Q9UQ26 (RIMS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Regulating synaptic membrane exocytosis protein 2 Alternative name(s): Rab-3-interacting molecule 2 Short name=RIM 2 Rab-3-interacting protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1411 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Rab effector involved in exocytosis. May act as scaffold protein. |
| Subunit structure | Interacts with RAB3A and RAB3B that have been activated by GTP-binding. Interacts with RAB3C, RAB3D and RAB26. Interacts with BZRAP1/RIMBP1 and RIMBP2. Interacts with PPFIA3 and PPFIA4. Interacts via its zinc finger with the first C2 domain of UNC13A. Forms a complex consisting of UNC13A, RIMS2 and RAB3A. Heterodimer with PCLO. Part of a ternary complex involving PCLO and EPAC2 By similarity. |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. Cell junction › synapse By similarity. Cell junction › synapse › presynaptic cell membrane; Peripheral membrane protein By similarity. |
| Sequence similarities | Contains 2 C2 domains. Contains 1 FYVE-type zinc finger. Contains 1 PDZ (DHR) domain. Contains 1 RabBD (Rab-binding) domain. |
| Sequence caution | The sequence BAA34471.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Membrane Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intracellular protein transport Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell presynaptic membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NCK1 | P16333 | 2 | EBI-1756749,EBI-389883 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 6 (identifier: Q9UQ26-6) Also known as: RIM2-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 1 (identifier: Q9UQ26-1) Also known as: RIM2-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-223: Missing. 224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA | ||||||
| Isoform 2 (identifier: Q9UQ26-2) The sequence of this isoform differs from the canonical sequence as follows: 1038-1038: S → R 1039-1411: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9UQ26-3) The sequence of this isoform differs from the canonical sequence as follows: 1-223: Missing. 224-263: SGDLSVPAVE...HHIASDIASD → MQFETLRQVC...ELFGQTLNNA 575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL 1076-1076: D → DSHFLTLPRSRYSQTIDHHHRDG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9UQ26-4) Also known as: RimL3a; The sequence of this isoform differs from the canonical sequence as follows: 774-801: SSSFESQKMDRPSISVTSPMSPGMLRDV → KFYLCWKKTLFIIAFIRDQMKYLTSNVK 802-1411: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9UQ26-5) Also known as: RimL3c; The sequence of this isoform differs from the canonical sequence as follows: 811-824: IKLWFDKVGHQLIV → VCSHYVYSSFWNIK 825-1411: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q9UQ26-7) Also known as: RIM2-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-1126: Missing. 1127-1174: RSAPPSPALS...LPPKGTLDRK → MGRQGLGGAS...MNSLEEEEGE | ||||||
| Isoform 8 (identifier: Q9UQ26-8) The sequence of this isoform differs from the canonical sequence as follows: 50-90: KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT → EEEKEQSVLK 575-642: SQKGKRKTSE...LNEEHSHSDK → MDYNWLDHTSWHSSEASPMSL 810-810: S → SSQSLSRRTTPFVPRVQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1411 | 1411 | Regulating synaptic membrane exocytosis protein 2 | PRO_0000190201 | |||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 26 – 185 | 160 | RabBD | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 668 – 754 | 87 | PDZ | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 807 – 913 | 107 | C2 1 | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1257 – 1359 | 103 | C2 2 | ||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 117 – 173 | 57 | FYVE-type | ||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 366 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 400 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 689 | 1 | Phosphothreonine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 691 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 699 | 1 | Phosphothreonine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1030 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1147 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1396 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1126 | 1126 | Missing in isoform 7. | VSP_040864 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 223 | 223 | Missing in isoform 1 and isoform 3. | VSP_040865 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 50 – 90 | 41 | KVKEE…KEPQT → EEEKEQSVLK in isoform 8. | VSP_044661 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 224 – 263 | 40 | SGDLS…DIASD → MQFETLRQVCNSVLSHFHGV FSSPPNILQNELFGQTLNNA in isoform 1 and isoform 3. | VSP_040866 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 575 – 642 | 68 | SQKGK…SHSDK → MDYNWLDHTSWHSSEASPMS L in isoform 3 and isoform 8. | VSP_040867 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 774 – 801 | 28 | SSSFE…MLRDV → KFYLCWKKTLFIIAFIRDQM KYLTSNVK in isoform 4. | VSP_040868 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 802 – 1411 | 610 | Missing in isoform 4. | VSP_040871 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 810 | 1 | S → SSQSLSRRTTPFVPRVQ in isoform 8. | VSP_044662 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 811 – 824 | 14 | IKLWF…HQLIV → VCSHYVYSSFWNIK in isoform 5. | VSP_040869 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 825 – 1411 | 587 | Missing in isoform 5. | VSP_040870 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1038 | 1 | S → R in isoform 2. | VSP_040872 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1039 – 1411 | 373 | Missing in isoform 2. | VSP_040873 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1076 | 1 | D → DSHFLTLPRSRYSQTIDHHH RDG in isoform 3. | VSP_040874 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1127 – 1174 | 48 | RSAPP…TLDRK → MGRQGLGGASAAGRSMQRSQ SRSSLSASFEALAGYFPCMN SLEEEEGE in isoform 7. | VSP_040875 | |||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | S → F in AAH43144. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 518 | 1 | Q → R in AAH43144. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 947 | 1 | M → V in BAG54403. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 646 – 649 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 651 – 663 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 677 – 680 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 681 – 688 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 690 – 692 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 694 – 701 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 710 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 718 – 722 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 732 – 741 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 743 – 754 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 808 – 816 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 817 – 820 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 821 – 831 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 836 – 838 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 843 – 846 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 854 – 857 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 885 – 887 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 890 – 898 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 900 – 903 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 910 – 915 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 916 – 918 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 925 – 929 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | Yu W., Sarginson J., Gibbs R.A. Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8). Tissue: Brain. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Hypothalamus. |
| [6] | Ho H.C. Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 689-1411 (ISOFORMS 4 AND 5). |
| [7] | "Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins." Wang Y., Suedhof T.C. Genomics 81:126-137(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, GENOMIC ORGANIZATION. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-689; SER-691 AND THR-699, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400 AND SER-1396, MASS SPECTROMETRY. |
| [10] | "PDZ domain and the first C2 domain of human RIM2B." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 637-934. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB018294 mRNA. Translation: BAA34471.2. Different initiation. AF007156 mRNA. Translation: AAC19157.1. AK126939 mRNA. Translation: BAG54403.1. AC007751 Genomic DNA. No translation available. AC012213 Genomic DNA. No translation available. AC090448 Genomic DNA. No translation available. AC090686 Genomic DNA. No translation available. AC107933 Genomic DNA. No translation available. AP001572 Genomic DNA. No translation available. AP002849 Genomic DNA. No translation available. BC043144 mRNA. Translation: AAH43144.1. AY057119 mRNA. Translation: AAL23679.1. AY057121 mRNA. Translation: AAL23681.1. | ||||||||||||||||||
| IPI | IPI00005698. IPI00249249. IPI00339350. IPI00396227. IPI00398789. IPI00873023. IPI00942680. IPI00966071. | ||||||||||||||||||
| RefSeq | NP_001093587.1. NM_001100117.2. NP_055492.3. NM_014677.4. | ||||||||||||||||||
| UniGene | Hs.655271. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9UQ26. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9UQ26. 5 interactions. | ||||||||||||||||||
| MINT | MINT-3083593. | ||||||||||||||||||
| STRING | 9606.ENSP00000386228. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9UQ26. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 41019522. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9UQ26. | ||||||||||||||||||
| PRIDE | Q9UQ26. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000262231; ENSP00000262231; ENSG00000176406. ENST00000339750; ENSP00000342051; ENSG00000176406. ENST00000406091; ENSP00000384892; ENSG00000176406. ENST00000507740; ENSP00000423559; ENSG00000176406. | ||||||||||||||||||
| GeneID | 9699. | ||||||||||||||||||
| KEGG | hsa:9699. | ||||||||||||||||||
| UCSC | uc003ylq.3. human. uc003ylr.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9699. | ||||||||||||||||||
| GeneCards | GC08P104582. | ||||||||||||||||||
| H-InvDB | HIX0020449. | ||||||||||||||||||
| HGNC | HGNC:17283. RIMS2. | ||||||||||||||||||
| HPA | HPA046538. HPA053672. | ||||||||||||||||||
| MIM | 606630. gene. | ||||||||||||||||||
| neXtProt | NX_Q9UQ26. | ||||||||||||||||||
| PharmGKB | PA38445. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG286957. | ||||||||||||||||||
| HOGENOM | HOG000082403. | ||||||||||||||||||
| HOVERGEN | HBG058147. | ||||||||||||||||||
| InParanoid | Q9UQ26. | ||||||||||||||||||
| KO | K15297. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9UQ26. | ||||||||||||||||||
| Bgee | Q9UQ26. | ||||||||||||||||||
| CleanEx | HS_RIMS2. | ||||||||||||||||||
| Genevestigator | Q9UQ26. | ||||||||||||||||||
| GermOnline | ENSG00000176406. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 3.30.40.10. 2 hits. | ||||||||||||||||||
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR001478. PDZ. IPR010911. Rab-bd_domain. IPR017455. Znf_FYVE-rel. IPR011011. Znf_FYVE_PHD. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] | ||||||||||||||||||
| Pfam | PF00168. C2. 2 hits. PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00239. C2. 2 hits. SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 2 hits. SSF57903. FYVE_PHD_ZnF. 1 hit. SSF50156. PDZ. 1 hit. | ||||||||||||||||||
| PROSITE | PS50004. C2. 2 hits. PS50106. PDZ. 1 hit. PS50916. RABBD. 1 hit. PS50178. ZF_FYVE. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q9UQ26. | ||||||||||||||||||
| GenomeRNAi | 9699. | ||||||||||||||||||
| NextBio | 36445. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RIMS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UQ26 Secondary accession number(s): B3KX91 Q8IWW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
