX91 expand/collapse secondary AC list , F8WD47, O43413, Q86XL9, Q8IWV9, Q8IWW1
Entry history
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 16, 2004
Last modified: July 9, 2014
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM