SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UPM6

- LHX6_HUMAN

UniProt

Q9UPM6 - LHX6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
LIM/homeobox protein Lhx6
Gene
LHX6, LHX6.1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi219 – 27860Homeobox
Add
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: UniProtKB
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell maturation Source: UniProtKB
  2. cerebral cortex GABAergic interneuron migration Source: UniProtKB
  3. cerebral cortex radially oriented cell migration Source: UniProtKB
  4. cerebral cortex tangential migration Source: UniProtKB
  5. forebrain neuron development Source: Ensembl
  6. forebrain neuron fate commitment Source: Ensembl
  7. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM/homeobox protein Lhx6
Short name:
LIM homeobox protein 6
Alternative name(s):
LIM/homeobox protein Lhx6.1
Gene namesi
Name:LHX6
Synonyms:LHX6.1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:21735. LHX6.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. nucleus Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134949308.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 363363LIM/homeobox protein Lhx6
PRO_0000075794Add
BLAST

Proteomic databases

PaxDbiQ9UPM6.
PRIDEiQ9UPM6.

Expressioni

Gene expression databases

ArrayExpressiQ9UPM6.
BgeeiQ9UPM6.
CleanExiHS_LHX6.
GenevestigatoriQ9UPM6.

Organism-specific databases

HPAiHPA047854.

Interactioni

Subunit structurei

Interacts with LDB1 (via the LIM zinc-binding domains) By similarity.

Protein-protein interaction databases

MINTiMINT-4718974.
STRINGi9606.ENSP00000377854.

Structurei

3D structure databases

ProteinModelPortaliQ9UPM6.
SMRiQ9UPM6. Positions 69-187, 214-277.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini70 – 12253LIM zinc-binding 1
Add
BLAST
Domaini131 – 18454LIM zinc-binding 2
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni55 – 194140Required for interaction with LDB1 By similarity
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Homeobox, LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG264882.
HOGENOMiHOG000038965.
HOVERGENiHBG006261.
InParanoidiQ9UPM6.
KOiK09375.
OMAiLSEDIHY.
OrthoDBiEOG744T9J.
PhylomeDBiQ9UPM6.
TreeFamiTF315442.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
2.10.110.10. 2 hits.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
SM00132. LIM. 2 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UPM6-1) [UniParc]FASTAAdd to Basket

Also known as: Lhx6.1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQPGSGCKA TTRCLEGTAP PAMAQSDAEA LAGALDKDEG QASPCTPSTP    50
SVCSPPSAAS SVPSAGKNIC SSCGLEILDR YLLKVNNLIW HVRCLECSVC 100
RTSLRQQNSC YIKNKEIFCK MDYFSRFGTK CARCGRQIYA SDWVRRARGN 150
AYHLACFACF SCKRQLSTGE EFGLVEEKVL CRIHYDTMIE NLKRAAENGN 200
GLTLEGAVPS EQDSQPKPAK RARTSFTAEQ LQVMQAQFAQ DNNPDAQTLQ 250
KLADMTGLSR RVIQVWFQNC RARHKKHTPQ HPVPPSGAPP SRLPSALSDD 300
IHYTPFSSPE RARMVTLHGY IESQVQCGQV HCRLPYTAPP VHLKADMDGP 350
LSNRGEKVIL FQY 363
Length:363
Mass (Da):40,045
Last modified:March 7, 2006 - v2
Checksum:i3633B5112D548532
GO
Isoform 2 (identifier: Q9UPM6-2) [UniParc]FASTAAdd to Basket

Also known as: Lhx6.1b

The sequence of this isoform differs from the canonical sequence as follows:
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:348
Mass (Da):38,193
Checksum:iDC0A3056BC56EF37
GO
Isoform 3 (identifier: Q9UPM6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM

Show »
Length:392
Mass (Da):43,136
Checksum:iD2A915F07BFC73C0
GO
Isoform 4 (identifier: Q9UPM6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYWKHENAAPALPEGCRLPAEGGPATDQVM
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:377
Mass (Da):41,284
Checksum:i132637341D6A94B4
GO
Isoform 5 (identifier: Q9UPM6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRRGLCRRSAENPDAGPVM
     324-363: QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY → HPFSVLTLPALPHLPVGAPQLPLSR

Show »
Length:366
Mass (Da):40,160
Checksum:iF78470DB966B0E28
GO
Isoform 6 (identifier: Q9UPM6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Note: No experimental confirmation available.

Show »
Length:176
Mass (Da):19,618
Checksum:i58A580E0C2AEE8FD
GO

Sequence cautioni

The sequence AAI03937.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAI03938.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAB66505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 187187Missing in isoform 6.
VSP_046043Add
BLAST
Alternative sequencei1 – 11M → MYWKHENAAPALPEGCRLPA EGGPATDQVM in isoform 3 and isoform 4.
VSP_037745
Alternative sequencei1 – 11M → MRRGLCRRSAENPDAGPVM in isoform 5.
VSP_042073
Alternative sequencei324 – 36340QVQCG…ILFQY → HPFSVLTLPALPHLPVGAPQ LPLSR in isoform 2, isoform 4 and isoform 5.
VSP_003109Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti16 – 161E → K in BAA83422. 1 Publication
Sequence conflicti16 – 161E → K in BAA83423. 1 Publication
Isoform 2 (identifier: Q9UPM6-2)
Sequence conflicti346 – 3461L → F in BAA83423. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB031041 mRNA. Translation: BAA83422.1.
AB031042 mRNA. Translation: BAA83423.1.
AK126982 mRNA. No translation available.
AK289827 mRNA. Translation: BAF82516.1.
AK297175 mRNA. Translation: BAH12516.1.
AK299709 mRNA. Translation: BAH13108.1.
AK313808 mRNA. Translation: BAG36544.1.
AL162424 Genomic DNA. Translation: CAO03566.1.
AL162424 Genomic DNA. Translation: CAI14703.1.
AL162424 Genomic DNA. Translation: CAI14704.1.
AL162424 Genomic DNA. Translation: CAO03565.1.
CH471090 Genomic DNA. Translation: EAW87515.1.
CH471090 Genomic DNA. Translation: EAW87516.1.
AL136570 mRNA. Translation: CAB66505.1. Different initiation.
BC103936 mRNA. Translation: AAI03937.1. Different initiation.
BC103937 mRNA. Translation: AAI03938.1. Different initiation.
CCDSiCCDS56583.1. [Q9UPM6-1]
CCDS56584.1. [Q9UPM6-5]
CCDS59144.1. [Q9UPM6-6]
CCDS6837.2. [Q9UPM6-4]
CCDS6838.2. [Q9UPM6-3]
PIRiT46907.
RefSeqiNP_001229262.1. NM_001242333.1. [Q9UPM6-5]
NP_001229263.1. NM_001242334.1. [Q9UPM6-1]
NP_001229264.1. NM_001242335.1. [Q9UPM6-6]
NP_055183.2. NM_014368.4. [Q9UPM6-3]
NP_954629.2. NM_199160.3. [Q9UPM6-4]
UniGeneiHs.103137.

Genome annotation databases

EnsembliENST00000340587; ENSP00000340137; ENSG00000106852. [Q9UPM6-4]
ENST00000373754; ENSP00000362859; ENSG00000106852. [Q9UPM6-2]
ENST00000373755; ENSP00000362860; ENSG00000106852. [Q9UPM6-1]
ENST00000394319; ENSP00000377854; ENSG00000106852. [Q9UPM6-3]
ENST00000541397; ENSP00000441464; ENSG00000106852. [Q9UPM6-5]
ENST00000559895; ENSP00000475927; ENSG00000106852. [Q9UPM6-6]
GeneIDi26468.
KEGGihsa:26468.
UCSCiuc004blx.4. human. [Q9UPM6-3]
uc004bly.4. human. [Q9UPM6-4]
uc010mvw.3. human. [Q9UPM6-1]
uc022bmx.1. human. [Q9UPM6-5]

Polymorphism databases

DMDMi90185239.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB031041 mRNA. Translation: BAA83422.1 .
AB031042 mRNA. Translation: BAA83423.1 .
AK126982 mRNA. No translation available.
AK289827 mRNA. Translation: BAF82516.1 .
AK297175 mRNA. Translation: BAH12516.1 .
AK299709 mRNA. Translation: BAH13108.1 .
AK313808 mRNA. Translation: BAG36544.1 .
AL162424 Genomic DNA. Translation: CAO03566.1 .
AL162424 Genomic DNA. Translation: CAI14703.1 .
AL162424 Genomic DNA. Translation: CAI14704.1 .
AL162424 Genomic DNA. Translation: CAO03565.1 .
CH471090 Genomic DNA. Translation: EAW87515.1 .
CH471090 Genomic DNA. Translation: EAW87516.1 .
AL136570 mRNA. Translation: CAB66505.1 . Different initiation.
BC103936 mRNA. Translation: AAI03937.1 . Different initiation.
BC103937 mRNA. Translation: AAI03938.1 . Different initiation.
CCDSi CCDS56583.1. [Q9UPM6-1 ]
CCDS56584.1. [Q9UPM6-5 ]
CCDS59144.1. [Q9UPM6-6 ]
CCDS6837.2. [Q9UPM6-4 ]
CCDS6838.2. [Q9UPM6-3 ]
PIRi T46907.
RefSeqi NP_001229262.1. NM_001242333.1. [Q9UPM6-5 ]
NP_001229263.1. NM_001242334.1. [Q9UPM6-1 ]
NP_001229264.1. NM_001242335.1. [Q9UPM6-6 ]
NP_055183.2. NM_014368.4. [Q9UPM6-3 ]
NP_954629.2. NM_199160.3. [Q9UPM6-4 ]
UniGenei Hs.103137.

3D structure databases

ProteinModelPortali Q9UPM6.
SMRi Q9UPM6. Positions 69-187, 214-277.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-4718974.
STRINGi 9606.ENSP00000377854.

Polymorphism databases

DMDMi 90185239.

Proteomic databases

PaxDbi Q9UPM6.
PRIDEi Q9UPM6.

Protocols and materials databases

DNASUi 26468.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340587 ; ENSP00000340137 ; ENSG00000106852 . [Q9UPM6-4 ]
ENST00000373754 ; ENSP00000362859 ; ENSG00000106852 . [Q9UPM6-2 ]
ENST00000373755 ; ENSP00000362860 ; ENSG00000106852 . [Q9UPM6-1 ]
ENST00000394319 ; ENSP00000377854 ; ENSG00000106852 . [Q9UPM6-3 ]
ENST00000541397 ; ENSP00000441464 ; ENSG00000106852 . [Q9UPM6-5 ]
ENST00000559895 ; ENSP00000475927 ; ENSG00000106852 . [Q9UPM6-6 ]
GeneIDi 26468.
KEGGi hsa:26468.
UCSCi uc004blx.4. human. [Q9UPM6-3 ]
uc004bly.4. human. [Q9UPM6-4 ]
uc010mvw.3. human. [Q9UPM6-1 ]
uc022bmx.1. human. [Q9UPM6-5 ]

Organism-specific databases

CTDi 26468.
GeneCardsi GC09M124964.
HGNCi HGNC:21735. LHX6.
HPAi HPA047854.
MIMi 608215. gene.
neXtProti NX_Q9UPM6.
PharmGKBi PA134949308.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG264882.
HOGENOMi HOG000038965.
HOVERGENi HBG006261.
InParanoidi Q9UPM6.
KOi K09375.
OMAi LSEDIHY.
OrthoDBi EOG744T9J.
PhylomeDBi Q9UPM6.
TreeFami TF315442.

Miscellaneous databases

GeneWikii LHX6.
GenomeRNAii 26468.
NextBioi 48705.
PROi Q9UPM6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UPM6.
Bgeei Q9UPM6.
CleanExi HS_LHX6.
Genevestigatori Q9UPM6.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
2.10.110.10. 2 hits.
InterProi IPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR001781. Znf_LIM.
[Graphical view ]
Pfami PF00046. Homeobox. 1 hit.
PF00412. LIM. 2 hits.
[Graphical view ]
SMARTi SM00389. HOX. 1 hit.
SM00132. LIM. 2 hits.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
PROSITEi PS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains."
    Kimura N., Ueno M., Nakashima K., Taga T.
    J. Biochem. 126:180-187(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 5 AND 6).
    Tissue: Brain and Hippocampus.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Amygdala.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).

Entry informationi

Entry nameiLHX6_HUMAN
AccessioniPrimary (citable) accession number: Q9UPM6
Secondary accession number(s): A6PVQ1
, A6PVQ2, A8K1B2, B7Z4D0, H0YN76, Q5T7S7, Q5T7S8, Q9NTK3, Q9UPM5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 7, 2006
Last modified: July 9, 2014
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi