Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Multiple inositol polyphosphate phosphatase 1

Gene

MINPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity).By similarity1 Publication

Catalytic activityi

Myo-inositol hexakisphosphate + H2O = myo-inositol pentakisphosphate (mixed isomers) + phosphate.1 Publication
2,3-bisphospho-D-glycerate + H2O = 2-phospho-D-glycerate + phosphate.1 Publication

Kineticsi

  1. KM=0.61 mM for 2,3-bisphosphoglycerate1 Publication
  2. KM=90 µM for inositol hexakisphosphate1 Publication
  1. Vmax=15.8 nmol/min/mg enzyme with 2,3-bisphospho-D-glycerate as substrate1 Publication
  2. Vmax=6.2 nmol/min/mg enzyme with inositol hexakisphosphate as substrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei89By similarity1

GO - Molecular functioni

GO - Biological processi

  • bone mineralization Source: UniProtKB
  • inositol phosphate metabolic process Source: Reactome
  • ossification Source: UniProtKB
  • polyphosphate metabolic process Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BioCyciMetaCyc:HS03025-MONOMER.
ZFISH:HS03025-MONOMER.
BRENDAi3.1.3.62. 2681.
ReactomeiR-HSA-1855231. Synthesis of IPs in the ER lumen.
SABIO-RKQ9UNW1.

Names & Taxonomyi

Protein namesi
Recommended name:
Multiple inositol polyphosphate phosphatase 1Imported (EC:3.1.3.621 Publication)
Alternative name(s):
2,3-bisphosphoglycerate 3-phosphatase1 Publication (EC:3.1.3.801 Publication)
Short name:
2,3-BPG phosphatase1 Publication
Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
Short name:
Ins(1,3,4,5)P(4) 3-phosphatase
Gene namesi
Name:MINPP1
Synonyms:MIPP
ORF Names:UNQ900/PRO1917
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:7102. MINPP1.

Subcellular locationi

  • Endoplasmic reticulum lumen By similarity

GO - Cellular componenti

  • endoplasmic reticulum Source: ProtInc
  • endoplasmic reticulum lumen Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Involvement in diseasei

Thyroid cancer, non-medullary, 2 (NMTC2)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA form of non-medullary thyroid cancer (NMTC), a cancer characterized by tumors originating from the thyroid follicular cells. NMTCs represent approximately 95% of all cases of thyroid cancer and are classified into papillary, follicular, Hurthle cell, and anaplastic neoplasms.
See also OMIM:188470
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant rs119486096dbSNPEnsembl.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant rs104894171dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi89H → A: Strong reduction of 2,3-bisphosphoglycerate 3-phosphatase activity. 1 Publication1
Mutagenesisi370H → A: Greatly diminishes phosphatase activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi9562.
MalaCardsiMINPP1.
MIMi188470. phenotype.
OpenTargetsiENSG00000107789.
PharmGKBiPA30820.

Polymorphism and mutation databases

BioMutaiMINPP1.
DMDMi68565617.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30By similarityAdd BLAST30
ChainiPRO_000001958231 – 487Multiple inositol polyphosphate phosphatase 1Add BLAST457

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi242N-linked (GlcNAc...)1 Publication1
Glycosylationi481N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ9UNW1.
PaxDbiQ9UNW1.
PeptideAtlasiQ9UNW1.
PRIDEiQ9UNW1.

PTM databases

DEPODiQ9UNW1.
iPTMnetiQ9UNW1.
PhosphoSitePlusiQ9UNW1.

Expressioni

Tissue specificityi

Widely expressed with highest levels in kidney, liver and placenta.1 Publication

Gene expression databases

BgeeiENSG00000107789.
CleanExiHS_MINPP1.
GenevisibleiQ9UNW1. HS.

Organism-specific databases

HPAiHPA026859.

Interactioni

Protein-protein interaction databases

BioGridi114932. 16 interactors.
IntActiQ9UNW1. 2 interactors.
STRINGi9606.ENSP00000361064.

Structurei

3D structure databases

ProteinModelPortaliQ9UNW1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi484 – 487Prevents secretion from ERPROSITE-ProRule annotation4

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1382. Eukaryota.
ENOG4111FS8. LUCA.
GeneTreeiENSGT00390000018409.
HOGENOMiHOG000113591.
HOVERGENiHBG052872.
InParanoidiQ9UNW1.
KOiK03103.
OMAiTRYEDAN.
OrthoDBiEOG091G0FRE.
PhylomeDBiQ9UNW1.
TreeFamiTF324072.

