Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UPW5 (CBPC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytosolic carboxypeptidase 1

EC=3.4.17.-
Alternative name(s):
ATP/GTP-binding protein 1
Nervous system nuclear protein induced by axotomy protein 1 homolog
Gene names
Name:AGTPBP1
Synonyms:CCP1, KIAA1035, NNA1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1226 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5 By similarity.

Cofactor

Binds 1 zinc ion per subunit By similarity.

Subunit structure

Interacts with MYLK By similarity.

Subcellular location

Cytoplasmcytosol By similarity. Nucleus By similarity. Mitochondrion By similarity.

Sequence similarities

Belongs to the peptidase M14 family.

Sequence caution

The sequence BAA82987.2 differs from that shown. Reason: Frameshift at position 10.

The sequence BAB14100.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB14505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAG61460.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAH56222.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence EAW62697.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Cellular componentCytoplasm
Mitochondrion
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandMetal-binding
Zinc
   Molecular functionCarboxypeptidase
Hydrolase
Metalloprotease
Protease
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processC-terminal protein deglutamylation

Inferred from sequence or structural similarity. Source: UniProtKB

adult walking behavior

Inferred from electronic annotation. Source: Ensembl

cerebellar Purkinje cell differentiation

Inferred from sequence or structural similarity. Source: UniProtKB

eye photoreceptor cell differentiation

Inferred from sequence or structural similarity. Source: UniProtKB

mitochondrion organization

Inferred from sequence or structural similarity. Source: UniProtKB

neuromuscular process

Inferred from sequence or structural similarity. Source: UniProtKB

neurotransmitter metabolic process

Inferred from electronic annotation. Source: Ensembl

olfactory bulb development

Inferred from sequence or structural similarity. Source: UniProtKB

protein side chain deglutamylation

Inferred from sequence or structural similarity. Source: UniProtKB

proteolysis

Inferred from electronic annotation. Source: UniProtKB-KW

retina development in camera-type eye

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytosol

Inferred from sequence or structural similarity. Source: UniProtKB

mitochondrion

Inferred from sequence or structural similarity. Source: UniProtKB

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionmetallocarboxypeptidase activity

Inferred from sequence or structural similarity. Source: UniProtKB

tubulin binding

Inferred from sequence or structural similarity. Source: UniProtKB

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9UPW5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UPW5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     304-343: Missing.
Isoform 3 (identifier: Q9UPW5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSKLKVIPEKS → MRTGSAASSAAAAAAAAAASASPATGVCMKTPGGGRRGIRRDPGAEPGAAALRGPRQRPILSR
     304-343: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12261226Cytosolic carboxypeptidase 1
PRO_0000308690

Sites

Active site9701Nucleophile By similarity
Metal binding9201Zinc By similarity
Metal binding9231Zinc By similarity
Metal binding10171Zinc By similarity

Natural variations

Alternative sequence1 – 1111MSKLKVIPEKS → MRTGSAASSAAAAAAAAAAS ASPATGVCMKTPGGGRRGIR RDPGAEPGAAALRGPRQRPI LSR in isoform 3.
VSP_040422
Alternative sequence304 – 34340Missing in isoform 2 and isoform 3.
VSP_029044
Natural variant4231E → K in a colorectal cancer sample; somatic mutation. Ref.12
VAR_036884

Experimental info

Sequence conflict2741Q → R in BAA91749. Ref.3
Sequence conflict398 – 3992DI → KK in CAH56222. Ref.7
Sequence conflict4641E → G in BAA91749. Ref.3
Sequence conflict4951M → V in BAB14505. Ref.3
Sequence conflict5741M → V in BAB14100. Ref.3
Sequence conflict5981E → G in BAA91749. Ref.3
Sequence conflict7121F → I in CAH56222. Ref.7
Sequence conflict7561M → T in BAB14100. Ref.3
Sequence conflict8121S → P in BAB14505. Ref.3
Sequence conflict8301T → A in CAH56158. Ref.7
Sequence conflict9091N → D in BAB14505. Ref.3
Sequence conflict9751G → R in BAG58598. Ref.3
Sequence conflict10541Y → F in BAB14505. Ref.3
Sequence conflict11531L → P in CAH56158. Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 23, 2007. Version 3.
Checksum: A6D598D11D2BD1F8

FASTA1,226138,448
        10         20         30         40         50         60 
MSKLKVIPEK SLTNNSRIVG LLAQLEKINA EPSESDTARY VTSKILHLAQ SQEKTRREMT 

        70         80         90        100        110        120 
AKGSTGMEIL LSTLENTKDL QTTLNILSIL VELVSAGGGR RVSFLVTKGG SQILLQLLMN 

       130        140        150        160        170        180 
ASKESPPHED LMVQIHSILA KIGPKDKKFG VKARINGALN ITLNLVKQNL QNHRLVLPCL 

       190        200        210        220        230        240 
QLLRVYSANS VNSVSLGKNG VVELMFKIIG PFSKKNSSLI KVALDTLAAL LKSKTNARRA 

       250        260        270        280        290        300 
VDRGYVQVLL TIYVDWHRHD NRHRNMLIRK GILQSLKSVT NIKLGRKAFI DANGMKILYN 

       310        320        330        340        350        360 
TSQECLAVRT LDPLVNTSSL IMRKCFPKNR LPLPTIKSSF HFQLPVIPVT GPVAQLYSLP 

       370        380        390        400        410        420 
PEVDDVVDES DDNDDIDVEA ENETENEDDL DQNFKNDDIE TDINKLKPQQ EPGRTIEDLK 

       430        440        450        460        470        480 
MYEHLFPELV DDFQDYDLIS KEPKPFVFEG KVRGPIVVPT AGEETSGNSG NLRKVVMKEN 

       490        500        510        520        530        540 
ISSKGDEGEK KSTFMDLAKE DIKDNDRTLQ QQPGDQNRTI SSVHGLNNDI VKALDRITLQ 

       550        560        570        580        590        600 
NIPSQTAPGF TAEMKKDCSL PLTVLTCAKA CPHMATCGNV LFEGRTVQLG KLCCTGVETE 

       610        620        630        640        650        660 
DDEDTESNSS VEQASVEVPD GPTLHDPDLY IEIVKNTKSV PEYSEVAYPD YFGHIPPPFK 

       670        680        690        700        710        720 
EPILERPYGV QRTKIAQDIE RLIHQSDIID RVVYDLDNPN YTIPEEGDIL KFNSKFESGN 

       730        740        750        760        770        780 
LRKVIQIRKN EYDLILNSDI NSNHYHQWFY FEVSGMRPGV AYRFNIINCE KSNSQFNYGM 

       790        800        810        820        830        840 
QPLMYSVQEA LNARPWWIRM GTDICYYKNH FSRSSVAAGG QKGKSYYTIT FTVNFPHKDD 

       850        860        870        880        890        900 
VCYFAYHYPY TYSTLQMHLQ KLESAHNPQQ IYFRKDVLCE TLSGNSCPLV TITAMPESNY 

       910        920        930        940        950        960 
YEHICHFRNR PYVFLSARVH PGETNASWVM KGTLEYLMSN NPTAQSLRES YIFKIVPMLN 

       970        980        990       1000       1010       1020 
PDGVINGNHR CSLSGEDLNR QWQSPSPDLH PTIYHAKGLL QYLAAVKRLP LVYCDYHGHS 

      1030       1040       1050       1060       1070       1080 
RKKNVFMYGC SIKETVWHTN DNATSCDVVE DTGYRTLPKI LSHIAPAFCM SSCSFVVEKS 

      1090       1100       1110       1120       1130       1140 
KESTARVVVW REIGVQRSYT MESTLCGCDQ GKYKGLQIGT RELEEMGAKF CVGLLRLKRL 

      1150       1160       1170       1180       1190       1200 
TSPLEYNLPS SLLDFENDLI ESSCKVTSPT TYVLDEDEPR FLEEVDYSAE SNDELDIELA 

      1210       1220 
ENVGDYEPSA QEEVLSDSEL SRTYLP 

« Hide

Isoform 2 [UniParc].

Checksum: D5361B66224C04BE
Show »

FASTA1,186133,864
Isoform 3 [UniParc].

Checksum: 8119980498634DDF
Show »

FASTA1,238138,647

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Hippocampus.
[4]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-1226.
Tissue: Esophageal carcinoma and Lymph node.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-423.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB028958 mRNA. Translation: BAA82987.2. Frameshift.
AK001544 mRNA. Translation: BAA91749.1.
AK022562 mRNA. Translation: BAB14100.1. Different initiation.
AK023280 mRNA. Translation: BAB14505.1. Different initiation.
AK295774 mRNA. Translation: BAG58598.1.
AK299506 mRNA. Translation: BAG61460.1. Different initiation.
AL157882, AL451131 Genomic DNA. Translation: CAH71213.1.
AL157882, AL451131 Genomic DNA. Translation: CAH71214.1.
AL451131, AL157882 Genomic DNA. Translation: CAH72317.1.
AL451131, AL157882 Genomic DNA. Translation: CAH72318.1.
CH471089 Genomic DNA. Translation: EAW62694.1.
CH471089 Genomic DNA. Translation: EAW62698.1.
CH471089 Genomic DNA. Translation: EAW62697.1. Sequence problems.
BC060815 mRNA. Translation: AAH60815.1.
BX648366 mRNA. Translation: CAH56158.1.
AL833359 mRNA. Translation: CAH56222.1. Different initiation.
RefSeqNP_001273644.1. NM_001286715.1.
NP_001273646.1. NM_001286717.1.
NP_056054.2. NM_015239.2.
XP_005251904.1. XM_005251847.2.
XP_005251905.1. XM_005251848.2.
UniGeneHs.719980.

3D structure databases

ProteinModelPortalQ9UPW5.
SMRQ9UPW5. Positions 710-1032.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116885. 10 interactions.
IntActQ9UPW5. 9 interactions.
MINTMINT-2858492.
STRING9606.ENSP00000338512.

Protein family/group databases

MEROPSM14.028.

PTM databases

PhosphoSiteQ9UPW5.

Polymorphism databases

DMDM160019039.

Proteomic databases

PaxDbQ9UPW5.
PRIDEQ9UPW5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000357081; ENSP00000349592; ENSG00000135049. [Q9UPW5-1]
ENST00000376083; ENSP00000365251; ENSG00000135049. [Q9UPW5-2]
ENST00000376109; ENSP00000365277; ENSG00000135049. [Q9UPW5-3]
GeneID23287.
KEGGhsa:23287.
UCSCuc004aod.4. human. [Q9UPW5-1]
uc010mqc.3. human. [Q9UPW5-2]
uc011lte.2. human. [Q9UPW5-3]

Organism-specific databases

CTD23287.
GeneCardsGC09M088161.
HGNCHGNC:17258. AGTPBP1.
HPAHPA057208.
MIM606830. gene.
neXtProtNX_Q9UPW5.
PharmGKBPA24630.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2866.
HOVERGENHBG107587.
InParanoidQ9UPW5.
OMADVLCETL.
OrthoDBEOG712TVD.
PhylomeDBQ9UPW5.
TreeFamTF313794.

Gene expression databases

ArrayExpressQ9UPW5.
BgeeQ9UPW5.
CleanExHS_AGTPBP1.
GenevestigatorQ9UPW5.

Family and domain databases

Gene3D1.25.10.10. 1 hit.
InterProIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000834. Peptidase_M14.
[Graphical view]
PfamPF00246. Peptidase_M14. 1 hit.
[Graphical view]
SUPFAMSSF48371. SSF48371. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi23287.
NextBio45098.
PROQ9UPW5.
SOURCESearch...

Entry information

Entry nameCBPC1_HUMAN
AccessionPrimary (citable) accession number: Q9UPW5
Secondary accession number(s): B4DIT6 expand/collapse secondary AC list , B4DRZ8, Q5VV80, Q63HM7, Q658P5, Q6P9D6, Q9H8U6, Q9H9W8, Q9NVK1
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: April 16, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM