Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Multiple inositol polyphosphate phosphatase 1

Gene

MINPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity).By similarity1 Publication

Catalytic activityi

Myo-inositol hexakisphosphate + H2O = myo-inositol pentakisphosphate (mixed isomers) + phosphate.1 Publication
2,3-bisphospho-D-glycerate + H2O = 2-phospho-D-glycerate + phosphate.1 Publication

Kineticsi

  1. KM=0.61 mM for 2,3-bisphosphoglycerate1 Publication
  2. KM=90 µM for inositol hexakisphosphate1 Publication
  1. Vmax=15.8 nmol/min/mg enzyme with 2,3-bisphospho-D-glycerate as substrate1 Publication
  2. Vmax=6.2 nmol/min/mg enzyme with inositol hexakisphosphate as substrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei89By similarity1

GO - Molecular functioni

GO - Biological processi

  • bone mineralization Source: UniProtKB
  • inositol phosphate metabolic process Source: Reactome
  • ossification Source: UniProtKB
  • polyphosphate metabolic process Source: ProtInc

Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

BioCyciMetaCyc:HS03025-MONOMER
BRENDAi3.1.3.62 2681
ReactomeiR-HSA-1855231 Synthesis of IPs in the ER lumen
SABIO-RKQ9UNW1

Names & Taxonomyi

Protein namesi
Recommended name:
Multiple inositol polyphosphate phosphatase 1Imported (EC:3.1.3.621 Publication)
Alternative name(s):
2,3-bisphosphoglycerate 3-phosphatase1 Publication (EC:3.1.3.801 Publication)
Short name:
2,3-BPG phosphatase1 Publication
Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
Short name:
Ins(1,3,4,5)P(4) 3-phosphatase
Gene namesi
Name:MINPP1
Synonyms:MIPP
ORF Names:UNQ900/PRO1917
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000107789.15
HGNCiHGNC:7102 MINPP1
MIMi605391 gene
neXtProtiNX_Q9UNW1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Involvement in diseasei

Thyroid cancer, non-medullary, 2 (NMTC2)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA form of non-medullary thyroid cancer (NMTC), a cancer characterized by tumors originating from the thyroid follicular cells. NMTCs represent approximately 95% of all cases of thyroid cancer and are classified into papillary, follicular, Hurthle cell, and anaplastic neoplasms.
See also OMIM:188470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs119486096EnsemblClinVar.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant dbSNP:rs104894171EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi89H → A: Strong reduction of 2,3-bisphosphoglycerate 3-phosphatase activity. 1 Publication1
Mutagenesisi370H → A: Greatly diminishes phosphatase activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi9562
MalaCardsiMINPP1
MIMi188470 phenotype
OpenTargetsiENSG00000107789
PharmGKBiPA30820

Polymorphism and mutation databases

BioMutaiMINPP1
DMDMi68565617

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30By similarityAdd BLAST30
ChainiPRO_000001958231 – 487Multiple inositol polyphosphate phosphatase 1Add BLAST457

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi242N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi481N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ9UNW1
PaxDbiQ9UNW1
PeptideAtlasiQ9UNW1
PRIDEiQ9UNW1

PTM databases

DEPODiQ9UNW1
iPTMnetiQ9UNW1
PhosphoSitePlusiQ9UNW1

Expressioni

Tissue specificityi

Widely expressed with highest levels in kidney, liver and placenta.1 Publication

Gene expression databases

BgeeiENSG00000107789
CleanExiHS_MINPP1
GenevisibleiQ9UNW1 HS

Organism-specific databases

HPAiHPA026859

Interactioni

Protein-protein interaction databases

BioGridi114932, 18 interactors
IntActiQ9UNW1, 3 interactors
STRINGi9606.ENSP00000361064

Structurei

3D structure databases

ProteinModelPortaliQ9UNW1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi484 – 487Prevents secretion from ERPROSITE-ProRule annotation4

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1382 Eukaryota
ENOG4111FS8 LUCA
GeneTreeiENSGT00390000018409
HOGENOMiHOG000113591
HOVERGENiHBG052872
InParanoidiQ9UNW1
KOiK03103
OMAiADMECGP
OrthoDBiEOG091G0FRE
PhylomeDBiQ9UNW1
TreeFamiTF324072

Family and domain databases

CDDicd07061 HP_HAP_like, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR000560 His_Pase_clade-2
IPR029033 His_PPase_superfam
IPR016274 Histidine_acid_Pase_euk
PfamiView protein in Pfam
PF00328 His_Phos_2, 1 hit
PIRSFiPIRSF000894 Acid_phosphatase, 1 hit
SUPFAMiSSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00014 ER_TARGET, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UNW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRAPGCLLR TSVAPAAALA AALLSSLARC SLLEPRDPVA SSLSPYFGTK
60 70 80 90 100
TRYEDVNPVL LSGPEAPWRD PELLEGTCTP VQLVALIRHG TRYPTVKQIR
110 120 130 140 150
KLRQLHGLLQ ARGSRDGGAS STGSRDLGAA LADWPLWYAD WMDGQLVEKG
160 170 180 190 200
RQDMRQLALR LASLFPALFS RENYGRLRLI TSSKHRCMDS SAAFLQGLWQ
210 220 230 240 250
HYHPGLPPPD VADMEFGPPT VNDKLMRFFD HCEKFLTEVE KNATALYHVE
260 270 280 290 300
AFKTGPEMQN ILKKVAATLQ VPVNDLNADL IQVAFFTCSF DLAIKGVKSP
310 320 330 340 350
WCDVFDIDDA KVLEYLNDLK QYWKRGYGYT INSRSSCTLF QDIFQHLDKA
360 370 380 390 400
VEQKQRSQPI SSPVILQFGH AETLLPLLSL MGYFKDKEPL TAYNYKKQMH
410 420 430 440 450
RKFRSGLIVP YASNLIFVLY HCENAKTPKE QFRVQMLLNE KVLPLAYSQE
460 470 480
TVSFYEDLKN HYKDILQSCQ TSEECELARA NSTSDEL
Length:487
Mass (Da):55,051
Last modified:May 1, 2000 - v1
Checksum:i89B8F347885B320A
GO
Isoform 2 (identifier: Q9UNW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: DLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKV → GLSQFLLQSSSSLVMQRLFFHCFLSWATSKTRNP
     313-487: Missing.

Note: No experimental confirmation available.
Show »
Length:312
Mass (Da):34,661
Checksum:iDC950F3E7144F13B
GO
Isoform 3 (identifier: Q9UNW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-284: DLIQVA → GIRIFK
     285-487: Missing.

Note: No experimental confirmation available.
Show »
Length:284
Mass (Da):31,475
Checksum:i0F4BC3ED1B4BFF67
GO
Isoform 4 (identifier: Q9UNW1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-213: MLRAPGCLLR...PGLPPPDVAD → MCLFQLCGLVRY

Note: No experimental confirmation available.
Show »
Length:286
Mass (Da):33,100
Checksum:iB48950FD3549CEEB
GO

Sequence cautioni

The sequence BAD93056 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81V → A in CAB43673 (PubMed:11230166).Curated1
Sequence conflicti111A → P in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti132A → R in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti156 – 157QL → HV in AAD02437 (PubMed:10087200).Curated2
Sequence conflicti344F → S in CAB43673 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs119486096EnsemblClinVar.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant dbSNP:rs104894171EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445691 – 213MLRAP…PDVAD → MCLFQLCGLVRY in isoform 4. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_014552279 – 312DLIQV…DDAKV → GLSQFLLQSSSSLVMQRLFF HCFLSWATSKTRNP in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_014553279 – 284DLIQVA → GIRIFK in isoform 3. 1 Publication6
Alternative sequenceiVSP_014554285 – 487Missing in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_014555313 – 487Missing in isoform 2. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084943 mRNA Translation: AAD09751.1
AF084944 mRNA Translation: AAD09752.1
AF046914 mRNA Translation: AAD02437.1
AL050356 mRNA Translation: CAB43673.1
AY358938 mRNA Translation: AAQ89297.1
AK309176 mRNA No translation available.
AB209819 mRNA Translation: BAD93056.1 Different initiation.
AL138767 Genomic DNA No translation available.
AL355334 Genomic DNA No translation available.
BC032504 mRNA Translation: AAH32504.1
CCDSiCCDS53551.1 [Q9UNW1-2]
CCDS53552.1 [Q9UNW1-4]
CCDS7384.1 [Q9UNW1-1]
RefSeqiNP_001171588.1, NM_001178117.1 [Q9UNW1-2]
NP_001171589.1, NM_001178118.1 [Q9UNW1-4]
NP_004888.2, NM_004897.4 [Q9UNW1-1]
XP_011538681.1, XM_011540379.2 [Q9UNW1-4]
XP_016872455.1, XM_017016966.1 [Q9UNW1-4]
UniGeneiHs.121260

Genome annotation databases

EnsembliENST00000371994; ENSP00000361062; ENSG00000107789 [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789 [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789 [Q9UNW1-4]
GeneIDi9562
KEGGihsa:9562
UCSCiuc001keu.4 human [Q9UNW1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMINP1_HUMAN
AccessioniPrimary (citable) accession number: Q9UNW1
Secondary accession number(s): F5H683
, O95172, O95286, Q59EJ2, Q9UGA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: May 1, 2000
Last modified: May 23, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health