Family and domain databases

CDDicd07061. HP_HAP_like. 1 hit.
Gene3Di3.40.50.1240. 1 hit.
InterProiIPR000560. His_Pase_clade-2.
IPR029033. His_PPase_superfam.
IPR016274. Histidine_acid_Pase_euk.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
PIRSFiPIRSF000894. Acid_phosphatase. 1 hit.
SUPFAMiSSF53254. SSF53254. 1 hit.
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UNW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRAPGCLLR TSVAPAAALA AALLSSLARC SLLEPRDPVA SSLSPYFGTK
60 70 80 90 100
TRYEDVNPVL LSGPEAPWRD PELLEGTCTP VQLVALIRHG TRYPTVKQIR
110 120 130 140 150
KLRQLHGLLQ ARGSRDGGAS STGSRDLGAA LADWPLWYAD WMDGQLVEKG
160 170 180 190 200
RQDMRQLALR LASLFPALFS RENYGRLRLI TSSKHRCMDS SAAFLQGLWQ
210 220 230 240 250
HYHPGLPPPD VADMEFGPPT VNDKLMRFFD HCEKFLTEVE KNATALYHVE
260 270 280 290 300
AFKTGPEMQN ILKKVAATLQ VPVNDLNADL IQVAFFTCSF DLAIKGVKSP
310 320 330 340 350
WCDVFDIDDA KVLEYLNDLK QYWKRGYGYT INSRSSCTLF QDIFQHLDKA
360 370 380 390 400
VEQKQRSQPI SSPVILQFGH AETLLPLLSL MGYFKDKEPL TAYNYKKQMH
410 420 430 440 450
RKFRSGLIVP YASNLIFVLY HCENAKTPKE QFRVQMLLNE KVLPLAYSQE
460 470 480
TVSFYEDLKN HYKDILQSCQ TSEECELARA NSTSDEL
Length:487
Mass (Da):55,051
Last modified:May 1, 2000 - v1
Checksum:i89B8F347885B320A
GO
Isoform 2 (identifier: Q9UNW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-312: DLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKV → GLSQFLLQSSSSLVMQRLFFHCFLSWATSKTRNP
     313-487: Missing.

Note: No experimental confirmation available.
Show »
Length:312
Mass (Da):34,661
Checksum:iDC950F3E7144F13B
GO
Isoform 3 (identifier: Q9UNW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-284: DLIQVA → GIRIFK
     285-487: Missing.

Note: No experimental confirmation available.
Show »
Length:284
Mass (Da):31,475
Checksum:i0F4BC3ED1B4BFF67
GO
Isoform 4 (identifier: Q9UNW1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-213: MLRAPGCLLR...PGLPPPDVAD → MCLFQLCGLVRY

Note: No experimental confirmation available.
Show »
Length:286
Mass (Da):33,100
Checksum:iB48950FD3549CEEB
GO

Sequence cautioni

The sequence BAD93056 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81V → A in CAB43673 (PubMed:11230166).Curated1
Sequence conflicti111A → P in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti132A → R in AAD02437 (PubMed:10087200).Curated1
Sequence conflicti156 – 157QL → HV in AAD02437 (PubMed:10087200).Curated2
Sequence conflicti344F → S in CAB43673 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02283641S → L in NMTC2; somatic mutation. 1 PublicationCorresponds to variant rs119486096dbSNPEnsembl.1
Natural variantiVAR_022837270Q → R in NMTC2. 1 PublicationCorresponds to variant rs104894171dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445691 – 213MLRAP…PDVAD → MCLFQLCGLVRY in isoform 4. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_014552279 – 312DLIQV…DDAKV → GLSQFLLQSSSSLVMQRLFF HCFLSWATSKTRNP in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_014553279 – 284DLIQVA → GIRIFK in isoform 3. 1 Publication6
Alternative sequenceiVSP_014554285 – 487Missing in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_014555313 – 487Missing in isoform 2. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084943 mRNA. Translation: AAD09751.1.
AF084944 mRNA. Translation: AAD09752.1.
AF046914 mRNA. Translation: AAD02437.1.
AL050356 mRNA. Translation: CAB43673.1.
AY358938 mRNA. Translation: AAQ89297.1.
AK309176 mRNA. No translation available.
AB209819 mRNA. Translation: BAD93056.1. Different initiation.
AL355334, AL138767 Genomic DNA. Translation: CAH73423.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16030.1.
AL355334, AL138767 Genomic DNA. Translation: CAH73422.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16029.1.
BC032504 mRNA. Translation: AAH32504.1.
CCDSiCCDS53551.1. [Q9UNW1-2]
CCDS53552.1. [Q9UNW1-4]
CCDS7384.1. [Q9UNW1-1]
RefSeqiNP_001171588.1. NM_001178117.1. [Q9UNW1-2]
NP_001171589.1. NM_001178118.1. [Q9UNW1-4]
NP_004888.2. NM_004897.4. [Q9UNW1-1]
XP_011538681.1. XM_011540379.2. [Q9UNW1-4]
XP_016872455.1. XM_017016966.1. [Q9UNW1-4]
UniGeneiHs.121260.

Genome annotation databases

EnsembliENST00000371994; ENSP00000361062; ENSG00000107789. [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789. [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789. [Q9UNW1-4]
GeneIDi9562.
KEGGihsa:9562.
UCSCiuc001keu.4. human. [Q9UNW1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084943 mRNA. Translation: AAD09751.1.
AF084944 mRNA. Translation: AAD09752.1.
AF046914 mRNA. Translation: AAD02437.1.
AL050356 mRNA. Translation: CAB43673.1.
AY358938 mRNA. Translation: AAQ89297.1.
AK309176 mRNA. No translation available.
AB209819 mRNA. Translation: BAD93056.1. Different initiation.
AL355334, AL138767 Genomic DNA. Translation: CAH73423.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16030.1.
AL355334, AL138767 Genomic DNA. Translation: CAH73422.1.
AL138767, AL355334 Genomic DNA. Translation: CAI16029.1.
BC032504 mRNA. Translation: AAH32504.1.
CCDSiCCDS53551.1. [Q9UNW1-2]
CCDS53552.1. [Q9UNW1-4]
CCDS7384.1. [Q9UNW1-1]
RefSeqiNP_001171588.1. NM_001178117.1. [Q9UNW1-2]
NP_001171589.1. NM_001178118.1. [Q9UNW1-4]
NP_004888.2. NM_004897.4. [Q9UNW1-1]
XP_011538681.1. XM_011540379.2. [Q9UNW1-4]
XP_016872455.1. XM_017016966.1. [Q9UNW1-4]
UniGeneiHs.121260.

3D structure databases

ProteinModelPortaliQ9UNW1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114932. 16 interactors.
IntActiQ9UNW1. 2 interactors.
STRINGi9606.ENSP00000361064.

PTM databases

DEPODiQ9UNW1.
iPTMnetiQ9UNW1.
PhosphoSitePlusiQ9UNW1.

Polymorphism and mutation databases

BioMutaiMINPP1.
DMDMi68565617.

Proteomic databases

EPDiQ9UNW1.
PaxDbiQ9UNW1.
PeptideAtlasiQ9UNW1.
PRIDEiQ9UNW1.

Protocols and materials databases

DNASUi9562.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371994; ENSP00000361062; ENSG00000107789. [Q9UNW1-2]
ENST00000371996; ENSP00000361064; ENSG00000107789. [Q9UNW1-1]
ENST00000536010; ENSP00000437823; ENSG00000107789. [Q9UNW1-4]
GeneIDi9562.
KEGGihsa:9562.
UCSCiuc001keu.4. human. [Q9UNW1-1]

Organism-specific databases

CTDi9562.
DisGeNETi9562.
GeneCardsiMINPP1.
HGNCiHGNC:7102. MINPP1.
HPAiHPA026859.
MalaCardsiMINPP1.
MIMi188470. phenotype.
605391. gene.
neXtProtiNX_Q9UNW1.
OpenTargetsiENSG00000107789.
PharmGKBiPA30820.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1382. Eukaryota.
ENOG4111FS8. LUCA.
GeneTreeiENSGT00390000018409.
HOGENOMiHOG000113591.
HOVERGENiHBG052872.
InParanoidiQ9UNW1.
KOiK03103.
OMAiTRYEDAN.
OrthoDBiEOG091G0FRE.
PhylomeDBiQ9UNW1.
TreeFamiTF324072.

Enzyme and pathway databases

BioCyciMetaCyc:HS03025-MONOMER.
ZFISH:HS03025-MONOMER.
BRENDAi3.1.3.62. 2681.
ReactomeiR-HSA-1855231. Synthesis of IPs in the ER lumen.
SABIO-RKQ9UNW1.

Miscellaneous databases

ChiTaRSiMINPP1. human.
GeneWikiiMINPP1.
GenomeRNAii9562.
PROiQ9UNW1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000107789.
CleanExiHS_MINPP1.
GenevisibleiQ9UNW1. HS.

Family and domain databases

CDDicd07061. HP_HAP_like. 1 hit.
Gene3Di3.40.50.1240. 1 hit.
InterProiIPR000560. His_Pase_clade-2.
IPR029033. His_PPase_superfam.
IPR016274. Histidine_acid_Pase_euk.
[Graphical view]
PfamiPF00328. His_Phos_2. 1 hit.
[Graphical view]
PIRSFiPIRSF000894. Acid_phosphatase. 1 hit.
SUPFAMiSSF53254. SSF53254. 1 hit.
PROSITEiPS00014. ER_TARGET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMINP1_HUMAN
AccessioniPrimary (citable) accession number: Q9UNW1
Secondary accession number(s): F5H683
, O95172, O95286, Q59EJ2, Q9UGA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.