Q9UPW5 (CBPC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic carboxypeptidase 1 EC=3.4.17.- Alternative name(s): ATP/GTP-binding protein 1 Nervous system nuclear protein induced by axotomy protein 1 homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1226 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5 By similarity. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Interacts with MYLK By similarity. |
| Subcellular location | Cytoplasm › cytosol By similarity. Nucleus By similarity. Mitochondrion By similarity. |
| Sequence similarities | Belongs to the peptidase M14 family. |
| Sequence caution | The sequence BAA82987.2 differs from that shown. Reason: Frameshift at position 10. The sequence BAB14100.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAG61460.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAH56222.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence EAW62697.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UPW5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UPW5-2) The sequence of this isoform differs from the canonical sequence as follows: 304-343: Missing. | ||||||
| Isoform 3 (identifier: Q9UPW5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSKLKVIPEKS → MRTGSAASSAAAAAAAAAASASPATGVCMKTPGGGRRGIRRDPGAEPGAAALRGPRQRPILSR 304-343: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1226 | 1226 | Cytosolic carboxypeptidase 1 | PRO_0000308690 | |||||
Sites | |||||||||
| Active site | 970 | 1 | Nucleophile By similarity | ||||||
| Metal binding | 920 | 1 | Zinc By similarity | ||||||
| Metal binding | 923 | 1 | Zinc By similarity | ||||||
| Metal binding | 1017 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 11 | 11 | MSKLKVIPEKS → MRTGSAASSAAAAAAAAAAS ASPATGVCMKTPGGGRRGIR RDPGAEPGAAALRGPRQRPI LSR in isoform 3. | VSP_040422 | |||||
| Alternative sequence | 304 – 343 | 40 | Missing in isoform 2 and isoform 3. | VSP_029044 | |||||
| Natural variant | 423 | 1 | E → K in a colorectal cancer sample; somatic mutation. Ref.11 | VAR_036884 | |||||
Experimental info | |||||||||
| Sequence conflict | 274 | 1 | Q → R in BAA91749. Ref.3 | ||||||
| Sequence conflict | 398 – 399 | 2 | DI → KK in CAH56222. Ref.7 | ||||||
| Sequence conflict | 464 | 1 | E → G in BAA91749. Ref.3 | ||||||
| Sequence conflict | 495 | 1 | M → V in BAB14505. Ref.3 | ||||||
| Sequence conflict | 574 | 1 | M → V in BAB14100. Ref.3 | ||||||
| Sequence conflict | 598 | 1 | E → G in BAA91749. Ref.3 | ||||||
| Sequence conflict | 712 | 1 | F → I in CAH56222. Ref.7 | ||||||
| Sequence conflict | 756 | 1 | M → T in BAB14100. Ref.3 | ||||||
| Sequence conflict | 812 | 1 | S → P in BAB14505. Ref.3 | ||||||
| Sequence conflict | 830 | 1 | T → A in CAH56158. Ref.7 | ||||||
| Sequence conflict | 909 | 1 | N → D in BAB14505. Ref.3 | ||||||
| Sequence conflict | 975 | 1 | G → R in BAG58598. Ref.3 | ||||||
| Sequence conflict | 1054 | 1 | Y → F in BAB14505. Ref.3 | ||||||
| Sequence conflict | 1153 | 1 | L → P in CAH56158. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB028958 mRNA. Translation: BAA82987.2. Frameshift. AK001544 mRNA. Translation: BAA91749.1. AK022562 mRNA. Translation: BAB14100.1. Different initiation. AK023280 mRNA. Translation: BAB14505.1. Different initiation. AK295774 mRNA. Translation: BAG58598.1. AK299506 mRNA. Translation: BAG61460.1. Different initiation. AL157882, AL451131 Genomic DNA. Translation: CAH71213.1. AL157882, AL451131 Genomic DNA. Translation: CAH71214.1. AL451131, AL157882 Genomic DNA. Translation: CAH72317.1. AL451131, AL157882 Genomic DNA. Translation: CAH72318.1. CH471089 Genomic DNA. Translation: EAW62694.1. CH471089 Genomic DNA. Translation: EAW62698.1. CH471089 Genomic DNA. Translation: EAW62697.1. Sequence problems. BC060815 mRNA. Translation: AAH60815.1. BX648366 mRNA. Translation: CAH56158.1. AL833359 mRNA. Translation: CAH56222.1. Different initiation. |
| IPI | IPI00167865. IPI00418530. IPI00942428. |
| RefSeq | NP_056054.2. NM_015239.2. |
| UniGene | Hs.719980. |
3D structure databases | |
| ProteinModelPortal | Q9UPW5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UPW5. 9 interactions. |
| MINT | MINT-2858492. |
| STRING | 9606.ENSP00000338512. |
Protein family/group databases | |
| MEROPS | M14.028. |
PTM databases | |
| PhosphoSite | Q9UPW5. |
Polymorphism databases | |
| DMDM | 160019039. |
Proteomic databases | |
| PaxDb | Q9UPW5. |
| PRIDE | Q9UPW5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357081; ENSP00000349592; ENSG00000135049. ENST00000376083; ENSP00000365251; ENSG00000135049. ENST00000376109; ENSP00000365277; ENSG00000135049. |
| GeneID | 23287. |
| KEGG | hsa:23287. |
| UCSC | uc004aod.4. human. uc010mqc.3. human. uc011lte.2. human. |
Organism-specific databases | |
| CTD | 23287. |
| GeneCards | GC09M088161. |
| HGNC | HGNC:17258. AGTPBP1. |
| MIM | 606830. gene. |
| neXtProt | NX_Q9UPW5. |
| PharmGKB | PA24630. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2866. |
| HOVERGEN | HBG107587. |
| InParanoid | Q9UPW5. |
| OMA | VSGMRPG. |
| OrthoDB | EOG4TMR17. |
Gene expression databases | |
| ArrayExpress | Q9UPW5. |
| Bgee | Q9UPW5. |
| CleanEx | HS_AGTPBP1. |
| Genevestigator | Q9UPW5. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 1 hit. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000834. Peptidase_M14. [Graphical view] |
| Pfam | PF00246. Peptidase_M14. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23287. |
| NextBio | 45098. |
| SOURCE | Search... |
Entry information
| Entry name | CBPC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UPW5 Secondary accession number(s): B4DIT6 Q9NVK1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
