Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trinucleotide repeat-containing gene 6B protein

Gene

TNRC6B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in RNA-mediated gene silencing by both micro-RNAs (miRNAs) and short interfering RNAs (siRNAs). Required for miRNA-dependent translational repression and siRNA-dependent endonucleolytic cleavage of complementary mRNAs by argonaute family proteins. As scaffoldng protein associates with argonaute proteins bound to partially complementary mRNAs and simultaneously can recruit CCR4-NOT and PAN deadenylase complexes.4 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processRNA-mediated gene silencing, Translation regulation

Enzyme and pathway databases

ReactomeiR-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-4086398 Ca2+ pathway
R-HSA-426496 Post-transcriptional silencing by small RNAs
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-5687128 MAPK6/MAPK4 signaling
R-HSA-8934593 Regulation of RUNX1 Expression and Activity
R-HSA-8936459 RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
R-HSA-8943723 Regulation of PTEN mRNA translation
R-HSA-8948700 Competing endogenous RNAs (ceRNAs) regulate PTEN translation
R-HSA-9018519 Estrogen-dependent gene expression

Names & Taxonomyi

Protein namesi
Recommended name:
Trinucleotide repeat-containing gene 6B protein
Gene namesi
Name:TNRC6B
Synonyms:KIAA1093
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100354.20
HGNCiHGNC:29190 TNRC6B
MIMi610740 gene
neXtProtiNX_Q9UPQ9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi23112
OpenTargetsiENSG00000100354
PharmGKBiPA134992981

Polymorphism and mutation databases

BioMutaiTNRC6B
DMDMi229904901

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000726051 – 1833Trinucleotide repeat-containing gene 6B proteinAdd BLAST1833

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei879PhosphoserineCombined sources1
Modified residuei1432PhosphoserineBy similarity1
Modified residuei1449PhosphothreonineBy similarity1
Modified residuei1461PhosphoserineBy similarity1
Modified residuei1464PhosphothreonineBy similarity1
Modified residuei1816PhosphoserineCombined sources1
Modified residuei1832PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UPQ9
MaxQBiQ9UPQ9
PaxDbiQ9UPQ9
PeptideAtlasiQ9UPQ9
PRIDEiQ9UPQ9

PTM databases

iPTMnetiQ9UPQ9
PhosphoSitePlusiQ9UPQ9

Expressioni

Gene expression databases

BgeeiENSG00000100354
CleanExiHS_TNRC6B
ExpressionAtlasiQ9UPQ9 baseline and differential
GenevisibleiQ9UPQ9 HS

Organism-specific databases

HPAiHPA003180

Interactioni

Subunit structurei

Interacts with AGO1, AGO2, AGO3 and AGO4. Interacts with CNOT1; the interaction mediates the association with the CCR4-NOT complex. Interacts with PAN3; the interaction mediates the association with the PAN complex.7 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116735, 74 interactors
DIPiDIP-29624N
ELMiQ9UPQ9
IntActiQ9UPQ9, 64 interactors
MINTiQ9UPQ9
STRINGi9606.ENSP00000401946

Structurei

3D structure databases

ProteinModelPortaliQ9UPQ9
SMRiQ9UPQ9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1648 – 1720RRMAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 994Interaction with argonaute proteinsAdd BLAST994
Regioni1218 – 1723Silencing domain; interaction with CNOT1 and PAN31 PublicationAdd BLAST506
Regioni1472 – 1490PABPC1-interacting motif-2 (PAM2)Add BLAST19

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1 – 39Sequence analysisAdd BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi825 – 880Pro-richAdd BLAST56
Compositional biasi1150 – 1220Gln-richAdd BLAST71

Sequence similaritiesi

Belongs to the GW182 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IET2 Eukaryota
ENOG410YDKH LUCA
GeneTreeiENSGT00410000025966
HOGENOMiHOG000049171
HOVERGENiHBG062594
InParanoidiQ9UPQ9
KOiK18412
OMAiDIEEMPR
OrthoDBiEOG091G00G6
PhylomeDBiQ9UPQ9
TreeFamiTF329702

Family and domain databases

CDDicd12712 RRM_TNRC6B, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR019486 Argonaute_hook_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR032226 TNRC6_PABC-bd
IPR033500 TNRC6B
IPR034925 TNRC6B_RRM
PANTHERiPTHR13020:SF32 PTHR13020:SF32, 1 hit
PfamiView protein in Pfam
PF10427 Ago_hook, 1 hit
PF16608 TNRC6-PABC_bdg, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UPQ9-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MREKEQEREE QLMEDKKRKK EDKKKKEATQ KVTEQKTKVP EVTKPSLSQP
60 70 80 90 100
TAASPIGSSP SPPVNGGNNA KRVAVPNGQP PSAARYMPRE VPPRFRCQQD
110 120 130 140 150
HKVLLKRGQP PPPSCMLLGG GAGPPPCTAP GANPNNAQVT GALLQSESGT
160 170 180 190 200
APDSTLGGAA ASNYANSTWG SGASSNNGTS PNPIHIWDKV IVDGSDMEEW
210 220 230 240 250
PCIASKDTES SSENTTDNNS ASNPGSEKST LPGSTTSNKG KGSQCQSASS
260 270 280 290 300
GNECNLGVWK SDPKAKSVQS SNSTTENNNG LGNWRNVSGQ DRIGPGSGFS
310 320 330 340 350
NFNPNSNPSA WPALVQEGTS RKGALETDNS NSSAQVSTVG QTSREQQSKM
360 370 380 390 400
ENAGVNFVVS GREQAQIHNT DGPKNGNTNS LNLSSPNPME NKGMPFGMGL
410 420 430 440 450
GNTSRSTDAP SQSTGDRKTG SVGSWGAARG PSGTDTVSGQ SNSGNNGNNG
460 470 480 490 500
KEREDSWKGA SVQKSTGSKN DSWDNNNRST GGSWNFGPQD SNDNKWGEGN
510 520 530 540 550
KMTSGVSQGE WKQPTGSDEL KIGEWSGPNQ PNSSTGAWDN QKGHPLPENQ
560 570 580 590 600
GNAQAPCWGR SSSSTGSEVG GQSTGSNHKA GSSDSHNSGR RSYRPTHPDC
610 620 630 640 650
QAVLQTLLSR TDLDPRVLSN TGWGQTQIKQ DTVWDIEEVP RPEGKSDKGT
660 670 680 690 700
EGWESAATQT KNSGGWGDAP SQSNQMKSGW GELSASTEWK DPKNTGGWND
710 720 730 740 750
YKNNNSSNWG GGRPDEKTPS SWNENPSKDQ GWGGGRQPNQ GWSSGKNGWG
760 770 780 790 800
EEVDQTKNSN WESSASKPVS GWGEGGQNEI GTWGNGGNAS LASKGGWEDC
810 820 830 840 850
KRSPAWNETG RQPNSWNKQH QQQQPPQQPP PPQPEASGSW GGPPPPPPGN
860 870 880 890 900
VRPSNSSWSS GPQPATPKDE EPSGWEEPSP QSISRKMDID DGTSAWGDPN
910 920 930 940 950
SYNYKNVNLW DKNSQGGPAP REPNLPTPMT SKSASVWSKS TPPAPDNGTS
960 970 980 990 1000
AWGEPNESSP GWGEMDDTGA STTGWGNTPA NAPNAMKPNS KSMQDGWGES
1010 1020 1030 1040 1050
DGPVTGARHP SWEEEEDGGV WNTTGSQGSA SSHNSASWGQ GGKKQMKCSL
1060 1070 1080 1090 1100
KGGNNDSWMN PLAKQFSNMG LLSQTEDNPS SKMDLSVGSL SDKKFDVDKR
1110 1120 1130 1140 1150
AMNLGDFNDI MRKDRSGFRP PNSKDMGTTD SGPYFEKLTL PFSNQDGCLG
1160 1170 1180 1190 1200
DEAPCSPFSP SPSYKLSPSG STLPNVSLGA IGTGLNPQNF AARQGGSHGL
1210 1220 1230 1240 1250
FGNSTAQSRG LHTPVQPLNS SPSLRAQVPP QFISPQVSAS MLKQFPNSGL
1260 1270 1280 1290 1300
SPGLFNVGPQ LSPQQIAMLS QLPQIPQFQL ACQLLLQQQQ QQQLLQNQRK
1310 1320 1330 1340 1350
ISQAVRQQQE QQLARMVSAL QQQQQQQQRQ PGMKHSPSHP VGPKPHLDNM
1360 1370 1380 1390 1400
VPNALNVGLP DLQTKGPIPG YGSGFSSGGM DYGMVGGKEA GTESRFKQWT
1410 1420 1430 1440 1450
SMMEGLPSVA TQEANMHKNG AIVAPGKTRG GSPYNQFDII PGDTLGGHTG
1460 1470 1480 1490 1500
PAGDSWLPAK SPPTNKIGSK SSNASWPPEF QPGVPWKGIQ NIDPESDPYV
1510 1520 1530 1540 1550
TPGSVLGGTA TSPIVDTDHQ LLRDNTTGSN SSLNTSLPSP GAWPYSASDN
1560 1570 1580 1590 1600
SFTNVHSTSA KFPDYKSTWS PDPIGHNPTH LSNKMWKNHI SSRNTTPLPR
1610 1620 1630 1640 1650
PPPGLTNPKP SSPWSSTAPR SVRGWGTQDS RLASASTWSD GGSVRPSYWL
1660 1670 1680 1690 1700
VLHNLTPQID GSTLRTICMQ HGPLLTFHLN LTQGTALIRY STKQEAAKAQ
1710 1720 1730 1740 1750
TALHMCVLGN TTILAEFATD DEVSRFLAQA QPPTPAATPS APAAGWQSLE
1760 1770 1780 1790 1800
TGQNQSDPVG PALNLFGGST GLGQWSSSAG GSSGADLAGA SLWGPPNYSS
1810 1820 1830
SLWGVPTVED PHRMGSPAPL LPGDLLGGGS DSI
Length:1,833
Mass (Da):194,002
Last modified:May 5, 2009 - v4
Checksum:iE982B786C97C75D0
GO
Isoform 2 (identifier: Q9UPQ9-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     936-989: VWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWGNTPANAPNAMKPN → D
     1138-1194: Missing.

Show »
Length:1,723
Mass (Da):182,815
Checksum:i80AFD934D6D02FC6
GO
Isoform 3 (identifier: Q9UPQ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MR → MQTNEGEVSEESSSKVEQEDFVMEGHGKTPPPGEESKQ
     153-935: Missing.
     1138-1194: Missing.

Show »
Length:1,029
Mass (Da):109,345
Checksum:i4CF58AF70B8973B3
GO

Sequence cautioni

The sequence BAA83045 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1321Missing in BAA83045 (PubMed:10470851).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051452517S → C. Corresponds to variant dbSNP:rs17001767Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0372901 – 2MR → MQTNEGEVSEESSSKVEQED FVMEGHGKTPPPGEESKQ in isoform 3. 1 Publication2
Alternative sequenceiVSP_037291153 – 935Missing in isoform 3. 1 PublicationAdd BLAST783
Alternative sequenceiVSP_037292936 – 989VWSKS…AMKPN → D in isoform 2. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_0372931138 – 1194Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB029016 mRNA Translation: BAA83045.2 Different initiation.
AK294519 mRNA Translation: BAG57731.1
Z93783 Genomic DNA No translation available.
AL031589 Genomic DNA No translation available.
AL022238 Genomic DNA No translation available.
CH471095 Genomic DNA Translation: EAW60367.1
BC028626 mRNA Translation: AAH28626.1
CCDSiCCDS46712.1 [Q9UPQ9-2]
CCDS46713.1 [Q9UPQ9-1]
CCDS54533.1 [Q9UPQ9-3]
RefSeqiNP_001020014.1, NM_001024843.1 [Q9UPQ9-2]
NP_001155973.1, NM_001162501.1 [Q9UPQ9-3]
NP_055903.2, NM_015088.2 [Q9UPQ9-1]
UniGeneiHs.372082

Genome annotation databases

EnsembliENST00000301923; ENSP00000306759; ENSG00000100354 [Q9UPQ9-2]
ENST00000335727; ENSP00000338371; ENSG00000100354 [Q9UPQ9-1]
ENST00000402203; ENSP00000384795; ENSG00000100354 [Q9UPQ9-2]
ENST00000454349; ENSP00000401946; ENSG00000100354 [Q9UPQ9-3]
GeneIDi23112
KEGGihsa:23112
UCSCiuc003aym.4 human [Q9UPQ9-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTNR6B_HUMAN
AccessioniPrimary (citable) accession number: Q9UPQ9
Secondary accession number(s): B0QY73
, B0QY78, B4DGC0, Q5TH52, Q8TBX2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 7, 2003
Last sequence update: May 5, 2009
Last modified: May 23, 2018
This is version 153 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health