Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-7

Gene

SNX7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in several stages of intracellular trafficking.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei73Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei99Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei108Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei117Phosphatidylinositol 3-phosphateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-7
Gene namesi
Name:SNX7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:14971. SNX7.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51375.
OpenTargetsiENSG00000162627.
PharmGKBiPA37947.

Polymorphism and mutation databases

BioMutaiSNX7.
DMDMi12643904.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002138481 – 387Sorting nexin-7Add BLAST387

Proteomic databases

EPDiQ9UNH6.
PaxDbiQ9UNH6.
PeptideAtlasiQ9UNH6.
PRIDEiQ9UNH6.

PTM databases

iPTMnetiQ9UNH6.
PhosphoSitePlusiQ9UNH6.

Expressioni

Gene expression databases

BgeeiENSG00000162627.
CleanExiHS_SNX7.
ExpressionAtlasiQ9UNH6. baseline and differential.
GenevisibleiQ9UNH6. HS.

Organism-specific databases

HPAiHPA037419.
HPA054338.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119508. 11 interactors.
IntActiQ9UNH6. 16 interactors.
MINTiMINT-1448465.
STRINGi9606.ENSP00000304429.

Structurei

Secondary structure

1387
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi33 – 43Combined sources11
Beta strandi48 – 58Combined sources11
Beta strandi60 – 64Combined sources5
Beta strandi67 – 73Combined sources7
Helixi74 – 87Combined sources14
Helixi107 – 109Combined sources3
Helixi111 – 130Combined sources20
Helixi134 – 136Combined sources3
Helixi138 – 145Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
ProteinModelPortaliQ9UNH6.
SMRiQ9UNH6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UNH6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 151PXPROSITE-ProRule annotationAdd BLAST122

Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

eggNOGiKOG2273. Eukaryota.
COG5391. LUCA.
GeneTreeiENSGT00870000136412.
HOVERGENiHBG009723.
InParanoidiQ9UNH6.
KOiK17921.
OMAiIDKCCKA.
OrthoDBiEOG091G08JS.
PhylomeDBiQ9UNH6.
TreeFamiTF328543.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
3.30.1520.10. 1 hit.
InterProiView protein in InterPro
IPR027267. AH/BAR-dom.
IPR001683. Phox.
IPR028656. SNX7.
PANTHERiPTHR10555:SF188. PTHR10555:SF188. 1 hit.
PfamiView protein in Pfam
PF00787. PX. 1 hit.
SMARTiView protein in SMART
SM00312. PX. 1 hit.
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiView protein in PROSITE
PS50195. PX. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UNH6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDMNSFSPMM PTSPLSMINQ IKFEDEPDLK DLFITVDEPE SHVTTIETFI
60 70 80 90 100
TYRIITKTSR GEFDSSEFEV RRRYQDFLWL KGKLEEAHPT LIIPPLPEKF
110 120 130 140 150
IVKGMVERFN DDFIETRRKA LHKFLNRIAD HPTLTFNEDF KIFLTAQAWE
160 170 180 190 200
LSSHKKQGPG LLSRMGQTVR AVASSMRGVK NRPEEFMEMN NFIELFSQKI
210 220 230 240 250
NLIDKISQRI YKEEREYFDE MKEYGPIHIL WSASEEDLVD TLKDVASCID
260 270 280 290 300
RCCKATEKRM SGLSEALLPV VHEYVLYSEM LMGVMKRRDQ IQAELDSKVE
310 320 330 340 350
VLTYKKADTD LLPEEIGKLE DKVECANNAL KADWERWKQN MQNDIKLAFT
360 370 380
DMAEENIHYY EQCLATWESF LTSQTNLHLE EASEDKP
Length:387
Mass (Da):45,303
Last modified:May 1, 2000 - v1
Checksum:iE703B3EC6013DC1F
GO
Isoform 2 (identifier: Q9UNH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-362: Missing.

Show »
Length:336
Mass (Da):39,207
Checksum:iAAE0BE2FA7BF4616
GO
Isoform 3 (identifier: Q9UNH6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSKDASLM

Show »
Length:451
Mass (Da):51,619
Checksum:i9BCBE544F8C3AAA4
GO

Sequence cautioni

The sequence AAD27830 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD96949 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti59S → T in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti105M → I in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti108 – 109RF → PG in CN483413 (Ref. 8) Curated2
Sequence conflicti153S → P in AAH10349 (PubMed:15489334).Curated1
Sequence conflicti165M → T in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti199K → R in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti324E → G in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti370F → L in CAB43229 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057331186F → L. Corresponds to variant dbSNP:rs35391040Ensembl.1
Natural variantiVAR_057332278S → N. Corresponds to variant dbSNP:rs12033678Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0390441M → MEGERRASQAPSSGLPAGGA NGESPGGGAPFPGSSGSSAL LQAEVLDLDEDEDDLEVFSK DASLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_006191312 – 362Missing in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA. Translation: AAP35393.1.
AK223229 mRNA. Translation: BAD96949.1. Different initiation.
AK293018 mRNA. Translation: BAF85707.1.
AL627442 Genomic DNA. Translation: CAH72125.2.
AL627442 Genomic DNA. Translation: CAH72126.1.
CH471097 Genomic DNA. Translation: EAW72995.1.
CH471097 Genomic DNA. Translation: EAW72996.1.
CH471097 Genomic DNA. Translation: EAW72997.1.
CH471097 Genomic DNA. Translation: EAW72998.1.
BC010349 mRNA. Translation: AAH10349.1.
BC018105 mRNA. Translation: AAH18105.1.
AF121857 mRNA. Translation: AAD27830.1. Different initiation.
AL049989 mRNA. Translation: CAB43229.1.
CN483413 mRNA. No translation available.
CCDSiCCDS755.2. [Q9UNH6-3]
RefSeqiNP_057060.2. NM_015976.4. [Q9UNH6-3]
NP_689424.2. NM_152238.3.
XP_006710741.1. XM_006710678.2. [Q9UNH6-1]
XP_011539866.1. XM_011541564.2. [Q9UNH6-1]
XP_016856914.1. XM_017001425.1. [Q9UNH6-1]
XP_016856915.1. XM_017001426.1. [Q9UNH6-1]
XP_016856916.1. XM_017001427.1. [Q9UNH6-1]
XP_016856917.1. XM_017001428.1. [Q9UNH6-2]
UniGeneiHs.197015.

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627. [Q9UNH6-3]
GeneIDi51375.
KEGGihsa:51375.
UCSCiuc010ouc.3. human. [Q9UNH6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA. Translation: AAP35393.1.
AK223229 mRNA. Translation: BAD96949.1. Different initiation.
AK293018 mRNA. Translation: BAF85707.1.
AL627442 Genomic DNA. Translation: CAH72125.2.
AL627442 Genomic DNA. Translation: CAH72126.1.
CH471097 Genomic DNA. Translation: EAW72995.1.
CH471097 Genomic DNA. Translation: EAW72996.1.
CH471097 Genomic DNA. Translation: EAW72997.1.
CH471097 Genomic DNA. Translation: EAW72998.1.
BC010349 mRNA. Translation: AAH10349.1.
BC018105 mRNA. Translation: AAH18105.1.
AF121857 mRNA. Translation: AAD27830.1. Different initiation.
AL049989 mRNA. Translation: CAB43229.1.
CN483413 mRNA. No translation available.
CCDSiCCDS755.2. [Q9UNH6-3]
RefSeqiNP_057060.2. NM_015976.4. [Q9UNH6-3]
NP_689424.2. NM_152238.3.
XP_006710741.1. XM_006710678.2. [Q9UNH6-1]
XP_011539866.1. XM_011541564.2. [Q9UNH6-1]
XP_016856914.1. XM_017001425.1. [Q9UNH6-1]
XP_016856915.1. XM_017001426.1. [Q9UNH6-1]
XP_016856916.1. XM_017001427.1. [Q9UNH6-1]
XP_016856917.1. XM_017001428.1. [Q9UNH6-2]
UniGeneiHs.197015.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
ProteinModelPortaliQ9UNH6.
SMRiQ9UNH6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119508. 11 interactors.
IntActiQ9UNH6. 16 interactors.
MINTiMINT-1448465.
STRINGi9606.ENSP00000304429.

PTM databases

iPTMnetiQ9UNH6.
PhosphoSitePlusiQ9UNH6.

Polymorphism and mutation databases

BioMutaiSNX7.
DMDMi12643904.

Proteomic databases

EPDiQ9UNH6.
PaxDbiQ9UNH6.
PeptideAtlasiQ9UNH6.
PRIDEiQ9UNH6.

Protocols and materials databases

DNASUi51375.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627. [Q9UNH6-3]
GeneIDi51375.
KEGGihsa:51375.
UCSCiuc010ouc.3. human. [Q9UNH6-1]

Organism-specific databases

CTDi51375.
DisGeNETi51375.
GeneCardsiSNX7.
HGNCiHGNC:14971. SNX7.
HPAiHPA037419.
HPA054338.
MIMi614904. gene.
neXtProtiNX_Q9UNH6.
OpenTargetsiENSG00000162627.
PharmGKBiPA37947.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2273. Eukaryota.
COG5391. LUCA.
GeneTreeiENSGT00870000136412.
HOVERGENiHBG009723.
InParanoidiQ9UNH6.
KOiK17921.
OMAiIDKCCKA.
OrthoDBiEOG091G08JS.
PhylomeDBiQ9UNH6.
TreeFamiTF328543.

Miscellaneous databases

ChiTaRSiSNX7. human.
EvolutionaryTraceiQ9UNH6.
GenomeRNAii51375.
PROiPR:Q9UNH6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162627.
CleanExiHS_SNX7.
ExpressionAtlasiQ9UNH6. baseline and differential.
GenevisibleiQ9UNH6. HS.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
3.30.1520.10. 1 hit.
InterProiView protein in InterPro
IPR027267. AH/BAR-dom.
IPR001683. Phox.
IPR028656. SNX7.
PANTHERiPTHR10555:SF188. PTHR10555:SF188. 1 hit.
PfamiView protein in Pfam
PF00787. PX. 1 hit.
SMARTiView protein in SMART
SM00312. PX. 1 hit.
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiView protein in PROSITE
PS50195. PX. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSNX7_HUMAN
AccessioniPrimary (citable) accession number: Q9UNH6
Secondary accession number(s): A8KAF3
, D3DT50, Q53FQ3, Q5VT09, Q5VT10, Q86U82, Q8WVD4, Q96FW9, Q9Y3Z7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: April 12, 2017
This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.