Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UP95

- S12A4_HUMAN

UniProt

Q9UP95 - S12A4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Solute carrier family 12 member 4

Gene

SLC12A4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl- exit in NaCl absorbing epithelia (By similarity). Isoform 4 has no transport activity.By similarity

Enzyme regulationi

Inhibited by WNK3.1 Publication

GO - Molecular functioni

  1. potassium:chloride symporter activity Source: ProtInc
  2. protein kinase binding Source: BHF-UCL

GO - Biological processi

  1. cell volume homeostasis Source: ProtInc
  2. chloride transmembrane transport Source: GOC
  3. chloride transport Source: GOC
  4. ion transport Source: Reactome
  5. potassium ion transport Source: UniProtKB-KW
  6. transmembrane transport Source: Reactome
  7. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Ion transport, Potassium transport, Symport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

ReactomeiREACT_19315. Cation-coupled Chloride cotransporters.

Protein family/group databases

TCDBi2.A.30.5.5. the cation-chloride cotransporter (ccc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 12 member 4
Alternative name(s):
Electroneutral potassium-chloride cotransporter 1
Erythroid K-Cl cotransporter 1
Short name:
hKCC1
Gene namesi
Name:SLC12A4
Synonyms:KCC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:10913. SLC12A4.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. lysosomal membrane Source: UniProtKB
  3. membrane Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35807.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10851085Solute carrier family 12 member 4PRO_0000178030Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei47 – 471PhosphoserineBy similarity
Modified residuei51 – 511Phosphoserine1 Publication
Glycosylationi245 – 2451N-linked (GlcNAc...)Sequence Analysis
Glycosylationi312 – 3121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi331 – 3311N-linked (GlcNAc...)Sequence Analysis
Glycosylationi347 – 3471N-linked (GlcNAc...)Sequence Analysis
Glycosylationi439 – 4391N-linked (GlcNAc...)Sequence Analysis
Modified residuei967 – 9671Phosphoserine4 Publications

Post-translational modificationi

N-glycosylated.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9UP95.
PaxDbiQ9UP95.
PRIDEiQ9UP95.

PTM databases

PhosphoSiteiQ9UP95.

Expressioni

Tissue specificityi

Ubiquitous. Levels are much higher in erythrocytes from patients with Hb SC and Hb SS compared to normal AA erythrocytes. This may contribute to red blood cell dehydration and to the manifestation of sickle cell disease by increasing the intracellular concentration of HbS. Isoform 1 was not detected in circulating reticulocytes.

Gene expression databases

BgeeiQ9UP95.
CleanExiHS_SLC12A4.
ExpressionAtlasiQ9UP95. baseline and differential.
GenevestigatoriQ9UP95.

Organism-specific databases

HPAiHPA041138.

Interactioni

Subunit structurei

Homomultimer and heteromultimer with other K-Cl cotransporters.1 Publication

Protein-protein interaction databases

BioGridi112449. 14 interactions.
IntActiQ9UP95. 1 interaction.
MINTiMINT-1191426.
STRINGi9606.ENSP00000318557.

Structurei

3D structure databases

ProteinModelPortaliQ9UP95.
SMRiQ9UP95. Positions 409-595.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 118118CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini170 – 21445CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini274 – 2752CytoplasmicSequence Analysis
Topological domaini377 – 40731CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini474 – 49320CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini588 – 62740CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini866 – 1085220CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei119 – 13921HelicalSequence AnalysisAdd
BLAST
Transmembranei149 – 16921HelicalSequence AnalysisAdd
BLAST
Transmembranei215 – 23521HelicalSequence AnalysisAdd
BLAST
Transmembranei253 – 27321HelicalSequence AnalysisAdd
BLAST
Transmembranei276 – 29621HelicalSequence AnalysisAdd
BLAST
Transmembranei356 – 37621HelicalSequence AnalysisAdd
BLAST
Transmembranei408 – 42821HelicalSequence AnalysisAdd
BLAST
Transmembranei453 – 47321HelicalSequence AnalysisAdd
BLAST
Transmembranei494 – 51421HelicalSequence AnalysisAdd
BLAST
Transmembranei567 – 58721HelicalSequence AnalysisAdd
BLAST
Transmembranei628 – 64821HelicalSequence AnalysisAdd
BLAST
Transmembranei845 – 86521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi160 – 1634Poly-Cys

Sequence similaritiesi

Belongs to the SLC12A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0531.
GeneTreeiENSGT00760000119053.
HOGENOMiHOG000092644.
HOVERGENiHBG052852.
InParanoidiQ9UP95.
KOiK14427.
OMAiERYNEGN.
OrthoDBiEOG78M01J.
PhylomeDBiQ9UP95.
TreeFamiTF313657.

Family and domain databases

InterProiIPR004841. AA-permease/SLC12A_dom.
IPR000622. K/Cl_cotranspt1.
IPR018491. K/Cl_cotranspt_1/3.
IPR000076. KCL_cotranspt.
IPR004842. Na/K/Cl_cotransptS.
[Graphical view]
PfamiPF00324. AA_permease. 2 hits.
PF03522. KCl_Cotrans_1. 1 hit.
[Graphical view]
PRINTSiPR01081. KCLTRNSPORT.
PR01082. KCLTRNSPORT1.
TIGRFAMsiTIGR00930. 2a30. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q9UP95-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPHFTVVPVD GPRRGDYDNL EGLSWVDYGE RAELDDSDGH GNHRESSPFL
60 70 80 90 100
SPLEASRGID YYDRNLALFE EELDIRPKVS SLLGKLVSYT NLTQGAKEHE
110 120 130 140 150
EAESGEGTRR RAAEAPSMGT LMGVYLPCLQ NIFGVILFLR LTWMVGTAGV
160 170 180 190 200
LQALLIVLIC CCCTLLTAIS MSAIATNGVV PAGGSYFMIS RSLGPEFGGA
210 220 230 240 250
VGLCFYLGTT FAAAMYILGA IEILLTYIAP PAAIFYPSGA HDTSNATLNN
260 270 280 290 300
MRVYGTIFLT FMTLVVFVGV KYVNKFASLF LACVIISILS IYAGGIKSIF
310 320 330 340 350
DPPVFPVCML GNRTLSRDQF DICAKTAVVD NETVATQLWS FFCHSPNLTT
360 370 380 390 400
DSCDPYFMLN NVTEIPGIPG AAAGVLQENL WSAYLEKGDI VEKHGLPSAD
410 420 430 440 450
APSLKESLPL YVVADIATSF TVLVGIFFPS VTGIMAGSNR SGDLRDAQKS
460 470 480 490 500
IPVGTILAII TTSLVYFSSV VLFGACIEGV VLRDKYGDGV SRNLVVGTLA
510 520 530 540 550
WPSPWVIVIG SFFSTCGAGL QSLTGAPRLL QAIAKDNIIP FLRVFGHGKV
560 570 580 590 600
NGEPTWALLL TALIAELGIL IASLDMVAPI LSMFFLMCYL FVNLACAVQT
610 620 630 640 650
LLRTPNWRPR FKYYHWALSF LGMSLCLALM FVSSWYYALV AMLIAGMIYK
660 670 680 690 700
YIEYQGAEKE WGDGIRGLSL SAARYALLRL EEGPPHTKNW RPQLLVLLKL
710 720 730 740 750
DEDLHVKYPR LLTFASQLKA GKGLTIVGSV IQGSFLESYG EAQAAEQTIK
760 770 780 790 800
NMMEIEKVKG FCQVVVASKV REGLAHLIQS CGLGGMRHNS VVLGWPYGWR
810 820 830 840 850
QSEDPRAWKT FIDTVRCTTA AHLALLVPKN IAFYPSNHER YLEGHIDVWW
860 870 880 890 900
IVHDGGMLML LPFLLRQHKV WRKCRMRIFT VAQMDDNSIQ MKKDLAVFLY
910 920 930 940 950
HLRLEAEVEV VEMHNSDISA YTYERTLMME QRSQMLRQMR LTKTEREREA
960 970 980 990 1000
QLVKDRHSAL RLESLYSDEE DESAVGADKI QMTWTRDKYM TETWDPSHAP
1010 1020 1030 1040 1050
DNFRELVHIK PDQSNVRRMH TAVKLNEVIV TRSHDARLVL LNMPGPPRNS
1060 1070 1080
EGDENYMEFL EVLTEGLERV LLVRGGGREV ITIYS
Length:1,085
Mass (Da):120,650
Last modified:December 13, 2002 - v2
Checksum:i42B590EC3D94EA4D
GO
Isoform 2 (identifier: Q9UP95-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1068: YMEFLEVLTEGLE → CIPLWRGRQLGGG
     1069-1085: Missing.

