Q9UPQ9 (TNR6B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Trinucleotide repeat-containing gene 6B protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1833 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in RNA-mediated gene silencing by both micro-RNAs (miRNAs) and short interfering RNAs (siRNAs). Required for miRNA-dependent translational repression and siRNA-dependent endonucleolytic cleavage of complementary mRNAs by argonaute family proteins. Ref.7 Ref.10 Ref.11 |
| Subunit structure | Interacts with EIF2C1/AGO1, EIF2C2/AGO2, EIF2C3/AGO3 and EIF2C4/AGO4. Ref.7 Ref.8 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm › P-body. Note: Mammalian P-bodies are also known as GW bodies (GWBs). Ref.7 Ref.10 |
| Sequence similarities | Belongs to the GW182 family. Contains 1 RRM (RNA recognition motif) domain. |
| Sequence caution | The sequence BAA83045.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | RNA-mediated gene silencing Translation regulation |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Notch signaling pathway Traceable author statement. Source: Reactome gene expressionTraceable author statement. Source: Reactome gene silencing by RNAInferred from electronic annotation. Source: UniProtKB-KW regulation of translationInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasmic mRNA processing body Inferred from electronic annotation. Source: UniProtKB-SubCell cytosolTraceable author statement. Source: Reactome |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UPQ9-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UPQ9-1) The sequence of this isoform differs from the canonical sequence as follows: 936-989: VWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWGNTPANAPNAMKPN → D 1138-1194: Missing. | ||||||
| Isoform 3 (identifier: Q9UPQ9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-2: MR → MQTNEGEVSEESSSKVEQEDFVMEGHGKTPPPGEESKQ 153-935: Missing. 1138-1194: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1833 | 1833 | Trinucleotide repeat-containing gene 6B protein | PRO_0000072605 | |||||
Regions | |||||||||
| Domain | 1648 – 1720 | 73 | RRM | ||||||
| Coiled coil | 1 – 39 | 39 | Potential | ||||||
| Compositional bias | 825 – 880 | 56 | Pro-rich | ||||||
| Compositional bias | 1150 – 1220 | 71 | Gln-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 879 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 1816 | 1 | Phosphoserine Ref.9 Ref.12 Ref.13 | ||||||
| Modified residue | 1832 | 1 | Phosphoserine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 2 | 2 | MR → MQTNEGEVSEESSSKVEQED FVMEGHGKTPPPGEESKQ in isoform 3. | VSP_037290 | |||||
| Alternative sequence | 153 – 935 | 783 | Missing in isoform 3. | VSP_037291 | |||||
| Alternative sequence | 936 – 989 | 54 | VWSKS…AMKPN → D in isoform 2. | VSP_037292 | |||||
| Alternative sequence | 1138 – 1194 | 57 | Missing in isoform 2 and isoform 3. | VSP_037293 | |||||
| Natural variant | 517 | 1 | S → C. Corresponds to variant rs17001767 [ dbSNP | Ensembl ]. | VAR_051452 | |||||
Experimental info | |||||||||
| Sequence conflict | 1321 | 1 | Missing in BAA83045. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Amygdala. |
| [4] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [7] | "Identification of novel argonaute-associated proteins." Meister G., Landthaler M., Peters L., Chen P.Y., Urlaub H., Luehrmann R., Tuschl T. Curr. Biol. 15:2149-2155(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION, INTERACTION WITH EIF2C1 AND EIF2C2, SUBCELLULAR LOCATION. |
| [8] | "Prolyl 4-hydroxylation regulates Argonaute 2 stability." Qi H.H., Ongusaha P.P., Myllyharju J., Cheng D., Pakkanen O., Shi Y., Lee S.W., Peng J., Shi Y. Nature 455:421-424(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH EIF2C1; EIF2C2; EIF2C3 AND EIF2C4. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1816, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs." Weinmann L., Hoeck J., Ivacevic T., Ohrt T., Muetze J., Schwille P., Kremmer E., Benes V., Urlaub H., Meister G. Cell 136:496-507(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION, INTERACTION WITH EIF2C3 AND EIF2C4, SUBCELLULAR LOCATION. |
| [11] | "Importance of the C-terminal domain of the human GW182 protein TNRC6C for translational repression." Zipprich J.T., Bhattacharyya S., Mathys H., Filipowicz W. RNA 15:781-793(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF2C2. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1816, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1816 AND SER-1832, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-879, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB029016 mRNA. Translation: BAA83045.2. Different initiation. AK294519 mRNA. Translation: BAG57731.1. Z93783, AL022238, AL031589 Genomic DNA. Translation: CAQ07207.1. Z93783, AL022238, AL031589 Genomic DNA. Translation: CAQ07209.1. AL031589, AL022238, Z93783 Genomic DNA. Translation: CAQ08008.1. AL031589, AL022238, Z93783 Genomic DNA. Translation: CAQ08010.1. AL022238, AL031589, Z93783 Genomic DNA. Translation: CAQ08927.1. AL022238, AL031589, Z93783 Genomic DNA. Translation: CAQ08932.1. CH471095 Genomic DNA. Translation: EAW60367.1. BC028626 mRNA. Translation: AAH28626.1. |
| IPI | IPI00152296. IPI00873067. IPI00940033. |
| RefSeq | NP_001020014.1. NM_001024843.1. NP_001155973.1. NM_001162501.1. NP_055903.2. NM_015088.2. |
| UniGene | Hs.372082. |
3D structure databases | |
| ProteinModelPortal | Q9UPQ9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29624N. DIP-44174N. |
| IntAct | Q9UPQ9. 18 interactions. |
| MINT | MINT-2822586. |
| STRING | 9606.ENSP00000338371. |
PTM databases | |
| PhosphoSite | Q9UPQ9. |
Polymorphism databases | |
| DMDM | 229904901. |
Proteomic databases | |
| PaxDb | Q9UPQ9. |
| PRIDE | Q9UPQ9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000301923; ENSP00000306759; ENSG00000100354. ENST00000335727; ENSP00000338371; ENSG00000100354. ENST00000402203; ENSP00000384795; ENSG00000100354. ENST00000454349; ENSP00000401946; ENSG00000100354. |
| GeneID | 23112. |
| KEGG | hsa:23112. |
| UCSC | uc003aym.3. human. uc003ayn.4. human. uc003ayo.3. human. |
Organism-specific databases | |
| CTD | 23112. |
| GeneCards | GC22P040440. |
| HGNC | HGNC:29190. TNRC6B. |
| HPA | HPA003180. |
| MIM | 610740. gene. |
| neXtProt | NX_Q9UPQ9. |
| PharmGKB | PA134992981. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG260411. |
| HOGENOM | HOG000049171. |
| HOVERGEN | HBG062594. |
| OMA | NETGRQP. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_6900. Immune System. REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q9UPQ9. |
| Bgee | Q9UPQ9. |
| CleanEx | HS_TNRC6B. |
| Genevestigator | Q9UPQ9. |
| GermOnline | ENSG00000100354. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.70.330. 2 hits. |
| InterPro | IPR019486. Argonaute_hook_dom. IPR026804. GW182_fam. IPR012677. Nucleotide-bd_a/b_plait. IPR009060. UBA-like. [Graphical view] |
| PANTHER | PTHR31070. PTHR31070. 1 hit. |
| Pfam | PF10427. Ago_hook. 1 hit. [Graphical view] |
| SUPFAM | SSF46934. UBA_like. 1 hit. |
| PROSITE | PS50102. RRM. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TNRC6B. human. |
| GenomeRNAi | 23112. |
| NextBio | 44311. |
| SOURCE | Search... |
Entry information
| Entry name | TNR6B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UPQ9 Secondary accession number(s): B0QY73 Q8TBX2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
