Q9UPM6 (LHX6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM/homeobox protein Lhx6 Short name=LIM homeobox protein 6 Alternative name(s): LIM/homeobox protein Lhx6.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 363 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex By similarity. |
| Subunit structure | Interacts with LDB1 (via the LIM zinc-binding domains) By similarity. |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Contains 1 homeobox DNA-binding domain. Contains 2 LIM zinc-binding domains. |
| Sequence caution | The sequence AAI03937.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI03938.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAB66505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UPM6-1) Also known as: Lhx6.1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UPM6-2) Also known as: Lhx6.1b; The sequence of this isoform differs from the canonical sequence as follows: 324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR | ||||||
| Isoform 3 (identifier: Q9UPM6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM | ||||||
| Isoform 4 (identifier: Q9UPM6-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM 324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR | ||||||
| Isoform 5 (identifier: Q9UPM6-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRRGLCRRSAENPDAGPVM 324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR | ||||||
| Isoform 6 (identifier: Q9UPM6-6) The sequence of this isoform differs from the canonical sequence as follows: 1-187: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 363 | 363 | LIM/homeobox protein Lhx6 | PRO_0000075794 | |||||
Regions | |||||||||
| Domain | 70 – 122 | 53 | LIM zinc-binding 1 | ||||||
| Domain | 131 – 184 | 54 | LIM zinc-binding 2 | ||||||
| DNA binding | 219 – 278 | 60 | Homeobox | ||||||
| Region | 55 – 194 | 140 | Required for interaction with LDB1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 187 | 187 | Missing in isoform 6. | VSP_046043 | |||||
| Alternative sequence | 1 | 1 | M → MYWKHENAAPALPEGCRLPA EGGPATDQVM in isoform 3 and isoform 4. | VSP_037745 | |||||
| Alternative sequence | 1 | 1 | M → MRRGLCRRSAENPDAGPVM in isoform 5. | VSP_042073 | |||||
| Alternative sequence | 324 – 363 | 40 | QVQCG…ILFQY → HPFSVLTLPALPHLPVGAPQ LPLSR in isoform 2, isoform 4 and isoform 5. | VSP_003109 | |||||
Experimental info | |||||||||
| Sequence conflict | 16 | 1 | E → K in BAA83422. Ref.1 | ||||||
| Sequence conflict | 16 | 1 | E → K in BAA83423. Ref.1 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 346 | 1 | L → F in BAA83423. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB031041 mRNA. Translation: BAA83422.1. AB031042 mRNA. Translation: BAA83423.1. AK126982 mRNA. No translation available. AK289827 mRNA. Translation: BAF82516.1. AK297175 mRNA. Translation: BAH12516.1. AK299709 mRNA. Translation: BAH13108.1. AK313808 mRNA. Translation: BAG36544.1. AL162424 Genomic DNA. Translation: CAO03566.1. AL162424 Genomic DNA. Translation: CAI14703.1. AL162424 Genomic DNA. Translation: CAI14704.1. AL162424 Genomic DNA. Translation: CAO03565.1. CH471090 Genomic DNA. Translation: EAW87515.1. CH471090 Genomic DNA. Translation: EAW87516.1. AL136570 mRNA. Translation: CAB66505.1. Different initiation. BC103936 mRNA. Translation: AAI03937.1. Different initiation. BC103937 mRNA. Translation: AAI03938.1. Different initiation. |
| IPI | IPI00294419. IPI00513787. IPI00852614. IPI00853518. |
| PIR | T46907. |
| RefSeq | NP_001229262.1. NM_001242333.1. NP_001229263.1. NM_001242334.1. NP_001229264.1. NM_001242335.1. NP_055183.2. NM_014368.4. NP_954629.2. NM_199160.3. |
| UniGene | Hs.103137. |
3D structure databases | |
| ProteinModelPortal | Q9UPM6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4718974. |
| STRING | 9606.ENSP00000377854. |
Polymorphism databases | |
| DMDM | 90185239. |
Proteomic databases | |
| PaxDb | Q9UPM6. |
| PRIDE | Q9UPM6. |
Protocols and materials databases | |
| DNASU | 26468. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000340587; ENSP00000340137; ENSG00000106852. ENST00000373754; ENSP00000362859; ENSG00000106852. ENST00000373755; ENSP00000362860; ENSG00000106852. ENST00000394319; ENSP00000377854; ENSG00000106852. ENST00000541397; ENSP00000441464; ENSG00000106852. ENST00000559895; ENSP00000453897; ENSG00000106852. |
| GeneID | 26468. |
| KEGG | hsa:26468. |
| UCSC | uc004blx.4. human. uc004bly.4. human. uc010mvw.3. human. uc022bmx.1. human. |
Organism-specific databases | |
| CTD | 26468. |
| GeneCards | GC09M124964. |
| HGNC | HGNC:21735. LHX6. |
| HPA | HPA047854. |
| MIM | 608215. gene. |
| neXtProt | NX_Q9UPM6. |
| PharmGKB | PA134949308. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG264882. |
| HOGENOM | HOG000038965. |
| HOVERGEN | HBG006261. |
| InParanoid | Q9UPM6. |
| KO | K09375. |
| OMA | PATDQVM. |
| OrthoDB | EOG4GTKD8. |
| PhylomeDB | Q9UPM6. |
Gene expression databases | |
| ArrayExpress | Q9UPM6. |
| Bgee | Q9UPM6. |
| CleanEx | HS_LHX6. |
| Genevestigator | Q9UPM6. |
| GermOnline | ENSG00000106852. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. 2.10.110.10. 2 hits. |
| InterPro | IPR017970. Homeobox_CS. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR001781. Znf_LIM. [Graphical view] |
| Pfam | PF00046. Homeobox. 1 hit. PF00412. LIM. 2 hits. [Graphical view] |
| SMART | SM00389. HOX. 1 hit. SM00132. LIM. 2 hits. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 26468. |
| NextBio | 48705. |
| SOURCE | Search... |
Entry information
| Entry name | LHX6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UPM6 Secondary accession number(s): A6PVQ1 Q9UPM5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
