Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UNP9 (PPIE_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 143. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Peptidyl-prolyl cis-trans isomerase E

Short name=PPIase E
EC=5.2.1.8
Alternative name(s):
Cyclophilin E
Cyclophilin-33
Rotamase E
Gene names
Name:PPIE
Synonyms:CYP33
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length301 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.

Catalytic activity

Peptidylproline (omega=180) = peptidylproline (omega=0).

Subunit structure

Identified in the spliceosome C complex. Ref.9

Subcellular location

Nucleus.

Tissue specificity

Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence similarities

Belongs to the cyclophilin-type PPIase family. PPIase E subfamily.

Contains 1 PPIase cyclophilin-type domain.

Contains 1 RRM (RNA recognition motif) domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

KMT2AQ031644EBI-591818,EBI-591370
XAB2Q9HCS73EBI-591818,EBI-295232

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: Q9UNP9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: Q9UNP9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → KQEESAITSQPRSWKLT
Isoform 3 (identifier: Q9UNP9-3)

Also known as: Cyclophilin-33B;

The sequence of this isoform differs from the canonical sequence as follows:
     280-301: AQGSKDGKPKQKVIIADCGEYV → VAPDTKASKARGSRKNKDGQERNWGKSQKVESHTI

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 301301Peptidyl-prolyl cis-trans isomerase E
PRO_0000064157

Regions

Domain6 – 8479RRM
Domain143 – 299157PPIase cyclophilin-type
Compositional bias60 – 634Poly-Ala

Natural variations

Alternative sequence280 – 30122AQGSK…CGEYV → VAPDTKASKARGSRKNKDGQ ERNWGKSQKVESHTI in isoform 3.
VSP_046370
Alternative sequence280 – 30122AQGSK…CGEYV → KQEESAITSQPRSWKLT in isoform B.
VSP_005181

Experimental info

Sequence conflict1511K → R in AAZ93379. Ref.3
Sequence conflict2071N → D in AAZ93379. Ref.3
Sequence conflict2871K → N in AAC00006. Ref.2

Secondary structure

................................................ 301
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: F3226149A790BA42

FASTA30133,431
        10         20         30         40         50         60 
MATTKRVLYV GGLAEEVDDK VLHAAFIPFG DITDIQIPLD YETEKHRGFA FVEFELAEDA 

        70         80         90        100        110        120 
AAAIDNMNES ELFGRTIRVN LAKPMRIKEG SSRPVWSDDD WLKKFSGKTL EENKEEEGSE 

       130        140        150        160        170        180 
PPKAETQEGE PIAKKARSNP QVYMDIKIGN KPAGRIQMLL RSDVVPMTAE NFRCLCTHEK 

       190        200        210        220        230        240 
GFGFKGSSFH RIIPQFMCQG GDFTNHNGTG GKSIYGKKFD DENFILKHTG PGLLSMANSG 

       250        260        270        280        290        300 
PNTNGSQFFL TCDKTDWLDG KHVVFGEVTE GLDVLRQIEA QGSKDGKPKQ KVIIADCGEY 


V 

« Hide

Isoform B [UniParc].

Checksum: B70A7F239825B54D
Show »

FASTA29633,085
Isoform 3 (Cyclophilin-33B) [UniParc].

Checksum: C5D0CFB2673046D7
Show »

FASTA31434,991

References

« Hide 'large scale' references
[1]"Co-amplification of a novel cyclophilin-like gene (PPIE) with L-myc in small cell lung cancer cell lines."
Kim J.-O., Nau M.M., Allikian K.A., Makela T.P., Alitalo K., Johnson B.E., Kelley M.J.
Oncogene 17:1019-1026(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
[2]Slater C., Thill G., Obar R.
Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
[3]Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Huang B., Lin L., Yang S.
Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
Tissue: Brain.
[5]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
Tissue: Bone marrow, Colon and Lung.
[8]"A nuclear RNA-binding cyclophilin in human T cells."
Mi H., Kops O., Zimmermann E., Jaeschke A., Tropschug M.
FEBS Lett. 398:201-205(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[9]"Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis."
Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J.
RNA 8:426-439(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPLICEOSOMAL C COMPLEX.
[10]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Solution structure of the RNA recognition motif in peptidyl-prolyl cis-trans isomerase E."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2005) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 1-89.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF104012 mRNA. Translation: AAD19906.1.
AF104013 mRNA. Translation: AAD19907.1.
AF042385 mRNA. Translation: AAC00006.1.
AF042386 mRNA. Translation: AAC00007.1.
DQ160195 mRNA. Translation: AAZ93379.1.
AK313666 mRNA. Translation: BAG36418.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19347.1.
AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19348.1.
AL049824, AL035404 Genomic DNA. Translation: CAI19350.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19409.1.
AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19410.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19576.1.
AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19577.1.
AL035404, AL049824 Genomic DNA. Translation: CAI19579.1.
CH471059 Genomic DNA. Translation: EAX07255.1.
BC004898 mRNA. Translation: AAH04898.1.
BC008451 mRNA. Translation: AAH08451.1.
BC107736 mRNA. Translation: AAI07737.1.
PIRS66681.
RefSeqNP_001181936.1. NM_001195007.1.
NP_006103.1. NM_006112.3.
NP_982281.1. NM_203456.2.
UniGeneHs.524690.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1ZMFX-ray1.88A137-301[»]
2CQBNMR-A1-89[»]
2KU7NMR-A2-82[»]
2KYXNMR-A3-83[»]
2R99X-ray1.61A131-301[»]
3LPYX-ray2.00A/B5-82[»]
3MDFX-ray1.85A/B1-83[»]
3UCHX-ray2.50A129-301[»]
ProteinModelPortalQ9UNP9.
SMRQ9UNP9. Positions 1-108, 138-301.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115714. 12 interactions.
IntActQ9UNP9. 10 interactions.
MINTMINT-3082792.
STRING9606.ENSP00000312769.

PTM databases

PhosphoSiteQ9UNP9.

Polymorphism databases

DMDM13124097.

Proteomic databases

PaxDbQ9UNP9.
PRIDEQ9UNP9.

Protocols and materials databases

DNASU10450.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000324379; ENSP00000312769; ENSG00000084072. [Q9UNP9-1]
ENST00000356511; ENSP00000348904; ENSG00000084072. [Q9UNP9-2]
ENST00000372830; ENSP00000361918; ENSG00000084072. [Q9UNP9-3]
GeneID10450.
KEGGhsa:10450.
UCSCuc001cds.2. human. [Q9UNP9-1]
uc001cdv.3. human. [Q9UNP9-2]

Organism-specific databases

CTD10450.
GeneCardsGC01P040157.
HGNCHGNC:9258. PPIE.
HPAHPA020131.
MIM602435. gene.
neXtProtNX_Q9UNP9.
PharmGKBPA33583.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0724.
HOVERGENHBG001065.
KOK09564.
OMAAFIEFEL.
PhylomeDBQ9UNP9.
TreeFamTF313817.

Gene expression databases

ArrayExpressQ9UNP9.
BgeeQ9UNP9.
CleanExHS_PPIE.
GenevestigatorQ9UNP9.

Family and domain databases

Gene3D3.30.70.330. 1 hit.
InterProIPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR016304. Cyclophilin-type_PPIase_E.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamPF00160. Pro_isomerase. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFPIRSF001475. PPI_cyclophilin_E. 1 hit.
PRINTSPR00153. CSAPPISMRASE.
SMARTSM00360. RRM. 1 hit.
[Graphical view]
PROSITEPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS50102. RRM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPPIE. human.
EvolutionaryTraceQ9UNP9.
GeneWikiPPIE_(gene).
GenomeRNAi10450.
NextBio39609.
PROQ9UNP9.
SOURCESearch...

Entry information

Entry namePPIE_HUMAN
AccessionPrimary (citable) accession number: Q9UNP9
Secondary accession number(s): B2R971 expand/collapse secondary AC list , O43634, O43635, Q32Q72, Q3S611, Q5TGA0, Q5TGA2, Q5TGA3, Q9UIZ5
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: April 16, 2014
This is version 143 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM