Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase E

Gene

PPIE

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

GO - Molecular functioni

  • cyclosporin A binding Source: ProtInc
  • nucleotide binding Source: InterPro
  • peptidyl-prolyl cis-trans isomerase activity Source: UniProtKB
  • poly(A) RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

  • mRNA splicing, via spliceosome Source: UniProtKB
  • positive regulation of viral genome replication Source: UniProtKB
  • protein folding Source: InterPro
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription-coupled nucleotide-excision repair Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Rotamase

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:HS01463-MONOMER.
BRENDAi5.2.1.8. 2681.
ReactomeiR-HSA-6781823. Formation of TC-NER Pre-Incision Complex.
R-HSA-6781827. Transcription-Coupled Nucleotide Excision Repair (TC-NER).
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.
R-HSA-6798695. Neutrophil degranulation.
R-HSA-72163. mRNA Splicing - Major Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase E (EC:5.2.1.8)
Short name:
PPIase E
Alternative name(s):
Cyclophilin E
Cyclophilin-33
Rotamase E
Gene namesi
Name:PPIE
Synonyms:CYP33
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9258. PPIE.

Subcellular locationi

GO - Cellular componenti

  • catalytic step 2 spliceosome Source: UniProtKB
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi10450.
OpenTargetsiENSG00000084072.
PharmGKBiPA33583.

Polymorphism and mutation databases

BioMutaiPPIE.
DMDMi13124097.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000641571 – 301Peptidyl-prolyl cis-trans isomerase EAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei91PhosphoserineCombined sources1
Modified residuei97PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UNP9.
PeptideAtlasiQ9UNP9.
PRIDEiQ9UNP9.
TopDownProteomicsiQ9UNP9-1. [Q9UNP9-1]
Q9UNP9-2. [Q9UNP9-2]

PTM databases

iPTMnetiQ9UNP9.
PhosphoSitePlusiQ9UNP9.

Expressioni

Tissue specificityi

Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Gene expression databases

BgeeiENSG00000084072.
CleanExiHS_PPIE.
ExpressionAtlasiQ9UNP9. baseline and differential.
GenevisibleiQ9UNP9. HS.

Organism-specific databases

HPAiHPA020131.

Interactioni

Subunit structurei

Identified in the spliceosome C complex. Component of the XAB2 complex, a multimeric protein complex composed of XAB2, PRPF19, AQR, ZNF830, ISY1, and PPIE.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KMT2AQ031644EBI-591818,EBI-591370
XAB2Q9HCS78EBI-591818,EBI-295232

Protein-protein interaction databases

BioGridi115714. 56 interactors.
DIPiDIP-34757N.
IntActiQ9UNP9. 13 interactors.
MINTiMINT-3082792.

Structurei

Secondary structure

1301
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 11Combined sources7
Helixi19 – 26Combined sources8
Helixi27 – 29Combined sources3
Beta strandi32 – 36Combined sources5
Turni41 – 43Combined sources3
Beta strandi48 – 56Combined sources9
Helixi57 – 67Combined sources11
Beta strandi70 – 72Combined sources3
Beta strandi78 – 81Combined sources4
Beta strandi141 – 148Combined sources8
Beta strandi151 – 160Combined sources10
Turni162 – 164Combined sources3
Helixi166 – 177Combined sources12
Turni178 – 180Combined sources3
Beta strandi188 – 193Combined sources6
Turni194 – 196Combined sources3
Beta strandi197 – 200Combined sources4
Turni203 – 205Combined sources3
Beta strandi206 – 209Combined sources4
Beta strandi214 – 217Combined sources4
Beta strandi230 – 236Combined sources7
Beta strandi248 – 253Combined sources6
Helixi256 – 258Combined sources3
Turni259 – 261Combined sources3
Beta strandi264 – 270Combined sources7
Helixi272 – 279Combined sources8
Beta strandi292 – 299Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZMFX-ray1.88A137-301[»]
2CQBNMR-A1-89[»]
2KU7NMR-A2-82[»]
2KYXNMR-A3-83[»]
2R99X-ray1.61A131-301[»]
3LPYX-ray2.00A/B5-82[»]
3MDFX-ray1.85A/B1-83[»]
3UCHX-ray2.50A129-301[»]
ProteinModelPortaliQ9UNP9.
SMRiQ9UNP9.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UNP9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 84RRMPROSITE-ProRule annotationAdd BLAST79
Domaini143 – 299PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST157

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi60 – 63Poly-Ala4

Sequence similaritiesi

Contains 1 PPIase cyclophilin-type domain.PROSITE-ProRule annotation
Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

GeneTreeiENSGT00760000119119.
HOGENOMiHOG000065981.
HOVERGENiHBG001065.
InParanoidiQ9UNP9.
KOiK09564.
OMAiIAKPMRI.
OrthoDBiEOG091G0BGL.
PhylomeDBiQ9UNP9.
TreeFamiTF313817.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
3.30.70.330. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR024936. Cyclophilin-type_PPIase.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR016304. Cyclophilin-type_PPIase_E.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PANTHERiPTHR11071. PTHR11071. 1 hit.
PfamiPF00160. Pro_isomerase. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001475. PPI_cyclophilin_E. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF50891. SSF50891. 1 hit.
SSF54928. SSF54928. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS50102. RRM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q9UNP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATTKRVLYV GGLAEEVDDK VLHAAFIPFG DITDIQIPLD YETEKHRGFA
60 70 80 90 100
FVEFELAEDA AAAIDNMNES ELFGRTIRVN LAKPMRIKEG SSRPVWSDDD
110 120 130 140 150
WLKKFSGKTL EENKEEEGSE PPKAETQEGE PIAKKARSNP QVYMDIKIGN
160 170 180 190 200
KPAGRIQMLL RSDVVPMTAE NFRCLCTHEK GFGFKGSSFH RIIPQFMCQG
210 220 230 240 250
GDFTNHNGTG GKSIYGKKFD DENFILKHTG PGLLSMANSG PNTNGSQFFL
260 270 280 290 300
TCDKTDWLDG KHVVFGEVTE GLDVLRQIEA QGSKDGKPKQ KVIIADCGEY

V
Length:301
Mass (Da):33,431
Last modified:May 1, 2000 - v1
Checksum:iF3226149A790BA42
GO
Isoform B (identifier: Q9UNP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → KQEESAITSQPRSWKLT

Show »
Length:296
Mass (Da):33,085
Checksum:iB70A7F239825B54D
GO
Isoform 3 (identifier: Q9UNP9-3) [UniParc]FASTAAdd to basket
Also known as: Cyclophilin-33B

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → VAPDTKASKARGSRKNKDGQERNWGKSQKVESHTI

Show »
Length:314
Mass (Da):34,991
Checksum:iC5D0CFB2673046D7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti151K → R in AAZ93379 (Ref. 3) Curated1
Sequence conflicti207N → D in AAZ93379 (Ref. 3) Curated1
Sequence conflicti287K → N in AAC00006 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046370280 – 301AQGSK…CGEYV → VAPDTKASKARGSRKNKDGQ ERNWGKSQKVESHTI in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_005181280 – 301AQGSK…CGEYV → KQEESAITSQPRSWKLT in isoform B. 2 PublicationsAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104012 mRNA. Translation: AAD19906.1.
AF104013 mRNA. Translation: AAD19907.1.
AF042385 mRNA. Translation: AAC00006.1.
AF042386 mRNA. Translation: AAC00007.1.
DQ160195 mRNA. Translation: AAZ93379.1.
AK313666 mRNA. Translation: BAG36418.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19347.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19348.1.
AL049824, AL035404 Genomic DNA. Translation: CAI19350.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19409.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19410.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19576.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19577.1.
AL035404, AL049824 Genomic DNA. Translation: CAI19579.1.
CH471059 Genomic DNA. Translation: EAX07255.1.
BC004898 mRNA. Translation: AAH04898.1.
BC008451 mRNA. Translation: AAH08451.1.
BC107736 mRNA. Translation: AAI07737.1.
CCDSiCCDS442.1. [Q9UNP9-2]
CCDS443.1. [Q9UNP9-1]
CCDS53299.1. [Q9UNP9-3]
PIRiS66681.
RefSeqiNP_001181936.1. NM_001195007.1. [Q9UNP9-3]
NP_006103.1. NM_006112.3. [Q9UNP9-1]
NP_982281.1. NM_203456.2. [Q9UNP9-2]
XP_016855540.1. XM_017000051.1. [Q9UNP9-3]
UniGeneiHs.524690.

Genome annotation databases

EnsembliENST00000324379; ENSP00000312769; ENSG00000084072. [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072. [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072. [Q9UNP9-3]
GeneIDi10450.
KEGGihsa:10450.
UCSCiuc001cds.3. human. [Q9UNP9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104012 mRNA. Translation: AAD19906.1.
AF104013 mRNA. Translation: AAD19907.1.
AF042385 mRNA. Translation: AAC00006.1.
AF042386 mRNA. Translation: AAC00007.1.
DQ160195 mRNA. Translation: AAZ93379.1.
AK313666 mRNA. Translation: BAG36418.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19347.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19348.1.
AL049824, AL035404 Genomic DNA. Translation: CAI19350.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19409.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19410.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19576.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19577.1.
AL035404, AL049824 Genomic DNA. Translation: CAI19579.1.
CH471059 Genomic DNA. Translation: EAX07255.1.
BC004898 mRNA. Translation: AAH04898.1.
BC008451 mRNA. Translation: AAH08451.1.
BC107736 mRNA. Translation: AAI07737.1.
CCDSiCCDS442.1. [Q9UNP9-2]
CCDS443.1. [Q9UNP9-1]
CCDS53299.1. [Q9UNP9-3]
PIRiS66681.
RefSeqiNP_001181936.1. NM_001195007.1. [Q9UNP9-3]
NP_006103.1. NM_006112.3. [Q9UNP9-1]
NP_982281.1. NM_203456.2. [Q9UNP9-2]
XP_016855540.1. XM_017000051.1. [Q9UNP9-3]
UniGeneiHs.524690.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZMFX-ray1.88A137-301[»]
2CQBNMR-A1-89[»]
2KU7NMR-A2-82[»]
2KYXNMR-A3-83[»]
2R99X-ray1.61A131-301[»]
3LPYX-ray2.00A/B5-82[»]
3MDFX-ray1.85A/B1-83[»]
3UCHX-ray2.50A129-301[»]
ProteinModelPortaliQ9UNP9.
SMRiQ9UNP9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115714. 56 interactors.
DIPiDIP-34757N.
IntActiQ9UNP9. 13 interactors.
MINTiMINT-3082792.

PTM databases

iPTMnetiQ9UNP9.
PhosphoSitePlusiQ9UNP9.

Polymorphism and mutation databases

BioMutaiPPIE.
DMDMi13124097.

Proteomic databases

EPDiQ9UNP9.
PeptideAtlasiQ9UNP9.
PRIDEiQ9UNP9.
TopDownProteomicsiQ9UNP9-1. [Q9UNP9-1]
Q9UNP9-2. [Q9UNP9-2]

Protocols and materials databases

DNASUi10450.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324379; ENSP00000312769; ENSG00000084072. [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072. [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072. [Q9UNP9-3]
GeneIDi10450.
KEGGihsa:10450.
UCSCiuc001cds.3. human. [Q9UNP9-1]

Organism-specific databases

CTDi10450.
DisGeNETi10450.
GeneCardsiPPIE.
HGNCiHGNC:9258. PPIE.
HPAiHPA020131.
MIMi602435. gene.
neXtProtiNX_Q9UNP9.
OpenTargetsiENSG00000084072.
PharmGKBiPA33583.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119119.
HOGENOMiHOG000065981.
HOVERGENiHBG001065.
InParanoidiQ9UNP9.
KOiK09564.
OMAiIAKPMRI.
OrthoDBiEOG091G0BGL.
PhylomeDBiQ9UNP9.
TreeFamiTF313817.

Enzyme and pathway databases

BioCyciZFISH:HS01463-MONOMER.
BRENDAi5.2.1.8. 2681.
ReactomeiR-HSA-6781823. Formation of TC-NER Pre-Incision Complex.
R-HSA-6781827. Transcription-Coupled Nucleotide Excision Repair (TC-NER).
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.
R-HSA-6798695. Neutrophil degranulation.
R-HSA-72163. mRNA Splicing - Major Pathway.

Miscellaneous databases

ChiTaRSiPPIE. human.
EvolutionaryTraceiQ9UNP9.
GeneWikiiPPIE_(gene).
GenomeRNAii10450.
PROiQ9UNP9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000084072.
CleanExiHS_PPIE.
ExpressionAtlasiQ9UNP9. baseline and differential.
GenevisibleiQ9UNP9. HS.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
3.30.70.330. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR024936. Cyclophilin-type_PPIase.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR016304. Cyclophilin-type_PPIase_E.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PANTHERiPTHR11071. PTHR11071. 1 hit.
PfamiPF00160. Pro_isomerase. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001475. PPI_cyclophilin_E. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF50891. SSF50891. 1 hit.
SSF54928. SSF54928. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPPIE_HUMAN
AccessioniPrimary (citable) accession number: Q9UNP9
Secondary accession number(s): B2R971
, O43634, O43635, Q32Q72, Q3S611, Q5TGA0, Q5TGA2, Q5TGA3, Q9UIZ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 169 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.