SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UNP9

- PPIE_HUMAN

UniProt

Q9UNP9 - PPIE_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Peptidyl-prolyl cis-trans isomerase E
Gene
PPIE, CYP33
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

GO - Molecular functioni

  1. RNA binding Source: UniProtKB
  2. cyclosporin A binding Source: ProtInc
  3. nucleotide binding Source: InterPro
  4. peptidyl-prolyl cis-trans isomerase activity Source: UniProtKB
  5. poly(A) RNA binding Source: UniProtKB
  6. protein binding Source: UniProtKB

GO - Biological processi

  1. mRNA splicing, via spliceosome Source: UniProtKB
  2. positive regulation of viral genome replication Source: UniProtKB
  3. protein folding Source: UniProtKB-KW
  4. protein peptidyl-prolyl isomerization Source: GOC
  5. regulation of transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Rotamase

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase E (EC:5.2.1.8)
Short name:
PPIase E
Alternative name(s):
Cyclophilin E
Cyclophilin-33
Rotamase E
Gene namesi
Name:PPIE
Synonyms:CYP33
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:9258. PPIE.

Subcellular locationi

GO - Cellular componenti

  1. catalytic step 2 spliceosome Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33583.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 301301Peptidyl-prolyl cis-trans isomerase E
PRO_0000064157Add
BLAST

Proteomic databases

MaxQBiQ9UNP9.
PaxDbiQ9UNP9.
PRIDEiQ9UNP9.

PTM databases

PhosphoSiteiQ9UNP9.

Expressioni

Tissue specificityi

Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Gene expression databases

ArrayExpressiQ9UNP9.
BgeeiQ9UNP9.
CleanExiHS_PPIE.
GenevestigatoriQ9UNP9.

Organism-specific databases

HPAiHPA020131.

Interactioni

Subunit structurei

Identified in the spliceosome C complex.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
KMT2AQ031644EBI-591818,EBI-591370
XAB2Q9HCS73EBI-591818,EBI-295232

Protein-protein interaction databases

BioGridi115714. 13 interactions.
IntActiQ9UNP9. 10 interactions.
MINTiMINT-3082792.
STRINGi9606.ENSP00000312769.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi5 – 117
Helixi19 – 268
Helixi27 – 293
Beta strandi32 – 365
Turni41 – 433
Beta strandi48 – 569
Helixi57 – 6711
Beta strandi70 – 723
Beta strandi78 – 814
Beta strandi141 – 1488
Beta strandi151 – 16010
Turni162 – 1643
Helixi166 – 17712
Turni178 – 1803
Beta strandi188 – 1936
Turni194 – 1963
Beta strandi197 – 2004
Turni203 – 2053
Beta strandi206 – 2094
Beta strandi214 – 2174
Beta strandi230 – 2367
Beta strandi248 – 2536
Helixi256 – 2583
Turni259 – 2613
Beta strandi264 – 2707
Helixi272 – 2798
Beta strandi292 – 2998

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ZMFX-ray1.88A137-301[»]
2CQBNMR-A1-89[»]
2KU7NMR-A2-82[»]
2KYXNMR-A3-83[»]
2R99X-ray1.61A131-301[»]
3LPYX-ray2.00A/B5-82[»]
3MDFX-ray1.85A/B1-83[»]
3UCHX-ray2.50A129-301[»]
ProteinModelPortaliQ9UNP9.
SMRiQ9UNP9. Positions 1-108, 138-301.

Miscellaneous databases

EvolutionaryTraceiQ9UNP9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 8479RRM
Add
BLAST
Domaini143 – 299157PPIase cyclophilin-type
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi60 – 634Poly-Ala

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0724.
HOVERGENiHBG001065.
KOiK09564.
OMAiAFIEFEL.
PhylomeDBiQ9UNP9.
TreeFamiTF313817.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
3.30.70.330. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR016304. Cyclophilin-type_PPIase_E.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00160. Pro_isomerase. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001475. PPI_cyclophilin_E. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF50891. SSF50891. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS50102. RRM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q9UNP9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATTKRVLYV GGLAEEVDDK VLHAAFIPFG DITDIQIPLD YETEKHRGFA    50
FVEFELAEDA AAAIDNMNES ELFGRTIRVN LAKPMRIKEG SSRPVWSDDD 100
WLKKFSGKTL EENKEEEGSE PPKAETQEGE PIAKKARSNP QVYMDIKIGN 150
KPAGRIQMLL RSDVVPMTAE NFRCLCTHEK GFGFKGSSFH RIIPQFMCQG 200
GDFTNHNGTG GKSIYGKKFD DENFILKHTG PGLLSMANSG PNTNGSQFFL 250
TCDKTDWLDG KHVVFGEVTE GLDVLRQIEA QGSKDGKPKQ KVIIADCGEY 300
V 301
Length:301
Mass (Da):33,431
Last modified:May 1, 2000 - v1
Checksum:iF3226149A790BA42
GO
Isoform B (identifier: Q9UNP9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → KQEESAITSQPRSWKLT

Show »
Length:296
Mass (Da):33,085
Checksum:iB70A7F239825B54D
GO
Isoform 3 (identifier: Q9UNP9-3) [UniParc]FASTAAdd to Basket

Also known as: Cyclophilin-33B

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → VAPDTKASKARGSRKNKDGQERNWGKSQKVESHTI

Show »
Length:314
Mass (Da):34,991
Checksum:iC5D0CFB2673046D7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei280 – 30122AQGSK…CGEYV → VAPDTKASKARGSRKNKDGQ ERNWGKSQKVESHTI in isoform 3.
VSP_046370Add
BLAST
Alternative sequencei280 – 30122AQGSK…CGEYV → KQEESAITSQPRSWKLT in isoform B.
VSP_005181Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti151 – 1511K → R in AAZ93379. 1 Publication
Sequence conflicti207 – 2071N → D in AAZ93379. 1 Publication
Sequence conflicti287 – 2871K → N in AAC00006. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF104012 mRNA. Translation: AAD19906.1.
AF104013 mRNA. Translation: AAD19907.1.
AF042385 mRNA. Translation: AAC00006.1.
AF042386 mRNA. Translation: AAC00007.1.
DQ160195 mRNA. Translation: AAZ93379.1.
AK313666 mRNA. Translation: BAG36418.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19347.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19348.1.
AL049824, AL035404 Genomic DNA. Translation: CAI19350.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19409.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19410.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19576.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19577.1.
AL035404, AL049824 Genomic DNA. Translation: CAI19579.1.
CH471059 Genomic DNA. Translation: EAX07255.1.
BC004898 mRNA. Translation: AAH04898.1.
BC008451 mRNA. Translation: AAH08451.1.
BC107736 mRNA. Translation: AAI07737.1.
CCDSiCCDS442.1. [Q9UNP9-2]
CCDS443.1. [Q9UNP9-1]
CCDS53299.1. [Q9UNP9-3]
PIRiS66681.
RefSeqiNP_001181936.1. NM_001195007.1. [Q9UNP9-3]
NP_006103.1. NM_006112.3. [Q9UNP9-1]
NP_982281.1. NM_203456.2. [Q9UNP9-2]
XP_006710351.1. XM_006710288.1. [Q9UNP9-3]
UniGeneiHs.524690.

Genome annotation databases

EnsembliENST00000324379; ENSP00000312769; ENSG00000084072. [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072. [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072. [Q9UNP9-3]
GeneIDi10450.
KEGGihsa:10450.
UCSCiuc001cds.2. human. [Q9UNP9-1]
uc001cdv.3. human. [Q9UNP9-2]

Polymorphism databases

DMDMi13124097.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF104012 mRNA. Translation: AAD19906.1 .
AF104013 mRNA. Translation: AAD19907.1 .
AF042385 mRNA. Translation: AAC00006.1 .
AF042386 mRNA. Translation: AAC00007.1 .
DQ160195 mRNA. Translation: AAZ93379.1 .
AK313666 mRNA. Translation: BAG36418.1 .
AL049824 , AL033527 , AL035404 Genomic DNA. Translation: CAI19347.1 .
AL049824 , AL033527 , AL035404 Genomic DNA. Translation: CAI19348.1 .
AL049824 , AL035404 Genomic DNA. Translation: CAI19350.1 .
AL033527 , AL035404 , AL049824 Genomic DNA. Translation: CAI19409.1 .
AL033527 , AL035404 , AL049824 Genomic DNA. Translation: CAI19410.1 .
AL035404 , AL033527 , AL049824 Genomic DNA. Translation: CAI19576.1 .
AL035404 , AL033527 , AL049824 Genomic DNA. Translation: CAI19577.1 .
AL035404 , AL049824 Genomic DNA. Translation: CAI19579.1 .
CH471059 Genomic DNA. Translation: EAX07255.1 .
BC004898 mRNA. Translation: AAH04898.1 .
BC008451 mRNA. Translation: AAH08451.1 .
BC107736 mRNA. Translation: AAI07737.1 .
CCDSi CCDS442.1. [Q9UNP9-2 ]
CCDS443.1. [Q9UNP9-1 ]
CCDS53299.1. [Q9UNP9-3 ]
PIRi S66681.
RefSeqi NP_001181936.1. NM_001195007.1. [Q9UNP9-3 ]
NP_006103.1. NM_006112.3. [Q9UNP9-1 ]
NP_982281.1. NM_203456.2. [Q9UNP9-2 ]
XP_006710351.1. XM_006710288.1. [Q9UNP9-3 ]
UniGenei Hs.524690.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1ZMF X-ray 1.88 A 137-301 [» ]
2CQB NMR - A 1-89 [» ]
2KU7 NMR - A 2-82 [» ]
2KYX NMR - A 3-83 [» ]
2R99 X-ray 1.61 A 131-301 [» ]
3LPY X-ray 2.00 A/B 5-82 [» ]
3MDF X-ray 1.85 A/B 1-83 [» ]
3UCH X-ray 2.50 A 129-301 [» ]
ProteinModelPortali Q9UNP9.
SMRi Q9UNP9. Positions 1-108, 138-301.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115714. 13 interactions.
IntActi Q9UNP9. 10 interactions.
MINTi MINT-3082792.
STRINGi 9606.ENSP00000312769.

PTM databases

PhosphoSitei Q9UNP9.

Polymorphism databases

DMDMi 13124097.

Proteomic databases

MaxQBi Q9UNP9.
PaxDbi Q9UNP9.
PRIDEi Q9UNP9.

Protocols and materials databases

DNASUi 10450.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324379 ; ENSP00000312769 ; ENSG00000084072 . [Q9UNP9-1 ]
ENST00000356511 ; ENSP00000348904 ; ENSG00000084072 . [Q9UNP9-2 ]
ENST00000372830 ; ENSP00000361918 ; ENSG00000084072 . [Q9UNP9-3 ]
GeneIDi 10450.
KEGGi hsa:10450.
UCSCi uc001cds.2. human. [Q9UNP9-1 ]
uc001cdv.3. human. [Q9UNP9-2 ]

Organism-specific databases

CTDi 10450.
GeneCardsi GC01P040157.
HGNCi HGNC:9258. PPIE.
HPAi HPA020131.
MIMi 602435. gene.
neXtProti NX_Q9UNP9.
PharmGKBi PA33583.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0724.
HOVERGENi HBG001065.
KOi K09564.
OMAi AFIEFEL.
PhylomeDBi Q9UNP9.
TreeFami TF313817.

Miscellaneous databases

ChiTaRSi PPIE. human.
EvolutionaryTracei Q9UNP9.
GeneWikii PPIE_(gene).
GenomeRNAii 10450.
NextBioi 39609.
PROi Q9UNP9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UNP9.
Bgeei Q9UNP9.
CleanExi HS_PPIE.
Genevestigatori Q9UNP9.

Family and domain databases

Gene3Di 2.40.100.10. 1 hit.
3.30.70.330. 1 hit.
InterProi IPR029000. Cyclophilin-like_dom.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR016304. Cyclophilin-type_PPIase_E.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view ]
Pfami PF00160. Pro_isomerase. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view ]
PIRSFi PIRSF001475. PPI_cyclophilin_E. 1 hit.
PRINTSi PR00153. CSAPPISMRASE.
SMARTi SM00360. RRM. 1 hit.
[Graphical view ]
SUPFAMi SSF50891. SSF50891. 1 hit.
PROSITEi PS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS50102. RRM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Co-amplification of a novel cyclophilin-like gene (PPIE) with L-myc in small cell lung cancer cell lines."
    Kim J.-O., Nau M.M., Allikian K.A., Makela T.P., Alitalo K., Johnson B.E., Kelley M.J.
    Oncogene 17:1019-1026(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
  2. Slater C., Thill G., Obar R.
    Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
  3. Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Huang B., Lin L., Yang S.
    Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Tissue: Brain.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Tissue: Bone marrow, Colon and Lung.
  8. "A nuclear RNA-binding cyclophilin in human T cells."
    Mi H., Kops O., Zimmermann E., Jaeschke A., Tropschug M.
    FEBS Lett. 398:201-205(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  9. "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis."
    Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J.
    RNA 8:426-439(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPLICEOSOMAL C COMPLEX.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Solution structure of the RNA recognition motif in peptidyl-prolyl cis-trans isomerase E."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1-89.

Entry informationi

Entry nameiPPIE_HUMAN
AccessioniPrimary (citable) accession number: Q9UNP9
Secondary accession number(s): B2R971
, O43634, O43635, Q32Q72, Q3S611, Q5TGA0, Q5TGA2, Q5TGA3, Q9UIZ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi