SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UPW5

- CBPC1_HUMAN

UniProt

Q9UPW5 - CBPC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytosolic carboxypeptidase 1

Gene
AGTPBP1, CCP1, KIAA1035, NNA1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5 By similarity.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi920 – 9201Zinc By similarity
Metal bindingi923 – 9231Zinc By similarity
Active sitei970 – 9701Nucleophile By similarity
Metal bindingi1017 – 10171Zinc By similarity

GO - Molecular functioni

  1. metallocarboxypeptidase activity Source: UniProtKB
  2. tubulin binding Source: UniProtKB
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. adult walking behavior Source: Ensembl
  2. cerebellar Purkinje cell differentiation Source: UniProtKB
  3. C-terminal protein deglutamylation Source: UniProtKB
  4. eye photoreceptor cell differentiation Source: UniProtKB
  5. mitochondrion organization Source: UniProtKB
  6. neuromuscular process Source: UniProtKB
  7. neurotransmitter metabolic process Source: Ensembl
  8. olfactory bulb development Source: UniProtKB
  9. protein side chain deglutamylation Source: UniProtKB
  10. retina development in camera-type eye Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM14.028.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase 1 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein 1
Nervous system nuclear protein induced by axotomy protein 1 homolog
Gene namesi
Name:AGTPBP1
Synonyms:CCP1, KIAA1035, NNA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:17258. AGTPBP1.

Subcellular locationi

Cytoplasmcytosol By similarity. Nucleus By similarity. Mitochondrion By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. mitochondrion Source: UniProtKB
  3. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24630.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12261226Cytosolic carboxypeptidase 1PRO_0000308690Add
BLAST

Proteomic databases

MaxQBiQ9UPW5.
PaxDbiQ9UPW5.
PRIDEiQ9UPW5.

PTM databases

PhosphoSiteiQ9UPW5.

Expressioni

Gene expression databases

ArrayExpressiQ9UPW5.
BgeeiQ9UPW5.
CleanExiHS_AGTPBP1.
GenevestigatoriQ9UPW5.

Organism-specific databases

HPAiHPA057208.

Interactioni

Subunit structurei

Interacts with MYLK By similarity.

Protein-protein interaction databases

BioGridi116885. 10 interactions.
IntActiQ9UPW5. 9 interactions.
MINTiMINT-2858492.
STRINGi9606.ENSP00000338512.

Structurei

3D structure databases

ProteinModelPortaliQ9UPW5.
SMRiQ9UPW5. Positions 710-1032.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.

Phylogenomic databases

eggNOGiCOG2866.
HOVERGENiHBG107587.
InParanoidiQ9UPW5.
OMAiDVLCETL.
OrthoDBiEOG712TVD.
PhylomeDBiQ9UPW5.
TreeFamiTF313794.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UPW5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSKLKVIPEK SLTNNSRIVG LLAQLEKINA EPSESDTARY VTSKILHLAQ     50
SQEKTRREMT AKGSTGMEIL LSTLENTKDL QTTLNILSIL VELVSAGGGR 100
RVSFLVTKGG SQILLQLLMN ASKESPPHED LMVQIHSILA KIGPKDKKFG 150
VKARINGALN ITLNLVKQNL QNHRLVLPCL QLLRVYSANS VNSVSLGKNG 200
VVELMFKIIG PFSKKNSSLI KVALDTLAAL LKSKTNARRA VDRGYVQVLL 250
TIYVDWHRHD NRHRNMLIRK GILQSLKSVT NIKLGRKAFI DANGMKILYN 300
TSQECLAVRT LDPLVNTSSL IMRKCFPKNR LPLPTIKSSF HFQLPVIPVT 350
GPVAQLYSLP PEVDDVVDES DDNDDIDVEA ENETENEDDL DQNFKNDDIE 400
TDINKLKPQQ EPGRTIEDLK MYEHLFPELV DDFQDYDLIS KEPKPFVFEG 450
KVRGPIVVPT AGEETSGNSG NLRKVVMKEN ISSKGDEGEK KSTFMDLAKE 500
DIKDNDRTLQ QQPGDQNRTI SSVHGLNNDI VKALDRITLQ NIPSQTAPGF 550
TAEMKKDCSL PLTVLTCAKA CPHMATCGNV LFEGRTVQLG KLCCTGVETE 600
DDEDTESNSS VEQASVEVPD GPTLHDPDLY IEIVKNTKSV PEYSEVAYPD 650
YFGHIPPPFK EPILERPYGV QRTKIAQDIE RLIHQSDIID RVVYDLDNPN 700
YTIPEEGDIL KFNSKFESGN LRKVIQIRKN EYDLILNSDI NSNHYHQWFY 750
FEVSGMRPGV AYRFNIINCE KSNSQFNYGM QPLMYSVQEA LNARPWWIRM 800
GTDICYYKNH FSRSSVAAGG QKGKSYYTIT FTVNFPHKDD VCYFAYHYPY 850
TYSTLQMHLQ KLESAHNPQQ IYFRKDVLCE TLSGNSCPLV TITAMPESNY 900
YEHICHFRNR PYVFLSARVH PGETNASWVM KGTLEYLMSN NPTAQSLRES 950
YIFKIVPMLN PDGVINGNHR CSLSGEDLNR QWQSPSPDLH PTIYHAKGLL 1000
QYLAAVKRLP LVYCDYHGHS RKKNVFMYGC SIKETVWHTN DNATSCDVVE 1050
DTGYRTLPKI LSHIAPAFCM SSCSFVVEKS KESTARVVVW REIGVQRSYT 1100
MESTLCGCDQ GKYKGLQIGT RELEEMGAKF CVGLLRLKRL TSPLEYNLPS 1150
SLLDFENDLI ESSCKVTSPT TYVLDEDEPR FLEEVDYSAE SNDELDIELA 1200
ENVGDYEPSA QEEVLSDSEL SRTYLP 1226
Length:1,226
Mass (Da):138,448
Last modified:October 23, 2007 - v3
Checksum:iA6D598D11D2BD1F8
GO
Isoform 2 (identifier: Q9UPW5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-343: Missing.

Show »
Length:1,186
Mass (Da):133,864
Checksum:iD5361B66224C04BE
GO
Isoform 3 (identifier: Q9UPW5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSKLKVIPEKS → MRTGSAASSAAAAAAAAAASASPATGVCMKTPGGGRRGIRRDPGAEPGAAALRGPRQRPILSR
     304-343: Missing.

Note: No experimental confirmation available.

Show »
Length:1,238
Mass (Da):138,647
Checksum:i8119980498634DDF
GO

Sequence cautioni

The sequence BAA82987.2 differs from that shown. Reason: Frameshift at position 10.
The sequence BAB14100.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB14505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAG61460.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAH56222.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence EAW62697.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti423 – 4231E → K in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036884

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1111MSKLKVIPEKS → MRTGSAASSAAAAAAAAAAS ASPATGVCMKTPGGGRRGIR RDPGAEPGAAALRGPRQRPI LSR in isoform 3. VSP_040422Add
BLAST
Alternative sequencei304 – 34340Missing in isoform 2 and isoform 3. VSP_029044Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti274 – 2741Q → R in BAA91749. 1 Publication
Sequence conflicti398 – 3992DI → KK in CAH56222. 1 Publication
Sequence conflicti464 – 4641E → G in BAA91749. 1 Publication
Sequence conflicti495 – 4951M → V in BAB14505. 1 Publication
Sequence conflicti574 – 5741M → V in BAB14100. 1 Publication
Sequence conflicti598 – 5981E → G in BAA91749. 1 Publication
Sequence conflicti712 – 7121F → I in CAH56222. 1 Publication
Sequence conflicti756 – 7561M → T in BAB14100. 1 Publication
Sequence conflicti812 – 8121S → P in BAB14505. 1 Publication
Sequence conflicti830 – 8301T → A in CAH56158. 1 Publication
Sequence conflicti909 – 9091N → D in BAB14505. 1 Publication
Sequence conflicti975 – 9751G → R in BAG58598. 1 Publication
Sequence conflicti1054 – 10541Y → F in BAB14505. 1 Publication
Sequence conflicti1153 – 11531L → P in CAH56158. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB028958 mRNA. Translation: BAA82987.2. Frameshift.
AK001544 mRNA. Translation: BAA91749.1.
AK022562 mRNA. Translation: BAB14100.1. Different initiation.
AK023280 mRNA. Translation: BAB14505.1. Different initiation.
AK295774 mRNA. Translation: BAG58598.1.
AK299506 mRNA. Translation: BAG61460.1. Different initiation.
AL157882, AL451131 Genomic DNA. Translation: CAH71213.1.
AL157882, AL451131 Genomic DNA. Translation: CAH71214.1.
AL451131, AL157882 Genomic DNA. Translation: CAH72317.1.
AL451131, AL157882 Genomic DNA. Translation: CAH72318.1.
CH471089 Genomic DNA. Translation: EAW62694.1.
CH471089 Genomic DNA. Translation: EAW62698.1.
CH471089 Genomic DNA. Translation: EAW62697.1. Sequence problems.
BC060815 mRNA. Translation: AAH60815.1.
BX648366 mRNA. Translation: CAH56158.1.
AL833359 mRNA. Translation: CAH56222.1. Different initiation.
CCDSiCCDS6672.1. [Q9UPW5-2]
CCDS69615.1. [Q9UPW5-3]
RefSeqiNP_001273644.1. NM_001286715.1.
NP_001273646.1. NM_001286717.1. [Q9UPW5-3]
NP_056054.2. NM_015239.2. [Q9UPW5-2]
XP_005251904.1. XM_005251847.2. [Q9UPW5-1]
XP_005251905.1. XM_005251848.2. [Q9UPW5-1]
UniGeneiHs.719980.

Genome annotation databases

EnsembliENST00000357081; ENSP00000349592; ENSG00000135049. [Q9UPW5-1]
ENST00000376083; ENSP00000365251; ENSG00000135049. [Q9UPW5-2]
ENST00000376109; ENSP00000365277; ENSG00000135049. [Q9UPW5-3]
GeneIDi23287.
KEGGihsa:23287.
UCSCiuc004aod.4. human. [Q9UPW5-1]
uc010mqc.3. human. [Q9UPW5-2]
uc011lte.2. human. [Q9UPW5-3]

Polymorphism databases

DMDMi160019039.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB028958 mRNA. Translation: BAA82987.2 . Frameshift.
AK001544 mRNA. Translation: BAA91749.1 .
AK022562 mRNA. Translation: BAB14100.1 . Different initiation.
AK023280 mRNA. Translation: BAB14505.1 . Different initiation.
AK295774 mRNA. Translation: BAG58598.1 .
AK299506 mRNA. Translation: BAG61460.1 . Different initiation.
AL157882 , AL451131 Genomic DNA. Translation: CAH71213.1 .
AL157882 , AL451131 Genomic DNA. Translation: CAH71214.1 .
AL451131 , AL157882 Genomic DNA. Translation: CAH72317.1 .
AL451131 , AL157882 Genomic DNA. Translation: CAH72318.1 .
CH471089 Genomic DNA. Translation: EAW62694.1 .
CH471089 Genomic DNA. Translation: EAW62698.1 .
CH471089 Genomic DNA. Translation: EAW62697.1 . Sequence problems.
BC060815 mRNA. Translation: AAH60815.1 .
BX648366 mRNA. Translation: CAH56158.1 .
AL833359 mRNA. Translation: CAH56222.1 . Different initiation.
CCDSi CCDS6672.1. [Q9UPW5-2 ]
CCDS69615.1. [Q9UPW5-3 ]
RefSeqi NP_001273644.1. NM_001286715.1.
NP_001273646.1. NM_001286717.1. [Q9UPW5-3 ]
NP_056054.2. NM_015239.2. [Q9UPW5-2 ]
XP_005251904.1. XM_005251847.2. [Q9UPW5-1 ]
XP_005251905.1. XM_005251848.2. [Q9UPW5-1 ]
UniGenei Hs.719980.

3D structure databases

ProteinModelPortali Q9UPW5.
SMRi Q9UPW5. Positions 710-1032.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116885. 10 interactions.
IntActi Q9UPW5. 9 interactions.
MINTi MINT-2858492.
STRINGi 9606.ENSP00000338512.

Protein family/group databases

MEROPSi M14.028.

PTM databases

PhosphoSitei Q9UPW5.

Polymorphism databases

DMDMi 160019039.

Proteomic databases

MaxQBi Q9UPW5.
PaxDbi Q9UPW5.
PRIDEi Q9UPW5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000357081 ; ENSP00000349592 ; ENSG00000135049 . [Q9UPW5-1 ]
ENST00000376083 ; ENSP00000365251 ; ENSG00000135049 . [Q9UPW5-2 ]
ENST00000376109 ; ENSP00000365277 ; ENSG00000135049 . [Q9UPW5-3 ]
GeneIDi 23287.
KEGGi hsa:23287.
UCSCi uc004aod.4. human. [Q9UPW5-1 ]
uc010mqc.3. human. [Q9UPW5-2 ]
uc011lte.2. human. [Q9UPW5-3 ]

Organism-specific databases

CTDi 23287.
GeneCardsi GC09M088161.
HGNCi HGNC:17258. AGTPBP1.
HPAi HPA057208.
MIMi 606830. gene.
neXtProti NX_Q9UPW5.
PharmGKBi PA24630.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2866.
HOVERGENi HBG107587.
InParanoidi Q9UPW5.
OMAi DVLCETL.
OrthoDBi EOG712TVD.
PhylomeDBi Q9UPW5.
TreeFami TF313794.

Miscellaneous databases

GenomeRNAii 23287.
NextBioi 45098.
PROi Q9UPW5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UPW5.
Bgeei Q9UPW5.
CleanExi HS_AGTPBP1.
Genevestigatori Q9UPW5.

Family and domain databases

Gene3Di 1.25.10.10. 1 hit.
InterProi IPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000834. Peptidase_M14.
[Graphical view ]
Pfami PF00246. Peptidase_M14. 1 hit.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Hippocampus.
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-1226.
    Tissue: Esophageal carcinoma and Lymph node.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-423.

Entry informationi

Entry nameiCBPC1_HUMAN
AccessioniPrimary (citable) accession number: Q9UPW5
Secondary accession number(s): B4DIT6
, B4DRZ8, Q5VV80, Q63HM7, Q658P5, Q6P9D6, Q9H8U6, Q9H9W8, Q9NVK1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 99 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi