Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UPW5

- CBPC1_HUMAN

UniProt

Q9UPW5 - CBPC1_HUMAN

Protein

Cytosolic carboxypeptidase 1

Gene

AGTPBP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 3 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5 By similarity.By similarity

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi920 – 9201ZincBy similarity
    Metal bindingi923 – 9231ZincBy similarity
    Active sitei970 – 9701NucleophileBy similarity
    Metal bindingi1017 – 10171ZincBy similarity

    GO - Molecular functioni

    1. metallocarboxypeptidase activity Source: UniProtKB
    2. tubulin binding Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. adult walking behavior Source: Ensembl
    2. cerebellar Purkinje cell differentiation Source: UniProtKB
    3. C-terminal protein deglutamylation Source: UniProtKB
    4. eye photoreceptor cell differentiation Source: UniProtKB
    5. mitochondrion organization Source: UniProtKB
    6. neuromuscular process Source: UniProtKB
    7. neurotransmitter metabolic process Source: Ensembl
    8. olfactory bulb development Source: UniProtKB
    9. protein side chain deglutamylation Source: UniProtKB
    10. retina development in camera-type eye Source: Ensembl

    Keywords - Molecular functioni

    Carboxypeptidase, Hydrolase, Metalloprotease, Protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM14.028.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytosolic carboxypeptidase 1 (EC:3.4.17.-)
    Alternative name(s):
    ATP/GTP-binding protein 1
    Nervous system nuclear protein induced by axotomy protein 1 homolog
    Gene namesi
    Name:AGTPBP1
    Synonyms:CCP1, KIAA1035, NNA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:17258. AGTPBP1.

    Subcellular locationi

    Cytoplasmcytosol By similarity. Nucleus By similarity. Mitochondrion By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. mitochondrion Source: UniProtKB
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Mitochondrion, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24630.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12261226Cytosolic carboxypeptidase 1PRO_0000308690Add
    BLAST

    Proteomic databases

    MaxQBiQ9UPW5.
    PaxDbiQ9UPW5.
    PRIDEiQ9UPW5.

    PTM databases

    PhosphoSiteiQ9UPW5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9UPW5.
    BgeeiQ9UPW5.
    CleanExiHS_AGTPBP1.
    GenevestigatoriQ9UPW5.

    Organism-specific databases

    HPAiHPA057208.

    Interactioni

    Subunit structurei

    Interacts with MYLK.By similarity

    Protein-protein interaction databases

    BioGridi116885. 10 interactions.
    IntActiQ9UPW5. 9 interactions.
    MINTiMINT-2858492.
    STRINGi9606.ENSP00000338512.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UPW5.
    SMRiQ9UPW5. Positions 710-1032.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase M14 family.Curated

    Phylogenomic databases

    eggNOGiCOG2866.
    HOVERGENiHBG107587.
    InParanoidiQ9UPW5.
    OMAiDVLCETL.
    OrthoDBiEOG712TVD.
    PhylomeDBiQ9UPW5.
    TreeFamiTF313794.

    Family and domain databases

    Gene3Di1.25.10.10. 1 hit.
    InterProiIPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR000834. Peptidase_M14.
    [Graphical view]
    PfamiPF00246. Peptidase_M14. 1 hit.
    [Graphical view]
    SUPFAMiSSF48371. SSF48371. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UPW5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSKLKVIPEK SLTNNSRIVG LLAQLEKINA EPSESDTARY VTSKILHLAQ     50
    SQEKTRREMT AKGSTGMEIL LSTLENTKDL QTTLNILSIL VELVSAGGGR 100
    RVSFLVTKGG SQILLQLLMN ASKESPPHED LMVQIHSILA KIGPKDKKFG 150
    VKARINGALN ITLNLVKQNL QNHRLVLPCL QLLRVYSANS VNSVSLGKNG 200
    VVELMFKIIG PFSKKNSSLI KVALDTLAAL LKSKTNARRA VDRGYVQVLL 250
    TIYVDWHRHD NRHRNMLIRK GILQSLKSVT NIKLGRKAFI DANGMKILYN 300
    TSQECLAVRT LDPLVNTSSL IMRKCFPKNR LPLPTIKSSF HFQLPVIPVT 350
    GPVAQLYSLP PEVDDVVDES DDNDDIDVEA ENETENEDDL DQNFKNDDIE 400
    TDINKLKPQQ EPGRTIEDLK MYEHLFPELV DDFQDYDLIS KEPKPFVFEG 450
    KVRGPIVVPT AGEETSGNSG NLRKVVMKEN ISSKGDEGEK KSTFMDLAKE 500
    DIKDNDRTLQ QQPGDQNRTI SSVHGLNNDI VKALDRITLQ NIPSQTAPGF 550
    TAEMKKDCSL PLTVLTCAKA CPHMATCGNV LFEGRTVQLG KLCCTGVETE 600
    DDEDTESNSS VEQASVEVPD GPTLHDPDLY IEIVKNTKSV PEYSEVAYPD 650
    YFGHIPPPFK EPILERPYGV QRTKIAQDIE RLIHQSDIID RVVYDLDNPN 700
    YTIPEEGDIL KFNSKFESGN LRKVIQIRKN EYDLILNSDI NSNHYHQWFY 750
    FEVSGMRPGV AYRFNIINCE KSNSQFNYGM QPLMYSVQEA LNARPWWIRM 800
    GTDICYYKNH FSRSSVAAGG QKGKSYYTIT FTVNFPHKDD VCYFAYHYPY 850
    TYSTLQMHLQ KLESAHNPQQ IYFRKDVLCE TLSGNSCPLV TITAMPESNY 900
    YEHICHFRNR PYVFLSARVH PGETNASWVM KGTLEYLMSN NPTAQSLRES 950
    YIFKIVPMLN PDGVINGNHR CSLSGEDLNR QWQSPSPDLH PTIYHAKGLL 1000
    QYLAAVKRLP LVYCDYHGHS RKKNVFMYGC SIKETVWHTN DNATSCDVVE 1050
    DTGYRTLPKI LSHIAPAFCM SSCSFVVEKS KESTARVVVW REIGVQRSYT 1100
    MESTLCGCDQ GKYKGLQIGT RELEEMGAKF CVGLLRLKRL TSPLEYNLPS 1150
    SLLDFENDLI ESSCKVTSPT TYVLDEDEPR FLEEVDYSAE SNDELDIELA 1200
    ENVGDYEPSA QEEVLSDSEL SRTYLP 1226
    Length:1,226
    Mass (Da):138,448
    Last modified:October 23, 2007 - v3
    Checksum:iA6D598D11D2BD1F8
    GO
    Isoform 2 (identifier: Q9UPW5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         304-343: Missing.

    Show »
    Length:1,186
    Mass (Da):133,864
    Checksum:iD5361B66224C04BE
    GO
    Isoform 3 (identifier: Q9UPW5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSKLKVIPEKS → MRTGSAASSAAAAAAAAAASASPATGVCMKTPGGGRRGIRRDPGAEPGAAALRGPRQRPILSR
         304-343: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,238
    Mass (Da):138,647
    Checksum:i8119980498634DDF
    GO

    Sequence cautioni

    The sequence BAA82987.2 differs from that shown. Reason: Frameshift at position 10.
    The sequence BAB14100.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB14505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAG61460.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAH56222.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence EAW62697.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti274 – 2741Q → R in BAA91749. (PubMed:14702039)Curated
    Sequence conflicti398 – 3992DI → KK in CAH56222. (PubMed:17974005)Curated
    Sequence conflicti464 – 4641E → G in BAA91749. (PubMed:14702039)Curated
    Sequence conflicti495 – 4951M → V in BAB14505. (PubMed:14702039)Curated
    Sequence conflicti574 – 5741M → V in BAB14100. (PubMed:14702039)Curated
    Sequence conflicti598 – 5981E → G in BAA91749. (PubMed:14702039)Curated
    Sequence conflicti712 – 7121F → I in CAH56222. (PubMed:17974005)Curated
    Sequence conflicti756 – 7561M → T in BAB14100. (PubMed:14702039)Curated
    Sequence conflicti812 – 8121S → P in BAB14505. (PubMed:14702039)Curated
    Sequence conflicti830 – 8301T → A in CAH56158. (PubMed:17974005)Curated
    Sequence conflicti909 – 9091N → D in BAB14505. (PubMed:14702039)Curated
    Sequence conflicti975 – 9751G → R in BAG58598. (PubMed:14702039)Curated
    Sequence conflicti1054 – 10541Y → F in BAB14505. (PubMed:14702039)Curated
    Sequence conflicti1153 – 11531L → P in CAH56158. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti423 – 4231E → K in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_036884

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1111MSKLKVIPEKS → MRTGSAASSAAAAAAAAAAS ASPATGVCMKTPGGGRRGIR RDPGAEPGAAALRGPRQRPI LSR in isoform 3. 1 PublicationVSP_040422Add
    BLAST
    Alternative sequencei304 – 34340Missing in isoform 2 and isoform 3. 2 PublicationsVSP_029044Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB028958 mRNA. Translation: BAA82987.2. Frameshift.
    AK001544 mRNA. Translation: BAA91749.1.
    AK022562 mRNA. Translation: BAB14100.1. Different initiation.
    AK023280 mRNA. Translation: BAB14505.1. Different initiation.
    AK295774 mRNA. Translation: BAG58598.1.
    AK299506 mRNA. Translation: BAG61460.1. Different initiation.
    AL157882, AL451131 Genomic DNA. Translation: CAH71213.1.
    AL157882, AL451131 Genomic DNA. Translation: CAH71214.1.
    AL451131, AL157882 Genomic DNA. Translation: CAH72317.1.
    AL451131, AL157882 Genomic DNA. Translation: CAH72318.1.
    CH471089 Genomic DNA. Translation: EAW62694.1.
    CH471089 Genomic DNA. Translation: EAW62698.1.
    CH471089 Genomic DNA. Translation: EAW62697.1. Sequence problems.
    BC060815 mRNA. Translation: AAH60815.1.
    BX648366 mRNA. Translation: CAH56158.1.
    AL833359 mRNA. Translation: CAH56222.1. Different initiation.
    CCDSiCCDS6672.1. [Q9UPW5-2]
    CCDS69615.1. [Q9UPW5-3]
    RefSeqiNP_001273644.1. NM_001286715.1.
    NP_001273646.1. NM_001286717.1. [Q9UPW5-3]
    NP_056054.2. NM_015239.2. [Q9UPW5-2]
    XP_005251904.1. XM_005251847.2. [Q9UPW5-1]
    XP_005251905.1. XM_005251848.2. [Q9UPW5-1]
    UniGeneiHs.719980.

    Genome annotation databases

    EnsembliENST00000357081; ENSP00000349592; ENSG00000135049. [Q9UPW5-1]
    ENST00000376083; ENSP00000365251; ENSG00000135049. [Q9UPW5-2]
    GeneIDi23287.
    KEGGihsa:23287.
    UCSCiuc004aod.4. human. [Q9UPW5-1]
    uc010mqc.3. human. [Q9UPW5-2]
    uc011lte.2. human. [Q9UPW5-3]

    Polymorphism databases

    DMDMi160019039.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB028958 mRNA. Translation: BAA82987.2 . Frameshift.
    AK001544 mRNA. Translation: BAA91749.1 .
    AK022562 mRNA. Translation: BAB14100.1 . Different initiation.
    AK023280 mRNA. Translation: BAB14505.1 . Different initiation.
    AK295774 mRNA. Translation: BAG58598.1 .
    AK299506 mRNA. Translation: BAG61460.1 . Different initiation.
    AL157882 , AL451131 Genomic DNA. Translation: CAH71213.1 .
    AL157882 , AL451131 Genomic DNA. Translation: CAH71214.1 .
    AL451131 , AL157882 Genomic DNA. Translation: CAH72317.1 .
    AL451131 , AL157882 Genomic DNA. Translation: CAH72318.1 .
    CH471089 Genomic DNA. Translation: EAW62694.1 .
    CH471089 Genomic DNA. Translation: EAW62698.1 .
    CH471089 Genomic DNA. Translation: EAW62697.1 . Sequence problems.
    BC060815 mRNA. Translation: AAH60815.1 .
    BX648366 mRNA. Translation: CAH56158.1 .
    AL833359 mRNA. Translation: CAH56222.1 . Different initiation.
    CCDSi CCDS6672.1. [Q9UPW5-2 ]
    CCDS69615.1. [Q9UPW5-3 ]
    RefSeqi NP_001273644.1. NM_001286715.1.
    NP_001273646.1. NM_001286717.1. [Q9UPW5-3 ]
    NP_056054.2. NM_015239.2. [Q9UPW5-2 ]
    XP_005251904.1. XM_005251847.2. [Q9UPW5-1 ]
    XP_005251905.1. XM_005251848.2. [Q9UPW5-1 ]
    UniGenei Hs.719980.

    3D structure databases

    ProteinModelPortali Q9UPW5.
    SMRi Q9UPW5. Positions 710-1032.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116885. 10 interactions.
    IntActi Q9UPW5. 9 interactions.
    MINTi MINT-2858492.
    STRINGi 9606.ENSP00000338512.

    Protein family/group databases

    MEROPSi M14.028.

    PTM databases

    PhosphoSitei Q9UPW5.

    Polymorphism databases

    DMDMi 160019039.

    Proteomic databases

    MaxQBi Q9UPW5.
    PaxDbi Q9UPW5.
    PRIDEi Q9UPW5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357081 ; ENSP00000349592 ; ENSG00000135049 . [Q9UPW5-1 ]
    ENST00000376083 ; ENSP00000365251 ; ENSG00000135049 . [Q9UPW5-2 ]
    GeneIDi 23287.
    KEGGi hsa:23287.
    UCSCi uc004aod.4. human. [Q9UPW5-1 ]
    uc010mqc.3. human. [Q9UPW5-2 ]
    uc011lte.2. human. [Q9UPW5-3 ]

    Organism-specific databases

    CTDi 23287.
    GeneCardsi GC09M088161.
    HGNCi HGNC:17258. AGTPBP1.
    HPAi HPA057208.
    MIMi 606830. gene.
    neXtProti NX_Q9UPW5.
    PharmGKBi PA24630.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2866.
    HOVERGENi HBG107587.
    InParanoidi Q9UPW5.
    OMAi DVLCETL.
    OrthoDBi EOG712TVD.
    PhylomeDBi Q9UPW5.
    TreeFami TF313794.

    Miscellaneous databases

    GenomeRNAii 23287.
    NextBioi 45098.
    PROi Q9UPW5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UPW5.
    Bgeei Q9UPW5.
    CleanExi HS_AGTPBP1.
    Genevestigatori Q9UPW5.

    Family and domain databases

    Gene3Di 1.25.10.10. 1 hit.
    InterProi IPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR000834. Peptidase_M14.
    [Graphical view ]
    Pfami PF00246. Peptidase_M14. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48371. SSF48371. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Hippocampus.
    4. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 396-1226.
      Tissue: Esophageal carcinoma and Lymph node.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-423.

    Entry informationi

    Entry nameiCBPC1_HUMAN
    AccessioniPrimary (citable) accession number: Q9UPW5
    Secondary accession number(s): B4DIT6
    , B4DRZ8, Q5VV80, Q63HM7, Q658P5, Q6P9D6, Q9H8U6, Q9H9W8, Q9NVK1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 100 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Peptidase families
      Classification of peptidase families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3