Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-7

Gene

SNX7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in several stages of intracellular trafficking.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei73 – 731Phosphatidylinositol 3-phosphateBy similarity
Binding sitei99 – 991Phosphatidylinositol 3-phosphateBy similarity
Binding sitei108 – 1081Phosphatidylinositol 3-phosphateBy similarity
Binding sitei117 – 1171Phosphatidylinositol 3-phosphateBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-7
Gene namesi
Name:SNX7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:14971. SNX7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37947.

Polymorphism and mutation databases

BioMutaiSNX7.
DMDMi12643904.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 387387Sorting nexin-7PRO_0000213848Add
BLAST

Proteomic databases

EPDiQ9UNH6.
MaxQBiQ9UNH6.
PaxDbiQ9UNH6.
PRIDEiQ9UNH6.

PTM databases

iPTMnetiQ9UNH6.
PhosphoSiteiQ9UNH6.

Expressioni

Gene expression databases

BgeeiQ9UNH6.
CleanExiHS_SNX7.
ExpressionAtlasiQ9UNH6. baseline and differential.
GenevisibleiQ9UNH6. HS.

Organism-specific databases

HPAiHPA037419.
HPA054338.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
HGSO149643EBI-751422,EBI-740220
SNX4O952192EBI-751422,EBI-724909
TEX11Q8IYF34EBI-751422,EBI-742397

Protein-protein interaction databases

BioGridi119508. 11 interactions.
IntActiQ9UNH6. 14 interactions.
MINTiMINT-1448465.
STRINGi9606.ENSP00000304429.

Structurei

Secondary structure

1
387
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi33 – 4311Combined sources
Beta strandi48 – 5811Combined sources
Beta strandi60 – 645Combined sources
Beta strandi67 – 737Combined sources
Helixi74 – 8714Combined sources
Helixi107 – 1093Combined sources
Helixi111 – 13020Combined sources
Helixi134 – 1363Combined sources
Helixi138 – 1458Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
ProteinModelPortaliQ9UNH6.
SMRiQ9UNH6. Positions 25-150.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UNH6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini30 – 151122PXPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the sorting nexin family.Curated
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2273. Eukaryota.
COG5391. LUCA.
GeneTreeiENSGT00840000129805.
HOVERGENiHBG009723.
InParanoidiQ9UNH6.
KOiK17921.
OMAiIDKCCKA.
PhylomeDBiQ9UNH6.
TreeFamiTF328543.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
InterProiIPR001683. Phox.
IPR028656. SNX7.
[Graphical view]
PANTHERiPTHR10555:SF21. PTHR10555:SF21. 1 hit.
PfamiPF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS50195. PX. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UNH6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDMNSFSPMM PTSPLSMINQ IKFEDEPDLK DLFITVDEPE SHVTTIETFI
60 70 80 90 100
TYRIITKTSR GEFDSSEFEV RRRYQDFLWL KGKLEEAHPT LIIPPLPEKF
110 120 130 140 150
IVKGMVERFN DDFIETRRKA LHKFLNRIAD HPTLTFNEDF KIFLTAQAWE
160 170 180 190 200
LSSHKKQGPG LLSRMGQTVR AVASSMRGVK NRPEEFMEMN NFIELFSQKI
210 220 230 240 250
NLIDKISQRI YKEEREYFDE MKEYGPIHIL WSASEEDLVD TLKDVASCID
260 270 280 290 300
RCCKATEKRM SGLSEALLPV VHEYVLYSEM LMGVMKRRDQ IQAELDSKVE
310 320 330 340 350
VLTYKKADTD LLPEEIGKLE DKVECANNAL KADWERWKQN MQNDIKLAFT
360 370 380
DMAEENIHYY EQCLATWESF LTSQTNLHLE EASEDKP
Length:387
Mass (Da):45,303
Last modified:May 1, 2000 - v1
Checksum:iE703B3EC6013DC1F
GO
Isoform 2 (identifier: Q9UNH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-362: Missing.

Show »
Length:336
Mass (Da):39,207
Checksum:iAAE0BE2FA7BF4616
GO
Isoform 3 (identifier: Q9UNH6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSKDASLM

Show »
Length:451
Mass (Da):51,619
Checksum:i9BCBE544F8C3AAA4
GO

Sequence cautioni

The sequence AAD27830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD96949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti59 – 591S → T in BAD96949 (PubMed:14702039).Curated
Sequence conflicti105 – 1051M → I in CAB43229 (PubMed:17974005).Curated
Sequence conflicti108 – 1092RF → PG in CN483413 (Ref. 8) Curated
Sequence conflicti153 – 1531S → P in AAH10349 (PubMed:15489334).Curated
Sequence conflicti165 – 1651M → T in CAB43229 (PubMed:17974005).Curated
Sequence conflicti199 – 1991K → R in BAD96949 (PubMed:14702039).Curated
Sequence conflicti324 – 3241E → G in CAB43229 (PubMed:17974005).Curated
Sequence conflicti370 – 3701F → L in CAB43229 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti186 – 1861F → L.
Corresponds to variant rs35391040 [ dbSNP | Ensembl ].
VAR_057331
Natural varianti278 – 2781S → N.
Corresponds to variant rs12033678 [ dbSNP | Ensembl ].
VAR_057332

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEGERRASQAPSSGLPAGGA NGESPGGGAPFPGSSGSSAL LQAEVLDLDEDEDDLEVFSK DASLM in isoform 3. 1 PublicationVSP_039044
Alternative sequencei312 – 36251Missing in isoform 2. 2 PublicationsVSP_006191Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA. Translation: AAP35393.1.
AK223229 mRNA. Translation: BAD96949.1. Different initiation.
AK293018 mRNA. Translation: BAF85707.1.
AL627442 Genomic DNA. Translation: CAH72125.2.
AL627442 Genomic DNA. Translation: CAH72126.1.
CH471097 Genomic DNA. Translation: EAW72995.1.
CH471097 Genomic DNA. Translation: EAW72996.1.
CH471097 Genomic DNA. Translation: EAW72997.1.
CH471097 Genomic DNA. Translation: EAW72998.1.
BC010349 mRNA. Translation: AAH10349.1.
BC018105 mRNA. Translation: AAH18105.1.
AF121857 mRNA. Translation: AAD27830.1. Different initiation.
AL049989 mRNA. Translation: CAB43229.1.
CN483413 mRNA. No translation available.
CCDSiCCDS755.2. [Q9UNH6-3]
RefSeqiNP_057060.2. NM_015976.4. [Q9UNH6-3]
NP_689424.2. NM_152238.3.
XP_006710741.1. XM_006710678.1. [Q9UNH6-1]
XP_011539866.1. XM_011541564.1. [Q9UNH6-1]
UniGeneiHs.197015.

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627. [Q9UNH6-3]
GeneIDi51375.
KEGGihsa:51375.
UCSCiuc010ouc.3. human. [Q9UNH6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA. Translation: AAP35393.1.
AK223229 mRNA. Translation: BAD96949.1. Different initiation.
AK293018 mRNA. Translation: BAF85707.1.
AL627442 Genomic DNA. Translation: CAH72125.2.
AL627442 Genomic DNA. Translation: CAH72126.1.
CH471097 Genomic DNA. Translation: EAW72995.1.
CH471097 Genomic DNA. Translation: EAW72996.1.
CH471097 Genomic DNA. Translation: EAW72997.1.
CH471097 Genomic DNA. Translation: EAW72998.1.
BC010349 mRNA. Translation: AAH10349.1.
BC018105 mRNA. Translation: AAH18105.1.
AF121857 mRNA. Translation: AAD27830.1. Different initiation.
AL049989 mRNA. Translation: CAB43229.1.
CN483413 mRNA. No translation available.
CCDSiCCDS755.2. [Q9UNH6-3]
RefSeqiNP_057060.2. NM_015976.4. [Q9UNH6-3]
NP_689424.2. NM_152238.3.
XP_006710741.1. XM_006710678.1. [Q9UNH6-1]
XP_011539866.1. XM_011541564.1. [Q9UNH6-1]
UniGeneiHs.197015.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
ProteinModelPortaliQ9UNH6.
SMRiQ9UNH6. Positions 25-150.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119508. 11 interactions.
IntActiQ9UNH6. 14 interactions.
MINTiMINT-1448465.
STRINGi9606.ENSP00000304429.

PTM databases

iPTMnetiQ9UNH6.
PhosphoSiteiQ9UNH6.

Polymorphism and mutation databases

BioMutaiSNX7.
DMDMi12643904.

Proteomic databases

EPDiQ9UNH6.
MaxQBiQ9UNH6.
PaxDbiQ9UNH6.
PRIDEiQ9UNH6.

Protocols and materials databases

DNASUi51375.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627. [Q9UNH6-3]
GeneIDi51375.
KEGGihsa:51375.
UCSCiuc010ouc.3. human. [Q9UNH6-1]

Organism-specific databases

CTDi51375.
GeneCardsiSNX7.
HGNCiHGNC:14971. SNX7.
HPAiHPA037419.
HPA054338.
MIMi614904. gene.
neXtProtiNX_Q9UNH6.
PharmGKBiPA37947.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2273. Eukaryota.
COG5391. LUCA.
GeneTreeiENSGT00840000129805.
HOVERGENiHBG009723.
InParanoidiQ9UNH6.
KOiK17921.
OMAiIDKCCKA.
PhylomeDBiQ9UNH6.
TreeFamiTF328543.

Miscellaneous databases

ChiTaRSiSNX7. human.
EvolutionaryTraceiQ9UNH6.
GenomeRNAii51375.
PROiQ9UNH6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UNH6.
CleanExiHS_SNX7.
ExpressionAtlasiQ9UNH6. baseline and differential.
GenevisibleiQ9UNH6. HS.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
InterProiIPR001683. Phox.
IPR028656. SNX7.
[Graphical view]
PANTHERiPTHR10555:SF21. PTHR10555:SF21. 1 hit.
PfamiPF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS50195. PX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Gastric mucosa and Uterus.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Colon.
  6. "A large family of endosome-localized proteins related to sorting nexin 1."
    Teasdale R.D., Loci D., Houghton F., Karlsson L., Gleeson P.A.
    Biochem. J. 358:7-16(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  7. Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  8. "Expressed sequence tag analysis of cultured primary human ocular pericytes."
    Tsai J.Y., Wistow G.
    Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-132 (ISOFORM 3).
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Human sorting nexin 7, phox homology (PX) domain."
    Structural genomics consortium (SGC)
    Submitted (SEP-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 25-154.

Entry informationi

Entry nameiSNX7_HUMAN
AccessioniPrimary (citable) accession number: Q9UNH6
Secondary accession number(s): A8KAF3
, D3DT50, Q53FQ3, Q5VT09, Q5VT10, Q86U82, Q8WVD4, Q96FW9, Q9Y3Z7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: June 8, 2016
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.