Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UPM6

- LHX6_HUMAN

UniProt

Q9UPM6 - LHX6_HUMAN

Protein

LIM/homeobox protein Lhx6

Gene

LHX6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 142 (01 Oct 2014)
      Sequence version 2 (07 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi219 – 27860HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell maturation Source: UniProtKB
    2. cerebral cortex GABAergic interneuron migration Source: UniProtKB
    3. cerebral cortex radially oriented cell migration Source: UniProtKB
    4. cerebral cortex tangential migration Source: UniProtKB
    5. forebrain neuron fate commitment Source: Ensembl
    6. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Neurogenesis, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    LIM/homeobox protein Lhx6
    Short name:
    LIM homeobox protein 6
    Alternative name(s):
    LIM/homeobox protein Lhx6.1
    Gene namesi
    Name:LHX6
    Synonyms:LHX6.1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:21735. LHX6.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: LIFEdb

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134949308.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 363363LIM/homeobox protein Lhx6PRO_0000075794Add
    BLAST

    Proteomic databases

    PaxDbiQ9UPM6.
    PRIDEiQ9UPM6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9UPM6.
    BgeeiQ9UPM6.
    CleanExiHS_LHX6.
    GenevestigatoriQ9UPM6.

    Organism-specific databases

    HPAiHPA047854.

    Interactioni

    Subunit structurei

    Interacts with LDB1 (via the LIM zinc-binding domains).By similarity

    Protein-protein interaction databases

    MINTiMINT-4718974.
    STRINGi9606.ENSP00000377854.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UPM6.
    SMRiQ9UPM6. Positions 69-187, 214-277.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini70 – 12253LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini131 – 18454LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni55 – 194140Required for interaction with LDB1By similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
    Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox, LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG264882.
    HOGENOMiHOG000038965.
    HOVERGENiHBG006261.
    InParanoidiQ9UPM6.
    KOiK09375.
    OMAiLSEDIHY.
    OrthoDBiEOG744T9J.
    PhylomeDBiQ9UPM6.
    TreeFamiTF315442.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    2.10.110.10. 2 hits.
    InterProiIPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00046. Homeobox. 1 hit.
    PF00412. LIM. 2 hits.
    [Graphical view]
    SMARTiSM00389. HOX. 1 hit.
    SM00132. LIM. 2 hits.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    PROSITEiPS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UPM6-1) [UniParc]FASTAAdd to Basket

    Also known as: Lhx6.1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQPGSGCKA TTRCLEGTAP PAMAQSDAEA LAGALDKDEG QASPCTPSTP    50
    SVCSPPSAAS SVPSAGKNIC SSCGLEILDR YLLKVNNLIW HVRCLECSVC 100
    RTSLRQQNSC YIKNKEIFCK MDYFSRFGTK CARCGRQIYA SDWVRRARGN 150
    AYHLACFACF SCKRQLSTGE EFGLVEEKVL CRIHYDTMIE NLKRAAENGN 200
    GLTLEGAVPS EQDSQPKPAK RARTSFTAEQ LQVMQAQFAQ DNNPDAQTLQ 250
    KLADMTGLSR RVIQVWFQNC RARHKKHTPQ HPVPPSGAPP SRLPSALSDD 300
    IHYTPFSSPE RARMVTLHGY IESQVQCGQV HCRLPYTAPP VHLKADMDGP 350
    LSNRGEKVIL FQY 363
    Length:363
    Mass (Da):40,045
    Last modified:March 7, 2006 - v2
    Checksum:i3633B5112D548532
    GO
    Isoform 2 (identifier: Q9UPM6-2) [UniParc]FASTAAdd to Basket

    Also known as: Lhx6.1b

    The sequence of this isoform differs from the canonical sequence as follows:
         324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

    Show »
    Length:348
    Mass (Da):38,193
    Checksum:iDC0A3056BC56EF37
    GO
    Isoform 3 (identifier: Q9UPM6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM

    Show »
    Length:392
    Mass (Da):43,136
    Checksum:iD2A915F07BFC73C0
    GO
    Isoform 4 (identifier: Q9UPM6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM
         324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

    Show »
    Length:377
    Mass (Da):41,284
    Checksum:i132637341D6A94B4
    GO
    Isoform 5 (identifier: Q9UPM6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRRGLCRRSAENPDAGPVM
         324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

    Show »
    Length:366
    Mass (Da):40,160
    Checksum:iF78470DB966B0E28
    GO
    Isoform 6 (identifier: Q9UPM6-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-187: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:176
    Mass (Da):19,618
    Checksum:i58A580E0C2AEE8FD
    GO

