Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UP95 (S12A4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 130. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Solute carrier family 12 member 4
Alternative name(s):
Electroneutral potassium-chloride cotransporter 1
Erythroid K-Cl cotransporter 1
Short name=hKCC1
Gene names
Name:SLC12A4
Synonyms:KCC1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1085 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl- exit in NaCl absorbing epithelia By similarity. Isoform 4 has no transport activity.

Enzyme regulation

Inhibited by WNK3. Ref.12

Subunit structure

Homomultimer and heteromultimer with other K-Cl cotransporters. Ref.7

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Ubiquitous. Levels are much higher in erythrocytes from patients with Hb SC and Hb SS compared to normal AA erythrocytes. This may contribute to red blood cell dehydration and to the manifestation of sickle cell disease by increasing the intracellular concentration of HbS. Isoform 1 was not detected in circulating reticulocytes.

Post-translational modification

N-glycosylated.

Sequence similarities

Belongs to the SLC12A transporter family.

Sequence caution

The sequence AAC35282.1 differs from that shown. Reason: Frameshift at position 454.

The sequence BAG57330.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9UP95-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UP95-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1068: YMEFLEVLTEGLE → CIPLWRGRQLGGG
     1069-1085: Missing.
Isoform 3 (identifier: Q9UP95-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1012-1085: Missing.
Isoform 4 (identifier: Q9UP95-4)

The sequence of this isoform differs from the canonical sequence as follows:
     749-955: Missing.
     956-958: RHS → PCA
     963-987: ESLYSDEEDESAVGADKIQMTWTRD → PTWPCSCPRTSPSTPATTSATWRAT
     988-1085: Missing.
Isoform 5 (identifier: Q9UP95-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MGDTLSP
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9UP95-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSD → MAAEGAVCGFVYLEGTAWAVPEDTEPLASCTL
Note: No experimental confirmation available.
Isoform 7 (identifier: Q9UP95-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MPHFTVVPVD...YYDRNLALFE → MRAGGACRPG...GSAPSWMTRT
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10851085Solute carrier family 12 member 4
PRO_0000178030

Regions

Topological domain1 – 118118Cytoplasmic Potential
Transmembrane119 – 13921Helical; Potential
Transmembrane149 – 16921Helical; Potential
Topological domain170 – 21445Cytoplasmic Potential
Transmembrane215 – 23521Helical; Potential
Transmembrane253 – 27321Helical; Potential
Topological domain274 – 2752Cytoplasmic Potential
Transmembrane276 – 29621Helical; Potential
Transmembrane356 – 37621Helical; Potential
Topological domain377 – 40731Cytoplasmic Potential
Transmembrane408 – 42821Helical; Potential
Transmembrane453 – 47321Helical; Potential
Topological domain474 – 49320Cytoplasmic Potential
Transmembrane494 – 51421Helical; Potential
Transmembrane567 – 58721Helical; Potential
Topological domain588 – 62740Cytoplasmic Potential
Transmembrane628 – 64821Helical; Potential
Transmembrane845 – 86521Helical; Potential
Topological domain866 – 1085220Cytoplasmic Potential
Compositional bias160 – 1634Poly-Cys

Amino acid modifications

Modified residue471Phosphoserine By similarity
Modified residue511Phosphoserine Ref.9
Modified residue9671Phosphoserine Ref.9 Ref.10 Ref.11 Ref.13
Glycosylation2451N-linked (GlcNAc...) Potential
Glycosylation3121N-linked (GlcNAc...) Potential
Glycosylation3311N-linked (GlcNAc...) Potential
Glycosylation3471N-linked (GlcNAc...) Potential
Glycosylation4391N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 7070MPHFT…LALFE → MRAGGACRPGAAGTAAGTAA GGWDGGCGGAEPARCLTSPW CQWTGRGAATMTTSRGSVGW TTGSAPSWMTRT in isoform 7.
VSP_046369
Alternative sequence1 – 3838MPHFT…LDDSD → MGDTLSP in isoform 5.
VSP_044596
Alternative sequence1 – 3838MPHFT…LDDSD → MAAEGAVCGFVYLEGTAWAV PEDTEPLASCTL in isoform 6.
VSP_046146
Alternative sequence749 – 955207Missing in isoform 4.
VSP_006108
Alternative sequence956 – 9583RHS → PCA in isoform 4.
VSP_006109
Alternative sequence963 – 98725ESLYS…TWTRD → PTWPCSCPRTSPSTPATTSA TWRAT in isoform 4.
VSP_006110
Alternative sequence988 – 108598Missing in isoform 4.
VSP_006111
Alternative sequence1012 – 108574Missing in isoform 3.
VSP_006112
Alternative sequence1056 – 106813YMEFL…TEGLE → CIPLWRGRQLGGG in isoform 2.
VSP_006113
Alternative sequence1069 – 108517Missing in isoform 2.
VSP_006114

Experimental info

Sequence conflict421N → D in BAG61116. Ref.3
Sequence conflict2111F → L in BAG63994. Ref.3
Sequence conflict2881I → N in BAG63994. Ref.3
Sequence conflict3701G → R in BAG57330. Ref.3
Sequence conflict6971L → P in BAG63994. Ref.3
Sequence conflict10161V → A in BAG57330. Ref.3
Sequence conflict10551N → D in BAG57330. Ref.3
Isoform 6:
Sequence conflict41E → G in BAH14786. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 13, 2002. Version 2.
Checksum: 42B590EC3D94EA4D

FASTA1,085120,650
        10         20         30         40         50         60 
MPHFTVVPVD GPRRGDYDNL EGLSWVDYGE RAELDDSDGH GNHRESSPFL SPLEASRGID 

        70         80         90        100        110        120 
YYDRNLALFE EELDIRPKVS SLLGKLVSYT NLTQGAKEHE EAESGEGTRR RAAEAPSMGT 

       130        140        150        160        170        180 
LMGVYLPCLQ NIFGVILFLR LTWMVGTAGV LQALLIVLIC CCCTLLTAIS MSAIATNGVV 

       190        200        210        220        230        240 
PAGGSYFMIS RSLGPEFGGA VGLCFYLGTT FAAAMYILGA IEILLTYIAP PAAIFYPSGA 

       250        260        270        280        290        300 
HDTSNATLNN MRVYGTIFLT FMTLVVFVGV KYVNKFASLF LACVIISILS IYAGGIKSIF 

       310        320        330        340        350        360 
DPPVFPVCML GNRTLSRDQF DICAKTAVVD NETVATQLWS FFCHSPNLTT DSCDPYFMLN 

       370        380        390        400        410        420 
NVTEIPGIPG AAAGVLQENL WSAYLEKGDI VEKHGLPSAD APSLKESLPL YVVADIATSF 

       430        440        450        460        470        480 
TVLVGIFFPS VTGIMAGSNR SGDLRDAQKS IPVGTILAII TTSLVYFSSV VLFGACIEGV 

       490        500        510        520        530        540 
VLRDKYGDGV SRNLVVGTLA WPSPWVIVIG SFFSTCGAGL QSLTGAPRLL QAIAKDNIIP 

       550        560        570        580        590        600 
FLRVFGHGKV NGEPTWALLL TALIAELGIL IASLDMVAPI LSMFFLMCYL FVNLACAVQT 

       610        620        630        640        650        660 
LLRTPNWRPR FKYYHWALSF LGMSLCLALM FVSSWYYALV AMLIAGMIYK YIEYQGAEKE 

       670        680        690        700        710        720 
WGDGIRGLSL SAARYALLRL EEGPPHTKNW RPQLLVLLKL DEDLHVKYPR LLTFASQLKA 

       730        740        750        760        770        780 
GKGLTIVGSV IQGSFLESYG EAQAAEQTIK NMMEIEKVKG FCQVVVASKV REGLAHLIQS 

       790        800        810        820        830        840 
CGLGGMRHNS VVLGWPYGWR QSEDPRAWKT FIDTVRCTTA AHLALLVPKN IAFYPSNHER 

       850        860        870        880        890        900 
YLEGHIDVWW IVHDGGMLML LPFLLRQHKV WRKCRMRIFT VAQMDDNSIQ MKKDLAVFLY 

       910        920        930        940        950        960 
HLRLEAEVEV VEMHNSDISA YTYERTLMME QRSQMLRQMR LTKTEREREA QLVKDRHSAL 

       970        980        990       1000       1010       1020 
RLESLYSDEE DESAVGADKI QMTWTRDKYM TETWDPSHAP DNFRELVHIK PDQSNVRRMH 

      1030       1040       1050       1060       1070       1080 
TAVKLNEVIV TRSHDARLVL LNMPGPPRNS EGDENYMEFL EVLTEGLERV LLVRGGGREV 


ITIYS 

« Hide

Isoform 2 [UniParc].

Checksum: 7A1FB4FD47252C88
Show »

FASTA1,068118,620
Isoform 3 [UniParc].

Checksum: 33860CBEC1BE578B
Show »

FASTA1,011112,275
Isoform 4 [UniParc].

Checksum: 63DD249B6CA8689C
Show »

FASTA78084,701
Isoform 5 [UniParc].

Checksum: 328721D9B50DF738
Show »

FASTA1,054117,046
Isoform 6 [UniParc].

Checksum: EC9A4E5C31C90A87
Show »

FASTA1,079119,629
Isoform 7 [UniParc].

Checksum: 701F57E7F5732CBD
Show »

FASTA1,087119,745

References

« Hide 'large scale' references
[1]"Molecular cloning and functional expression of the K-Cl cotransporter from rabbit, rat, and human. A new member of the cation-chloride cotransporter family."
Gillen C.M., Brill S., Payne J.A., Forbush B. III
J. Biol. Chem. 271:16237-16244(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Embryonic kidney.
[2]"Molecular identification and expression of erythroid K:Cl cotransporter in human and mouse erythroleukemic cells."
Pellegrino C.M., Rybicki A.C., Musto S., Nagel R.L., Schwartz R.S.
Blood Cells Mol. Dis. 24:31-40(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Erythroleukemia.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 25-1087 (ISOFORM 7).
Tissue: Cerebellum and Testis.
[4]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Eye.
[6]Golding S., Culliford S.J., Ellory J.C.
Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 280-517.
Tissue: Erythroleukemia.
[7]"A dominant negative mutant of the KCC1 K-Cl cotransporter: both N- and C-terminal cytoplasmic domains are required for K-Cl cotransport activity."
Casula S., Shmukler B.E., Wilhelm S., Stuart-Tilley A.K., Su W., Chernova M.N., Brugnara C., Alper S.L.
J. Biol. Chem. 276:41870-41878(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 684-1085 (ISOFORM 4), SUBUNIT.
[8]"Mouse K-Cl cotransporter KCC1: cloning, mapping, pathological expression, and functional regulation."
Su W., Shmukler B.E., Chernova M.N., Stuart-Tilley A.K., de Franceschi L., Brugnara C., Alper S.L.
Am. J. Physiol. 277:C899-C912(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: EXPRESSION IN ERYTHROCYTE MEMBRANES.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-51 AND SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[11]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Similar Effects of all WNK3 Variants upon SLC12 Cotransporters."
Cruz-Rangel S., Melo Z., Vazquez N., Meade P., Bobadilla N.A., Pasantes-Morales H., Gamba G., Mercado A.
Am. J. Physiol. 301:C601-C608(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: ENZYME REGULATION.
[13]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-967, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U55054 mRNA. Translation: AAC50563.1.
AF047338 mRNA. Translation: AAC32815.1.
AF054505 mRNA. Translation: AAC39684.1.
AF054506 mRNA. Translation: AAC39685.1.
AK293956 mRNA. Translation: BAG57330.1. Different initiation.
AK299042 mRNA. Translation: BAG61116.1.
AK302790 mRNA. Translation: BAG63994.1.
AK316415 mRNA. Translation: BAH14786.1.
AC040162 Genomic DNA. No translation available.
BC021193 mRNA. Translation: AAH21193.1.
AF053402 mRNA. Translation: AAC35282.1. Frameshift.
AY026038 mRNA. Translation: AAK01946.1.
CCDSCCDS10855.1. [Q9UP95-1]
CCDS54030.1. [Q9UP95-6]
CCDS54031.1. [Q9UP95-5]
CCDS54032.1. [Q9UP95-7]
RefSeqNP_001139433.1. NM_001145961.1.
NP_001139434.1. NM_001145962.1. [Q9UP95-7]
NP_001139435.1. NM_001145963.1. [Q9UP95-6]
NP_001139436.1. NM_001145964.1. [Q9UP95-5]
NP_005063.1. NM_005072.4. [Q9UP95-1]
UniGeneHs.10094.

