Q9UP95 (S12A4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Solute carrier family 12 member 4 Alternative name(s): Electroneutral potassium-chloride cotransporter 1 Erythroid K-Cl cotransporter 1 Short name=hKCC1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1085 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl- exit in NaCl absorbing epithelia By similarity. Isoform 4 has no transport activity. |
| Enzyme regulation | Inhibited by WNK3. Ref.12 |
| Subunit structure | Homomultimer and heteromultimer with other K-Cl cotransporters. Ref.7 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Levels are much higher in erythrocytes from patients with Hb SC and Hb SS compared to normal AA erythrocytes. This may contribute to red blood cell dehydration and to the manifestation of sickle cell disease by increasing the intracellular concentration of HbS. Isoform 1 was not detected in circulating reticulocytes. |
| Post-translational modification | N-glycosylated. |
| Sequence similarities | Belongs to the SLC12A transporter family. |
| Sequence caution | The sequence AAC35282.1 differs from that shown. Reason: Frameshift at position 454. The sequence BAG57330.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Symport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell volume homeostasis Traceable author statement Ref.2. Source: ProtInc potassium ion transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | potassium:chloride symporter activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9UP95-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UP95-2) The sequence of this isoform differs from the canonical sequence as follows: 1056-1068: YMEFLEVLTEGLE → CIPLWRGRQLGGG 1069-1085: Missing. | ||||||
| Isoform 3 (identifier: Q9UP95-3) The sequence of this isoform differs from the canonical sequence as follows: 1012-1085: Missing. | ||||||
| Isoform 4 (identifier: Q9UP95-4) The sequence of this isoform differs from the canonical sequence as follows: 749-955: Missing. 956-958: RHS → PCA 963-987: ESLYSDEEDESAVGADKIQMTWTRD → PTWPCSCPRTSPSTPATTSATWRAT 988-1085: Missing. | ||||||
| Isoform 5 (identifier: Q9UP95-5) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MGDTLSP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9UP95-6) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MAAEGAVCGFVYLEGTAWAVPEDTEPLASCTL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q9UP95-7) The sequence of this isoform differs from the canonical sequence as follows: 1-70: MPHFTVVPVD...YYDRNLALFE → MRAGGACRPG...GSAPSWMTRT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1085 | 1085 | Solute carrier family 12 member 4 | PRO_0000178030 | |||||
Regions | |||||||||
| Topological domain | 1 – 118 | 118 | Cytoplasmic Potential | ||||||
| Transmembrane | 119 – 139 | 21 | Helical; Potential | ||||||
| Transmembrane | 149 – 169 | 21 | Helical; Potential | ||||||
| Topological domain | 170 – 214 | 45 | Cytoplasmic Potential | ||||||
| Transmembrane | 215 – 235 | 21 | Helical; Potential | ||||||
| Transmembrane | 253 – 273 | 21 | Helical; Potential | ||||||
| Topological domain | 274 – 275 | 2 | Cytoplasmic Potential | ||||||
| Transmembrane | 276 – 296 | 21 | Helical; Potential | ||||||
| Transmembrane | 356 – 376 | 21 | Helical; Potential | ||||||
| Topological domain | 377 – 407 | 31 | Cytoplasmic Potential | ||||||
| Transmembrane | 408 – 428 | 21 | Helical; Potential | ||||||
| Transmembrane | 453 – 473 | 21 | Helical; Potential | ||||||
| Topological domain | 474 – 493 | 20 | Cytoplasmic Potential | ||||||
| Transmembrane | 494 – 514 | 21 | Helical; Potential | ||||||
| Transmembrane | 567 – 587 | 21 | Helical; Potential | ||||||
| Topological domain | 588 – 627 | 40 | Cytoplasmic Potential | ||||||
| Transmembrane | 628 – 648 | 21 | Helical; Potential | ||||||
| Transmembrane | 845 – 865 | 21 | Helical; Potential | ||||||
| Topological domain | 866 – 1085 | 220 | Cytoplasmic Potential | ||||||
| Compositional bias | 160 – 163 | 4 | Poly-Cys | ||||||
Amino acid modifications | |||||||||
| Modified residue | 47 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 51 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 967 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 Ref.13 | ||||||
| Modified residue | 983 | 1 | Phosphothreonine By similarity | ||||||
| Glycosylation | 245 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 312 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 331 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 347 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 439 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 70 | 70 | MPHFT…LALFE → MRAGGACRPGAAGTAAGTAA GGWDGGCGGAEPARCLTSPW CQWTGRGAATMTTSRGSVGW TTGSAPSWMTRT in isoform 7. | VSP_046369 | |||||
| Alternative sequence | 1 – 38 | 38 | MPHFT…LDDSD → MGDTLSP in isoform 5. | VSP_044596 | |||||
| Alternative sequence | 1 – 38 | 38 | MPHFT…LDDSD → MAAEGAVCGFVYLEGTAWAV PEDTEPLASCTL in isoform 6. | VSP_046146 | |||||
| Alternative sequence | 749 – 955 | 207 | Missing in isoform 4. | VSP_006108 | |||||
| Alternative sequence | 956 – 958 | 3 | RHS → PCA in isoform 4. | VSP_006109 | |||||
| Alternative sequence | 963 – 987 | 25 | ESLYS…TWTRD → PTWPCSCPRTSPSTPATTSA TWRAT in isoform 4. | VSP_006110 | |||||
| Alternative sequence | 988 – 1085 | 98 | Missing in isoform 4. | VSP_006111 | |||||
| Alternative sequence | 1012 – 1085 | 74 | Missing in isoform 3. | VSP_006112 | |||||
| Alternative sequence | 1056 – 1068 | 13 | YMEFL…TEGLE → CIPLWRGRQLGGG in isoform 2. | VSP_006113 | |||||
| Alternative sequence | 1069 – 1085 | 17 | Missing in isoform 2. | VSP_006114 | |||||
Experimental info | |||||||||
| Sequence conflict | 42 | 1 | N → D in BAG61116. Ref.3 | ||||||
| Sequence conflict | 211 | 1 | F → L in BAG63994. Ref.3 | ||||||
| Sequence conflict | 288 | 1 | I → N in BAG63994. Ref.3 | ||||||
| Sequence conflict | 370 | 1 | G → R in BAG57330. Ref.3 | ||||||
| Sequence conflict | 697 | 1 | L → P in BAG63994. Ref.3 | ||||||
| Sequence conflict | 1016 | 1 | V → A in BAG57330. Ref.3 | ||||||
| Sequence conflict | 1055 | 1 | N → D in BAG57330. Ref.3 | ||||||
| Isoform 6: | |||||||||
| Sequence conflict | 4 | 1 | E → G in BAH14786. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and functional expression of the K-Cl cotransporter from rabbit, rat, and human. A new member of the cation-chloride cotransporter family." Gillen C.M., Brill S., Payne J.A., Forbush B. III J. Biol. Chem. 271:16237-16244(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Embryonic kidney. |
| [2] | "Molecular identification and expression of erythroid K:Cl cotransporter in human and mouse erythroleukemic cells." Pellegrino C.M., Rybicki A.C., Musto S., Nagel R.L., Schwartz R.S. Blood Cells Mol. Dis. 24:31-40(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Erythroleukemia. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 25-1087 (ISOFORM 7). Tissue: Cerebellum and Testis. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [6] | Golding S., Culliford S.J., Ellory J.C. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 280-517. Tissue: Erythroleukemia. |
| [7] | "A dominant negative mutant of the KCC1 K-Cl cotransporter: both N- and C-terminal cytoplasmic domains are required for K-Cl cotransport activity." Casula S., Shmukler B.E., Wilhelm S., Stuart-Tilley A.K., Su W., Chernova M.N., Brugnara C., Alper S.L. J. Biol. Chem. 276:41870-41878(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 684-1085 (ISOFORM 4), SUBUNIT. |
| [8] | "Mouse K-Cl cotransporter KCC1: cloning, mapping, pathological expression, and functional regulation." Su W., Shmukler B.E., Chernova M.N., Stuart-Tilley A.K., de Franceschi L., Brugnara C., Alper S.L. Am. J. Physiol. 277:C899-C912(1999) [PubMed] [Europe PMC] [Abstract] Cited for: EXPRESSION IN ERYTHROCYTE MEMBRANES. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-51 AND SER-967, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Similar Effects of all WNK3 Variants upon SLC12 Cotransporters." Cruz-Rangel S., Melo Z., Vazquez N., Meade P., Bobadilla N.A., Pasantes-Morales H., Gamba G., Mercado A. Am. J. Physiol. 301:C601-C608(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U55054 mRNA. Translation: AAC50563.1. AF047338 mRNA. Translation: AAC32815.1. AF054505 mRNA. Translation: AAC39684.1. AF054506 mRNA. Translation: AAC39685.1. AK293956 mRNA. Translation: BAG57330.1. Different initiation. AK299042 mRNA. Translation: BAG61116.1. AK302790 mRNA. Translation: BAG63994.1. AK316415 mRNA. Translation: BAH14786.1. AC040162 Genomic DNA. No translation available. BC021193 mRNA. Translation: AAH21193.1. AF053402 mRNA. Translation: AAC35282.1. Frameshift. AY026038 mRNA. Translation: AAK01946.1. |
| IPI | IPI00021057. IPI00215693. IPI00215694. IPI00215695. IPI00924945. IPI00927160. IPI00927273. |
| RefSeq | NP_001139433.1. NM_001145961.1. NP_001139434.1. NM_001145962.1. NP_001139435.1. NM_001145963.1. NP_001139436.1. NM_001145964.1. NP_005063.1. NM_005072.4. |
| UniGene | Hs.10094. |
3D structure databases | |
| ProteinModelPortal | Q9UP95. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1191426. |
| STRING | 9606.ENSP00000318557. |
PTM databases | |
| PhosphoSite | Q9UP95. |
Polymorphism databases | |
| DMDM | 27151691. |
Proteomic databases | |
| PaxDb | Q9UP95. |
| PRIDE | Q9UP95. |
Protocols and materials databases | |
| DNASU | 6560. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000316341; ENSP00000318557; ENSG00000124067. ENST00000338335; ENSP00000343374; ENSG00000124067. ENST00000422611; ENSP00000395983; ENSG00000124067. ENST00000537830; ENSP00000445962; ENSG00000124067. ENST00000541864; ENSP00000438334; ENSG00000124067. ENST00000576616; ENSP00000458902; ENSG00000124067. |
| GeneID | 6560. |
| KEGG | hsa:6560. |
| UCSC | uc002euz.2. human. uc002eva.2. human. |
Organism-specific databases | |
| CTD | 6560. |
| GeneCards | GC16M067979. |
| HGNC | HGNC:10913. SLC12A4. |
| HPA | HPA041138. |
| MIM | 604119. gene. |
| neXtProt | NX_Q9UP95. |
| PharmGKB | PA35807. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0531. |
| HOGENOM | HOG000092644. |
| HOVERGEN | HBG052852. |
| InParanoid | Q9UP95. |
| KO | K14427. |
| OrthoDB | EOG476JZG. |
| PhylomeDB | Q9UP95. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9UP95. |
| Bgee | Q9UP95. |
| CleanEx | HS_SLC12A4. |
| Genevestigator | Q9UP95. |
| GermOnline | ENSG00000124067. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004841. AA-permease_dom. IPR000622. K/Cl_cotranspt1. IPR018491. K/Cl_cotranspt_1/3. IPR000076. KCL_cotranspt. IPR004842. Na/K/Cl_cotransptS. [Graphical view] |
| Pfam | PF00324. AA_permease. 2 hits. PF03522. KCl_Cotrans_1. 1 hit. [Graphical view] |
| PRINTS | PR01081. KCLTRNSPORT. PR01082. KCLTRNSPORT1. |
| TIGRFAMs | TIGR00930. 2a30. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00887. Bumetanide. DB00761. Potassium Chloride. |
| GenomeRNAi | 6560. |
| NextBio | 25527. |
| SOURCE | Search... |
Entry information
| Entry name | S12A4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UP95 Secondary accession number(s): B4DF69 Q96LD5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