    Sequence cautioni

    The sequence AAI03937.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI03938.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAB66505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti16 – 161E → K in BAA83422. (PubMed:10393337)Curated
    Sequence conflicti16 – 161E → K in BAA83423. (PubMed:10393337)Curated
    Isoform 2 (identifier: Q9UPM6-2)
    Sequence conflicti346 – 3461L → F in BAA83423. (PubMed:10393337)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 187187Missing in isoform 6. 1 PublicationVSP_046043Add
    BLAST
    Alternative sequencei1 – 11M → MYWKHENAAPALPEGCRLPA EGGPATDQVM in isoform 3 and isoform 4. 1 PublicationVSP_037745
    Alternative sequencei1 – 11M → MRRGLCRRSAENPDAGPVM in isoform 5. 1 PublicationVSP_042073
    Alternative sequencei324 – 36340QVQCG…ILFQY → HPFSVLTLPALPHLPVGAPQ LPLSR in isoform 2, isoform 4 and isoform 5. 2 PublicationsVSP_003109Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB031041 mRNA. Translation: BAA83422.1.
    AB031042 mRNA. Translation: BAA83423.1.
    AK126982 mRNA. No translation available.
    AK289827 mRNA. Translation: BAF82516.1.
    AK297175 mRNA. Translation: BAH12516.1.
    AK299709 mRNA. Translation: BAH13108.1.
    AK313808 mRNA. Translation: BAG36544.1.
    AL162424 Genomic DNA. Translation: CAO03566.1.
    AL162424 Genomic DNA. Translation: CAI14703.1.
    AL162424 Genomic DNA. Translation: CAI14704.1.
    AL162424 Genomic DNA. Translation: CAO03565.1.
    CH471090 Genomic DNA. Translation: EAW87515.1.
    CH471090 Genomic DNA. Translation: EAW87516.1.
    AL136570 mRNA. Translation: CAB66505.1. Different initiation.
    BC103936 mRNA. Translation: AAI03937.1. Different initiation.
    BC103937 mRNA. Translation: AAI03938.1. Different initiation.
    CCDSiCCDS56583.1. [Q9UPM6-1]
    CCDS56584.1. [Q9UPM6-5]
    CCDS59144.1. [Q9UPM6-6]
    CCDS6837.2. [Q9UPM6-4]
    CCDS6838.2. [Q9UPM6-3]
    PIRiT46907.
    RefSeqiNP_001229262.1. NM_001242333.1. [Q9UPM6-5]
    NP_001229263.1. NM_001242334.1. [Q9UPM6-1]
    NP_001229264.1. NM_001242335.1. [Q9UPM6-6]
    NP_055183.2. NM_014368.4. [Q9UPM6-3]
    NP_954629.2. NM_199160.3. [Q9UPM6-4]
    UniGeneiHs.103137.

    Genome annotation databases

    EnsembliENST00000340587; ENSP00000340137; ENSG00000106852. [Q9UPM6-4]
    ENST00000373754; ENSP00000362859; ENSG00000106852. [Q9UPM6-2]
    ENST00000373755; ENSP00000362860; ENSG00000106852. [Q9UPM6-1]
    ENST00000394319; ENSP00000377854; ENSG00000106852. [Q9UPM6-3]
    ENST00000541397; ENSP00000441464; ENSG00000106852. [Q9UPM6-5]
    ENST00000559895; ENSP00000475927; ENSG00000106852. [Q9UPM6-6]
    GeneIDi26468.
    KEGGihsa:26468.
    UCSCiuc004blx.4. human. [Q9UPM6-3]
    uc004bly.4. human. [Q9UPM6-4]
    uc010mvw.3. human. [Q9UPM6-1]
    uc022bmx.1. human. [Q9UPM6-5]

    Polymorphism databases

    DMDMi90185239.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB031041 mRNA. Translation: BAA83422.1 .
    AB031042 mRNA. Translation: BAA83423.1 .
    AK126982 mRNA. No translation available.
    AK289827 mRNA. Translation: BAF82516.1 .
    AK297175 mRNA. Translation: BAH12516.1 .
    AK299709 mRNA. Translation: BAH13108.1 .
    AK313808 mRNA. Translation: BAG36544.1 .
    AL162424 Genomic DNA. Translation: CAO03566.1 .
    AL162424 Genomic DNA. Translation: CAI14703.1 .
    AL162424 Genomic DNA. Translation: CAI14704.1 .
    AL162424 Genomic DNA. Translation: CAO03565.1 .
    CH471090 Genomic DNA. Translation: EAW87515.1 .
    CH471090 Genomic DNA. Translation: EAW87516.1 .
    AL136570 mRNA. Translation: CAB66505.1 . Different initiation.
    BC103936 mRNA. Translation: AAI03937.1 . Different initiation.
    BC103937 mRNA. Translation: AAI03938.1 . Different initiation.
    CCDSi CCDS56583.1. [Q9UPM6-1 ]
    CCDS56584.1. [Q9UPM6-5 ]
    CCDS59144.1. [Q9UPM6-6 ]
    CCDS6837.2. [Q9UPM6-4 ]
    CCDS6838.2. [Q9UPM6-3 ]
    PIRi T46907.
    RefSeqi NP_001229262.1. NM_001242333.1. [Q9UPM6-5 ]
    NP_001229263.1. NM_001242334.1. [Q9UPM6-1 ]
    NP_001229264.1. NM_001242335.1. [Q9UPM6-6 ]
    NP_055183.2. NM_014368.4. [Q9UPM6-3 ]
    NP_954629.2. NM_199160.3. [Q9UPM6-4 ]
    UniGenei Hs.103137.

    3D structure databases

    ProteinModelPortali Q9UPM6.
    SMRi Q9UPM6. Positions 69-187, 214-277.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-4718974.
    STRINGi 9606.ENSP00000377854.

    Polymorphism databases

    DMDMi 90185239.

    Proteomic databases

    PaxDbi Q9UPM6.
    PRIDEi Q9UPM6.

    Protocols and materials databases

    DNASUi 26468.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000340587 ; ENSP00000340137 ; ENSG00000106852 . [Q9UPM6-4 ]
    ENST00000373754 ; ENSP00000362859 ; ENSG00000106852 . [Q9UPM6-2 ]
    ENST00000373755 ; ENSP00000362860 ; ENSG00000106852 . [Q9UPM6-1 ]
    ENST00000394319 ; ENSP00000377854 ; ENSG00000106852 . [Q9UPM6-3 ]
    ENST00000541397 ; ENSP00000441464 ; ENSG00000106852 . [Q9UPM6-5 ]
    ENST00000559895 ; ENSP00000475927 ; ENSG00000106852 . [Q9UPM6-6 ]
    GeneIDi 26468.
    KEGGi hsa:26468.
    UCSCi uc004blx.4. human. [Q9UPM6-3 ]
    uc004bly.4. human. [Q9UPM6-4 ]
    uc010mvw.3. human. [Q9UPM6-1 ]
    uc022bmx.1. human. [Q9UPM6-5 ]

    Organism-specific databases

    CTDi 26468.
    GeneCardsi GC09M124964.
    HGNCi HGNC:21735. LHX6.
    HPAi HPA047854.
    MIMi 608215. gene.
    neXtProti NX_Q9UPM6.
    PharmGKBi PA134949308.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG264882.
    HOGENOMi HOG000038965.
    HOVERGENi HBG006261.
    InParanoidi Q9UPM6.
    KOi K09375.
    OMAi LSEDIHY.
    OrthoDBi EOG744T9J.
    PhylomeDBi Q9UPM6.
    TreeFami TF315442.

    Miscellaneous databases

    GeneWikii LHX6.
    GenomeRNAii 26468.
    NextBioi 48705.
    PROi Q9UPM6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UPM6.
    Bgeei Q9UPM6.
    CleanExi HS_LHX6.
    Genevestigatori Q9UPM6.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    2.10.110.10. 2 hits.
    InterProi IPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00046. Homeobox. 1 hit.
    PF00412. LIM. 2 hits.
    [Graphical view ]
    SMARTi SM00389. HOX. 1 hit.
    SM00132. LIM. 2 hits.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    PROSITEi PS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains."
      Kimura N., Ueno M., Nakashima K., Taga T.
      J. Biochem. 126:180-187(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 5 AND 6).
      Tissue: Brain and Hippocampus.
    3. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Amygdala.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).

    Entry informationi

    Entry nameiLHX6_HUMAN
    AccessioniPrimary (citable) accession number: Q9UPM6
    Secondary accession number(s): A6PVQ1
    , A6PVQ2, A8K1B2, B7Z4D0, H0YN76, Q5T7S7, Q5T7S8, Q9NTK3, Q9UPM5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: March 7, 2006
    Last modified: October 1, 2014
    This is version 142 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3