3D structure databases

ProteinModelPortalQ9UP95.
SMRQ9UP95. Positions 409-595.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112449. 7 interactions.
IntActQ9UP95. 1 interaction.
MINTMINT-1191426.
STRING9606.ENSP00000318557.

Chemistry

DrugBankDB00887. Bumetanide.
DB00761. Potassium Chloride.
GuidetoPHARMACOLOGY971.

Protein family/group databases

TCDB2.A.30.5.5. the cation-chloride cotransporter (ccc) family.

PTM databases

PhosphoSiteQ9UP95.

Polymorphism databases

DMDM27151691.

Proteomic databases

MaxQBQ9UP95.
PaxDbQ9UP95.
PRIDEQ9UP95.

Protocols and materials databases

DNASU6560.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000316341; ENSP00000318557; ENSG00000124067. [Q9UP95-1]
ENST00000338335; ENSP00000343374; ENSG00000124067. [Q9UP95-4]
ENST00000422611; ENSP00000395983; ENSG00000124067. [Q9UP95-7]
ENST00000537830; ENSP00000445962; ENSG00000124067. [Q9UP95-6]
ENST00000541864; ENSP00000438334; ENSG00000124067. [Q9UP95-5]
ENST00000576616; ENSP00000458902; ENSG00000124067. [Q9UP95-2]
GeneID6560.
KEGGhsa:6560.
UCSCuc002euz.2. human. [Q9UP95-1]
uc002eva.2. human. [Q9UP95-2]

Organism-specific databases

CTD6560.
GeneCardsGC16M067979.
HGNCHGNC:10913. SLC12A4.
HPAHPA041138.
MIM604119. gene.
neXtProtNX_Q9UP95.
PharmGKBPA35807.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0531.
HOGENOMHOG000092644.
HOVERGENHBG052852.
InParanoidQ9UP95.
KOK14427.
OMAERYNEGN.
OrthoDBEOG78M01J.
PhylomeDBQ9UP95.
TreeFamTF313657.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ9UP95.
BgeeQ9UP95.
CleanExHS_SLC12A4.
GenevestigatorQ9UP95.

Family and domain databases

InterProIPR004841. AA-permease/SLC12A_dom.
IPR000622. K/Cl_cotranspt1.
IPR018491. K/Cl_cotranspt_1/3.
IPR000076. KCL_cotranspt.
IPR004842. Na/K/Cl_cotransptS.
[Graphical view]
PfamPF00324. AA_permease. 2 hits.
PF03522. KCl_Cotrans_1. 1 hit.
[Graphical view]
PRINTSPR01081. KCLTRNSPORT.
PR01082. KCLTRNSPORT1.
TIGRFAMsTIGR00930. 2a30. 1 hit.
ProtoNetSearch...

Other

GeneWikiChloride_potassium_symporter_4.
GenomeRNAi6560.
NextBio25527.
PROQ9UP95.
SOURCESearch...

Entry information

Entry nameS12A4_HUMAN
AccessionPrimary (citable) accession number: Q9UP95
Secondary accession number(s): B4DF69 expand/collapse secondary AC list , B4DR04, B4DZ82, B7ZAV0, F5H066, F5H0S9, F5H3C0, O60632, O75893, Q13953, Q96LD5
Entry history
Integrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: December 13, 2002
Last modified: July 9, 2014
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM