SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UNW1

- MINP1_HUMAN

UniProt

Q9UNW1 - MINP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Multiple inositol polyphosphate phosphatase 1
Gene
MINPP1, MIPP, UNQ900/PRO1917
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification).1 Publication

Catalytic activityi

Myo-inositol hexakisphosphate + H2O = myo-inositol pentakisphosphate (mixed isomers) + phosphate.1 Publication
2,3-bisphospho-D-glycerate + H2O = 2-phospho-D-glycerate + phosphate.1 Publication

Kineticsi

  1. KM=0.61 mM for 2,3-bisphosphoglycerate1 Publication

Vmax=15.8 nmol/min/mg enzyme with 2,3-bisphospho-D-glycerate as substrate

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei89 – 891 Reviewed prediction

GO - Molecular functioni

  1. acid phosphatase activity Source: InterPro
  2. bisphosphoglycerate 3-phosphatase activity Source: BHF-UCL
  3. inositol hexakisphosphate 2-phosphatase activity Source: UniProtKB-EC
  4. phosphohistidine phosphatase activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. bone mineralization Source: UniProtKB
  2. dephosphorylation Source: GOC
  3. inositol phosphate metabolic process Source: Reactome
  4. ossification Source: UniProtKB
  5. polyphosphate metabolic process Source: ProtInc
  6. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BioCyciMetaCyc:HS03025-MONOMER.
BRENDAi3.1.3.62. 2681.
ReactomeiREACT_150253. Synthesis of IPs in the ER lumen.
SABIO-RKQ9UNW1.

Names & Taxonomyi

Protein namesi
Recommended name:
Multiple inositol polyphosphate phosphatase 1 (EC:3.1.3.62)
Alternative name(s):
2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80)
Short name:
2,3-BPG phosphatase
Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
Short name:
Ins(1,3,4,5)P(4) 3-phosphatase
Gene namesi
Name:MINPP1
Synonyms:MIPP
ORF Names:UNQ900/PRO1917
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:7102. MINPP1.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum Source: ProtInc
  2. endoplasmic reticulum lumen Source: Reactome
  3. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Involvement in diseasei

Defects in MINPP1 may be involved in follicular thyroid tumors development.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi89 – 891H → A: Strong reduction of 2,3-bisphosphoglycerate 3-phosphatase activity. 1 Publication
Mutagenesisi370 – 3701H → A: Greatly diminishes phosphatase activity. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

PharmGKBiPA30820.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 By similarity
Add
BLAST
Chaini31 – 487457Multiple inositol polyphosphate phosphatase 1
PRO_0000019582Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi242 – 2421N-linked (GlcNAc...)1 Publication
Glycosylationi481 – 4811N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9UNW1.
PaxDbiQ9UNW1.
PeptideAtlasiQ9UNW1.
PRIDEiQ9UNW1.

PTM databases

PhosphoSiteiQ9UNW1.

Expressioni

Tissue specificityi

Widely expressed with highest levels in kidney, liver and placenta.1 Publication

Gene expression databases

ArrayExpressiQ9UNW1.
BgeeiQ9UNW1.
CleanExiHS_MINPP1.
GenevestigatoriQ9UNW1.

Organism-specific databases

HPAiHPA026859.

Interactioni

Protein-protein interaction databases

BioGridi114932. 1 interaction.
STRINGi9606.ENSP00000361064.

Structurei

3D structure databases

ProteinModelPortaliQ9UNW1.
SMRiQ9UNW1. Positions 79-455.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi484 – 4874Prevents secretion from ER Reviewed prediction

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG260296.
HOGENOMiHOG000113591.
HOVERGENiHBG052872.
InParanoidiQ9UNW1.
KOiK03103.
OMAiADMEFGP.
OrthoDBiEOG7992QC.
PhylomeDBiQ9UNW1.
TreeFamiTF324072.

Family and domain databases

Gene3Di3.40.50.1240. 1 hit.
InterProiIPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
IPR016274. Histidine_acid_Pase_euk.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
PIRSFiPIRSF000894. Acid_phosphatase. 1 hit.
SUPFAMiSSF53254. SSF53254. 1 hit.
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UNW1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLRAPGCLLR TSVAPAAALA AALLSSLARC SLLEPRDPVA SSLSPYFGTK    50
TRYEDVNPVL LSGPEAPWRD PELLEGTCTP VQLVALIRHG TRYPTVKQIR 100
KLRQLHGLLQ ARGSRDGGAS STGSRDLGAA LADWPLWYAD WMDGQLVEKG 150
RQDMRQLALR LASLFPALFS RENYGRLRLI TSSKHRCMDS SAAFLQGLWQ 200
HYHPGLPPPD VADMEFGPPT VNDKLMRFFD HCEKFLTEVE KNATALYHVE 250
AFKTGPEMQN ILKKVAATLQ VPVNDLNADL IQVAFFTCSF DLAIKGVKSP 300
WCDVFDIDDA KVLEYLNDLK QYWKRGYGYT INSRSSCTLF QDIFQHLDKA 350
VEQKQRSQPI SSPVILQFGH AETLLPLLSL MGYFKDKEPL TAYNYKKQMH 400
RKFRSGLIVP YASNLIFVLY HCENAKTPKE QFRVQMLLNE KVLPLAYSQE 450
TVSFYEDLKN HYKDILQSCQ TSEECELARA NSTSDEL 487
Length:487
Mass (Da):55,051
Last modified:May 1, 2000 - v1
Checksum:i89B8F347885B320A
GO
Isoform 2 (identifier: Q9UNW1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: DLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKV → GLSQFLLQSSSSLVMQRLFFHCFLSWATSKTRNP
     313-487: Missing.

Note: No experimental confirmation available.

Show »
Length:312
Mass (Da):34,661
Checksum:iDC950F3E7144F13B
GO
Isoform 3 (identifier: Q9UNW1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-284: DLIQVA → GIRIFK
     285-487: Missing.

Note: No experimental confirmation available.

Show »
Length:284
Mass (Da):31,475
Checksum:i0F4BC3ED1B4BFF67
GO
Isoform 4 (identifier: Q9UNW1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-213: MLRAPGCLLR...PGLPPPDVAD → MCLFQLCGLVRY

Note: No experimental confirmation available.

Show »
Length:286
Mass (Da):33,100
Checksum:iB48950FD3549CEEB
GO

Sequence cautioni

The sequence BAD93056.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti41 – 411S → L in a follicular thyroid carcinoma; somatic mutation. 1 Publication
VAR_022836
Natural varianti270 – 2701Q → R in a follicular thyroid adenoma. 1 Publication
VAR_022837

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 213213MLRAP…PDVAD → MCLFQLCGLVRY in isoform 4.
VSP_044569Add
BLAST
Alternative sequencei279 – 31234DLIQV…DDAKV → GLSQFLLQSSSSLVMQRLFF HCFLSWATSKTRNP in isoform 2.
VSP_014552Add
BLAST
Alternative sequencei279 – 2846DLIQVA → GIRIFK in isoform 3.
VSP_014553
Alternative sequencei285 – 487203Missing in isoform 3.
VSP_014554Add
BLAST
Alternative sequencei313 – 487175Missing in isoform 2.
VSP_014555Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti81 – 811V → A in CAB43673. 1 Publication
Sequence conflicti111 – 1111A → P in AAD02437. 1 Publication
Sequence conflicti132 – 1321A → R in AAD02437. 1 Publication
Sequence conflicti156 – 1572QL → HV in AAD02437. 1 Publication
Sequence conflicti344 – 3441F → S in CAB43673. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF084943 mRNA. Translation: AAD09751.1.
AF084944 mRNA. Translation: AAD09752.1.
AF046914 mRNA. Translation: AAD02437.1.
AL050356 mRNA. Translation: CAB43673.1.
AY358938 mRNA. Translation: AAQ89297.1.
AK309176 mRNA. No translation available.
AB209819 mRNA. Translation: BAD93056.1. Different initiation.
AL355334, AL138767 Genomic DNA. Translation: CAH73423.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16030.1.
AL355334, AL138767 Genomic DNA. Translation: CAH73422.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16029.1.
BC032504 mRNA. Translation: AAH32504.1.
CCDSiCCDS53551.1. [Q9UNW1-2]
CCDS53552.1. [Q9UNW1-4]
CCDS7384.1. [Q9UNW1-1]
RefSeqiNP_001171588.1. NM_001178117.1. [Q9UNW1-2]
NP_001171589.1. NM_001178118.1. [Q9UNW1-4]
NP_004888.2. NM_004897.4. [Q9UNW1-1]
UniGeneiHs.121260.

Genome annotation databases

EnsembliENST00000371994; ENSP00000361062; ENSG00000107789. [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789. [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789. [Q9UNW1-4]
GeneIDi9562.
KEGGihsa:9562.
UCSCiuc001keu.3. human. [Q9UNW1-1]
uc001kev.3. human. [Q9UNW1-2]

Polymorphism databases

DMDMi68565617.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF084943 mRNA. Translation: AAD09751.1 .
AF084944 mRNA. Translation: AAD09752.1 .
AF046914 mRNA. Translation: AAD02437.1 .
AL050356 mRNA. Translation: CAB43673.1 .
AY358938 mRNA. Translation: AAQ89297.1 .
AK309176 mRNA. No translation available.
AB209819 mRNA. Translation: BAD93056.1 . Different initiation.
AL355334 , AL138767 Genomic DNA. Translation: CAH73423.1 .
AL138767 , AL355334 Genomic DNA. Translation: CAI16030.1 .
AL355334 , AL138767 Genomic DNA. Translation: CAH73422.1 .
AL138767 , AL355334 Genomic DNA. Translation: CAI16029.1 .
BC032504 mRNA. Translation: AAH32504.1 .
CCDSi CCDS53551.1. [Q9UNW1-2 ]
CCDS53552.1. [Q9UNW1-4 ]
CCDS7384.1. [Q9UNW1-1 ]
RefSeqi NP_001171588.1. NM_001178117.1. [Q9UNW1-2 ]
NP_001171589.1. NM_001178118.1. [Q9UNW1-4 ]
NP_004888.2. NM_004897.4. [Q9UNW1-1 ]
UniGenei Hs.121260.

3D structure databases

ProteinModelPortali Q9UNW1.
SMRi Q9UNW1. Positions 79-455.
ModBasei Search...

Protein-protein interaction databases

BioGridi 114932. 1 interaction.
STRINGi 9606.ENSP00000361064.

PTM databases

PhosphoSitei Q9UNW1.

Polymorphism databases

DMDMi 68565617.

Proteomic databases

MaxQBi Q9UNW1.
PaxDbi Q9UNW1.
PeptideAtlasi Q9UNW1.
PRIDEi Q9UNW1.

Protocols and materials databases

DNASUi 9562.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000371994 ; ENSP00000361062 ; ENSG00000107789 . [Q9UNW1-2 ]
ENST00000371996 ; ENSP00000361064 ; ENSG00000107789 . [Q9UNW1-1 ]
ENST00000536010 ; ENSP00000437823 ; ENSG00000107789 . [Q9UNW1-4 ]
GeneIDi 9562.
KEGGi hsa:9562.
UCSCi uc001keu.3. human. [Q9UNW1-1 ]
uc001kev.3. human. [Q9UNW1-2 ]

Organism-specific databases

CTDi 9562.
GeneCardsi GC10P089264.
HGNCi HGNC:7102. MINPP1.
HPAi HPA026859.
MIMi 605391. gene.
neXtProti NX_Q9UNW1.
PharmGKBi PA30820.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG260296.
HOGENOMi HOG000113591.
HOVERGENi HBG052872.
InParanoidi Q9UNW1.
KOi K03103.
OMAi ADMEFGP.
OrthoDBi EOG7992QC.
PhylomeDBi Q9UNW1.
TreeFami TF324072.

Enzyme and pathway databases

BioCyci MetaCyc:HS03025-MONOMER.
BRENDAi 3.1.3.62. 2681.
Reactomei REACT_150253. Synthesis of IPs in the ER lumen.
SABIO-RK Q9UNW1.

Miscellaneous databases

ChiTaRSi MINPP1. human.
GeneWikii MINPP1.
GenomeRNAii 9562.
NextBioi 35863.
PROi Q9UNW1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UNW1.
Bgeei Q9UNW1.
CleanExi HS_MINPP1.
Genevestigatori Q9UNW1.

Family and domain databases

Gene3Di 3.40.50.1240. 1 hit.
InterProi IPR000560. His_Pase_superF_clade-2.
IPR029033. His_PPase_superfam.
IPR016274. Histidine_acid_Pase_euk.
[Graphical view ]
Pfami PF00328. His_Phos_2. 1 hit.
[Graphical view ]
PIRSFi PIRSF000894. Acid_phosphatase. 1 hit.
SUPFAMi SSF53254. SSF53254. 1 hit.
PROSITEi PS00014. ER_TARGET. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The human and rat forms of multiple inositol polyphosphate phosphatase: functional homology with a histidine acid phosphatase up-regulated during endochondral ossification."
    Caffrey J.J., Hidaka K., Matsuda M., Hirata M., Shears S.B.
    FEBS Lett. 442:99-104(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, MUTAGENESIS OF HIS-370.
  2. "Multiple inositol polyphosphate phosphatase: evolution as a distinct group within the histidine phosphatase family and chromosomal localization of the human and mouse genes to chromosomes 10q23 and 19."
    Chi H., Tiller G.E., Dasouki M.J., Romano P.R., Wang J., O'keefe R.J., Puzas J.E., Rosier R.N., Reynolds P.R.
    Genomics 56:324-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Thalamus.
  6. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  7. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  9. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-242.
    Tissue: Plasma.
  10. "Dephosphorylation of 2,3-bisphosphoglycerate by MIPP expands the regulatory capacity of the Rapoport-Luebering glycolytic shunt."
    Cho J., King J.S., Qian X., Harwood A.J., Shears S.B.
    Proc. Natl. Acad. Sci. U.S.A. 105:5998-6003(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS 2,3-BISPHOSPHOGLYCERATE 3-PHOSPHATASE, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF HIS-89.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Somatic mutation and germline variants of MINPP1, a phosphatase gene located in proximity to PTEN on 10q23.3, in follicular thyroid carcinomas."
    Gimm O., Chi H., Dahia P.L., Perren A., Hinze R., Komminoth P., Dralle H., Reynolds P.R., Eng C.
    J. Clin. Endocrinol. Metab. 86:1801-1805(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT FOLLICULAR THYROID CARCINOMA LEU-41, VARIANT FOLLICULAR THYROID ADENOMA ARG-270.

Entry informationi

Entry nameiMINP1_HUMAN
AccessioniPrimary (citable) accession number: Q9UNW1
Secondary accession number(s): F5H683
, O95172, O95286, Q59EJ2, Q9UGA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: May 1, 2000
Last modified: September 3, 2014
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi