Q9UNP9 (PPIE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Peptidyl-prolyl cis-trans isomerase E Short name=PPIase E EC=5.2.1.8 Alternative name(s): Cyclophilin E Cyclophilin-33 Rotamase E | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 301 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing. |
| Catalytic activity | Peptidylproline (omega=180) = peptidylproline (omega=0). |
| Subunit structure | Identified in the spliceosome C complex. Ref.9 |
| Subcellular location | |
| Tissue specificity | Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
| Sequence similarities | Belongs to the cyclophilin-type PPIase family. PPIase E subfamily. Contains 1 PPIase cyclophilin-type domain. Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MLL | Q03164 | 5 | EBI-591818,EBI-591370 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9UNP9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9UNP9-2) The sequence of this isoform differs from the canonical sequence as follows: 280-301: AQGSKDGKPKQKVIIADCGEYV → KQEESAITSQPRSWKLT | ||||||
| Isoform 3 (identifier: Q9UNP9-3) Also known as: Cyclophilin-33B; The sequence of this isoform differs from the canonical sequence as follows: 280-301: AQGSKDGKPKQKVIIADCGEYV → VAPDTKASKARGSRKNKDGQERNWGKSQKVESHTI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 301 | 301 | Peptidyl-prolyl cis-trans isomerase E | PRO_0000064157 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 6 – 84 | 79 | RRM | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 143 – 299 | 157 | PPIase cyclophilin-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 60 – 63 | 4 | Poly-Ala | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 280 – 301 | 22 | AQGSK…CGEYV → VAPDTKASKARGSRKNKDGQ ERNWGKSQKVESHTI in isoform 3. | VSP_046370 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 280 – 301 | 22 | AQGSK…CGEYV → KQEESAITSQPRSWKLT in isoform B. | VSP_005181 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 151 | 1 | K → R in AAZ93379. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 207 | 1 | N → D in AAZ93379. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 287 | 1 | K → N in AAC00006. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 5 – 11 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 19 – 26 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 27 – 29 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 32 – 36 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 41 – 43 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 56 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 57 – 67 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 78 – 81 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 148 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 160 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 162 – 164 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 166 – 177 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 178 – 180 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 193 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 194 – 196 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 200 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 203 – 205 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 209 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 217 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 230 – 236 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 248 – 253 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 258 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 259 – 261 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 264 – 270 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 272 – 279 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 292 – 299 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Co-amplification of a novel cyclophilin-like gene (PPIE) with L-myc in small cell lung cancer cell lines." Kim J.-O., Nau M.M., Allikian K.A., Makela T.P., Alitalo K., Johnson B.E., Kelley M.J. Oncogene 17:1019-1026(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). |
| [2] | Slater C., Thill G., Obar R. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). |
| [3] | Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Huang B., Lin L., Yang S. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Brain. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Bone marrow, Colon and Lung. |
| [8] | "A nuclear RNA-binding cyclophilin in human T cells." Mi H., Kops O., Zimmermann E., Jaeschke A., Tropschug M. FEBS Lett. 398:201-205(1996) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION. |
| [9] | "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. RNA 8:426-439(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPLICEOSOMAL C COMPLEX. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Solution structure of the RNA recognition motif in peptidyl-prolyl cis-trans isomerase E." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1-89. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF104012 mRNA. Translation: AAD19906.1. AF104013 mRNA. Translation: AAD19907.1. AF042385 mRNA. Translation: AAC00006.1. AF042386 mRNA. Translation: AAC00007.1. DQ160195 mRNA. Translation: AAZ93379.1. AK313666 mRNA. Translation: BAG36418.1. AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19347.1. AL049824, AL033527, AL035404 Genomic DNA. Translation: CAI19348.1. AL049824, AL035404 Genomic DNA. Translation: CAI19350.1. AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19409.1. AL033527, AL035404, AL049824 Genomic DNA. Translation: CAI19410.1. AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19576.1. AL035404, AL033527, AL049824 Genomic DNA. Translation: CAI19577.1. AL035404, AL049824 Genomic DNA. Translation: CAI19579.1. CH471059 Genomic DNA. Translation: EAX07255.1. BC004898 mRNA. Translation: AAH04898.1. BC008451 mRNA. Translation: AAH08451.1. BC107736 mRNA. Translation: AAI07737.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00009316. IPI00220188. IPI00514173. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S66681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_006103.1. NM_006112.3. NP_982281.1. NM_203456.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.524690. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9UNP9. 8 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000312769. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 13124097. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 10450. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000324379; ENSP00000312769; ENSG00000084072. ENST00000356511; ENSP00000348904; ENSG00000084072. ENST00000372830; ENSP00000361918; ENSG00000084072. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 10450. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:10450. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001cds.2. human. uc001cdv.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 10450. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P040157. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9258. PPIE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA020131. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602435. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33583. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0724. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001065. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K09564. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4STS55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PPIE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000084072. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.70.330. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002130. Cyclophilin-like_PPIase_dom. IPR020892. Cyclophilin-type_PPIase_CS. IPR016304. Cyclophilin-type_PPIase_E. IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00160. Pro_isomerase. 1 hit. PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF001475. PPI_cyclophilin_E. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00153. CSAPPISMRASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50891. CSA_PPIase. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00170. CSA_PPIASE_1. 1 hit. PS50072. CSA_PPIASE_2. 1 hit. PS50102. RRM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PPIE. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9UNP9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 10450. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 39609. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PPIE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UNP9 Secondary accession number(s): B2R971 Q9UIZ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