Show »
Length:1,068
Mass (Da):118,620
Checksum:i7A1FB4FD47252C88
GO
Isoform 3 (identifier: Q9UP95-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1012-1085: Missing.

Show »
Length:1,011
Mass (Da):112,275
Checksum:i33860CBEC1BE578B
GO
Isoform 4 (identifier: Q9UP95-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     749-955: Missing.
     956-958: RHS → PCA
     963-987: ESLYSDEEDESAVGADKIQMTWTRD → PTWPCSCPRTSPSTPATTSATWRAT
     988-1085: Missing.

Show »
Length:780
Mass (Da):84,701
Checksum:i63DD249B6CA8689C
GO
Isoform 5 (identifier: Q9UP95-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MGDTLSP

Note: No experimental confirmation available.

Show »
Length:1,054
Mass (Da):117,046
Checksum:i328721D9B50DF738
GO
Isoform 6 (identifier: Q9UP95-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MAAEGAVCGFVYLEGTAWAVPEDTEPLASCTL

Note: No experimental confirmation available.Curated

Show »
Length:1,079
Mass (Da):119,629
Checksum:iEC9A4E5C31C90A87
GO
Isoform 7 (identifier: Q9UP95-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MPHFTVVPVD...YYDRNLALFE → MRAGGACRPG...GSAPSWMTRT

Note: No experimental confirmation available.

Show »
Length:1,087
Mass (Da):119,745
Checksum:i701F57E7F5732CBD
GO

Sequence cautioni

The sequence AAC35282.1 differs from that shown. Reason: Frameshift at position 454.
The sequence BAG57330.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti42 – 421N → D in BAG61116. (PubMed:14702039)Curated
Sequence conflicti211 – 2111F → L in BAG63994. (PubMed:14702039)Curated
Sequence conflicti288 – 2881I → N in BAG63994. (PubMed:14702039)Curated
Sequence conflicti370 – 3701G → R in BAG57330. (PubMed:14702039)Curated
Sequence conflicti697 – 6971L → P in BAG63994. (PubMed:14702039)Curated
Sequence conflicti1016 – 10161V → A in BAG57330. (PubMed:14702039)Curated
Sequence conflicti1055 – 10551N → D in BAG57330. (PubMed:14702039)Curated
Isoform 6 (identifier: Q9UP95-6)
Sequence conflicti4 – 41E → G in BAH14786. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070MPHFT…LALFE → MRAGGACRPGAAGTAAGTAA GGWDGGCGGAEPARCLTSPW CQWTGRGAATMTTSRGSVGW TTGSAPSWMTRT in isoform 7. 1 PublicationVSP_046369Add
BLAST
Alternative sequencei1 – 3838MPHFT…LDDSD → MGDTLSP in isoform 5. 1 PublicationVSP_044596Add
BLAST
Alternative sequencei1 – 3838MPHFT…LDDSD → MAAEGAVCGFVYLEGTAWAV PEDTEPLASCTL in isoform 6. 1 PublicationVSP_046146Add
BLAST
Alternative sequencei749 – 955207Missing in isoform 4. 1 PublicationVSP_006108Add
BLAST
Alternative sequencei956 – 9583RHS → PCA in isoform 4. 1 PublicationVSP_006109
Alternative sequencei963 – 98725ESLYS…TWTRD → PTWPCSCPRTSPSTPATTSA TWRAT in isoform 4. 1 PublicationVSP_006110Add
BLAST
Alternative sequencei988 – 108598Missing in isoform 4. 1 PublicationVSP_006111Add
BLAST
Alternative sequencei1012 – 108574Missing in isoform 3. 1 PublicationVSP_006112Add
BLAST
Alternative sequencei1056 – 106813YMEFL…TEGLE → CIPLWRGRQLGGG in isoform 2. 1 PublicationVSP_006113Add
BLAST
Alternative sequencei1069 – 108517Missing in isoform 2. 1 PublicationVSP_006114Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U55054 mRNA. Translation: AAC50563.1.
AF047338 mRNA. Translation: AAC32815.1.
AF054505 mRNA. Translation: AAC39684.1.
AF054506 mRNA. Translation: AAC39685.1.
AK293956 mRNA. Translation: BAG57330.1. Different initiation.
AK299042 mRNA. Translation: BAG61116.1.
AK302790 mRNA. Translation: BAG63994.1.
AK316415 mRNA. Translation: BAH14786.1.
AC040162 Genomic DNA. No translation available.
BC021193 mRNA. Translation: AAH21193.1.
AF053402 mRNA. Translation: AAC35282.1. Frameshift.
AY026038 mRNA. Translation: AAK01946.1.
CCDSiCCDS10855.1. [Q9UP95-1]
CCDS54030.1. [Q9UP95-6]
CCDS54031.1. [Q9UP95-5]
CCDS54032.1. [Q9UP95-7]
RefSeqiNP_001139433.1. NM_001145961.1.
NP_001139434.1. NM_001145962.1. [Q9UP95-7]
NP_001139435.1. NM_001145963.1. [Q9UP95-6]
NP_001139436.1. NM_001145964.1. [Q9UP95-5]
NP_005063.1. NM_005072.4. [Q9UP95-1]
UniGeneiHs.10094.

Genome annotation databases

EnsembliENST00000316341; ENSP00000318557; ENSG00000124067. [Q9UP95-1]
ENST00000422611; ENSP00000395983; ENSG00000124067. [Q9UP95-7]
ENST00000537830; ENSP00000445962; ENSG00000124067. [Q9UP95-6]
ENST00000541864; ENSP00000438334; ENSG00000124067. [Q9UP95-5]
ENST00000576616; ENSP00000458902; ENSG00000124067. [Q9UP95-2]
GeneIDi6560.
KEGGihsa:6560.
UCSCiuc002euz.2. human. [Q9UP95-1]
uc002eva.2. human. [Q9UP95-2]

Polymorphism databases

DMDMi27151691.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U55054 mRNA. Translation: AAC50563.1 .
AF047338 mRNA. Translation: AAC32815.1 .
AF054505 mRNA. Translation: AAC39684.1 .
AF054506 mRNA. Translation: AAC39685.1 .
AK293956 mRNA. Translation: BAG57330.1 . Different initiation.
AK299042 mRNA. Translation: BAG61116.1 .
AK302790 mRNA. Translation: BAG63994.1 .
AK316415 mRNA. Translation: BAH14786.1 .
AC040162 Genomic DNA. No translation available.
BC021193 mRNA. Translation: AAH21193.1 .
AF053402 mRNA. Translation: AAC35282.1 . Frameshift.
AY026038 mRNA. Translation: AAK01946.1 .
CCDSi CCDS10855.1. [Q9UP95-1 ]
CCDS54030.1. [Q9UP95-6 ]
CCDS54031.1. [Q9UP95-5 ]
CCDS54032.1. [Q9UP95-7 ]
RefSeqi NP_001139433.1. NM_001145961.1.
NP_001139434.1. NM_001145962.1. [Q9UP95-7 ]
NP_001139435.1. NM_001145963.1. [Q9UP95-6 ]
NP_001139436.1. NM_001145964.1. [Q9UP95-5 ]
NP_005063.1. NM_005072.4. [Q9UP95-1 ]
UniGenei Hs.10094.

3D structure databases

ProteinModelPortali Q9UP95.
SMRi Q9UP95. Positions 409-595.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112449. 14 interactions.
IntActi Q9UP95. 1 interaction.
MINTi MINT-1191426.
STRINGi 9606.ENSP00000318557.

Chemistry

DrugBanki DB00887. Bumetanide.
DB00761. Potassium Chloride.
GuidetoPHARMACOLOGYi 971.

Protein family/group databases

TCDBi 2.A.30.5.5. the cation-chloride cotransporter (ccc) family.

PTM databases

PhosphoSitei Q9UP95.

Polymorphism databases

DMDMi 27151691.

Proteomic databases

MaxQBi Q9UP95.
PaxDbi Q9UP95.
PRIDEi Q9UP95.

Protocols and materials databases

DNASUi 6560.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000316341 ; ENSP00000318557 ; ENSG00000124067 . [Q9UP95-1 ]
ENST00000422611 ; ENSP00000395983 ; ENSG00000124067 . [Q9UP95-7 ]
ENST00000537830 ; ENSP00000445962 ; ENSG00000124067 . [Q9UP95-6 ]
ENST00000541864 ; ENSP00000438334 ; ENSG00000124067 . [Q9UP95-5 ]
ENST00000576616 ; ENSP00000458902 ; ENSG00000124067 . [Q9UP95-2 ]
GeneIDi 6560.
KEGGi hsa:6560.
UCSCi uc002euz.2. human. [Q9UP95-1 ]
uc002eva.2. human. [Q9UP95-2 ]

Organism-specific databases

CTDi 6560.
GeneCardsi GC16M067979.
HGNCi HGNC:10913. SLC12A4.
HPAi HPA041138.
MIMi 604119. gene.
neXtProti NX_Q9UP95.
PharmGKBi PA35807.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0531.
GeneTreei ENSGT00760000119053.
HOGENOMi HOG000092644.
HOVERGENi HBG052852.
InParanoidi Q9UP95.
KOi K14427.
OMAi ERYNEGN.
OrthoDBi EOG78M01J.
PhylomeDBi Q9UP95.
TreeFami TF313657.

Enzyme and pathway databases

Reactomei REACT_19315. Cation-coupled Chloride cotransporters.

Miscellaneous databases

GeneWikii Chloride_potassium_symporter_4.
GenomeRNAii 6560.
NextBioi 25527.
PROi Q9UP95.
SOURCEi Search...

Gene expression databases

Bgeei Q9UP95.
CleanExi HS_SLC12A4.
ExpressionAtlasi Q9UP95. baseline and differential.
Genevestigatori Q9UP95.

Family and domain databases

InterProi IPR004841. AA-permease/SLC12A_dom.
IPR000622. K/Cl_cotranspt1.
IPR018491. K/Cl_cotranspt_1/3.
IPR000076. KCL_cotranspt.
IPR004842. Na/K/Cl_cotransptS.
[Graphical view ]
Pfami PF00324. AA_permease. 2 hits.
PF03522. KCl_Cotrans_1. 1 hit.
[Graphical view ]
PRINTSi PR01081. KCLTRNSPORT.
PR01082. KCLTRNSPORT1.
TIGRFAMsi TIGR00930. 2a30. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and functional expression of the K-Cl cotransporter from rabbit, rat, and human. A new member of the cation-chloride cotransporter family."
    Gillen C.M., Brill S., Payne J.A., Forbush B. III
    J. Biol. Chem. 271:16237-16244(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Embryonic kidney.
  2. "Molecular identification and expression of erythroid K:Cl cotransporter in human and mouse erythroleukemic cells."
    Pellegrino C.M., Rybicki A.C., Musto S., Nagel R.L., Schwartz R.S.
    Blood Cells Mol. Dis. 24:31-40(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Erythroleukemia.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 25-1087 (ISOFORM 7).
    Tissue: Cerebellum and Testis.
  4. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  6. Golding S., Culliford S.J., Ellory J.C.
    Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 280-517.
    Tissue: Erythroleukemia.
  7. "A dominant negative mutant of the KCC1 K-Cl cotransporter: both N- and C-terminal cytoplasmic domains are required for K-Cl cotransport activity."
    Casula S., Shmukler B.E., Wilhelm S., Stuart-Tilley A.K., Su W., Chernova M.N., Brugnara C., Alper S.L.
    J. Biol. Chem. 276:41870-41878(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 684-1085 (ISOFORM 4), SUBUNIT.
  8. "Mouse K-Cl cotransporter KCC1: cloning, mapping, pathological expression, and functional regulation."
    Su W., Shmukler B.E., Chernova M.N., Stuart-Tilley A.K., de Franceschi L., Brugnara C., Alper S.L.
    Am. J. Physiol. 277:C899-C912(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: EXPRESSION IN ERYTHROCYTE MEMBRANES.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-51 AND SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: ENZYME REGULATION.
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiS12A4_HUMAN
AccessioniPrimary (citable) accession number: Q9UP95
Secondary accession number(s): B4DF69
, B4DR04, B4DZ82, B7ZAV0, F5H066, F5H0S9, F5H3C0, O60632, O75893, Q13953, Q96LD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: December 13, 2002
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3