Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase CDC14A

Gene

CDC14A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. Dephosphorylates SIRT2 around early anaphase. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.4 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei278Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Biological processi

Cell cycle, Cell division

Enzyme and pathway databases

BioCyciZFISH:HS01322-MONOMER.
ReactomeiR-HSA-176407. Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase.
R-HSA-5687128. MAPK6/MAPK4 signaling.
SIGNORiQ9UNH5.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase CDC14A (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
CDC14 cell division cycle 14 homolog A
Gene namesi
Name:CDC14A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:1718. CDC14A.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: HPA
  • mitotic spindle Source: GO_Central
  • nucleoplasm Source: HPA
  • nucleus Source: ProtInc
  • spindle pole Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi251D → A: Loss of phosphatase activity. 1 Publication1
Mutagenesisi278C → S: Loss of phosphatase activity. 2 Publications1
Mutagenesisi284R → A: Loss of phosphatase activity. 1 Publication1
Mutagenesisi362M → A: Inappropriate nucleolar localization; when associated with A-364. 1 Publication1
Mutagenesisi364I → A: Inappropriate nucleolar localization; when associated with A-362. 1 Publication1

Organism-specific databases

DisGeNETi8556.
OpenTargetsiENSG00000079335.
PharmGKBiPA26254.

Chemistry databases

ChEMBLiCHEMBL1772926.

Polymorphism and mutation databases

BioMutaiCDC14A.
DMDMi55976620.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948761 – 594Dual specificity protein phosphatase CDC14AAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei484PhosphoserineCombined sources1
Modified residuei583PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UNH5.
PaxDbiQ9UNH5.
PeptideAtlasiQ9UNH5.
PRIDEiQ9UNH5.

PTM databases

DEPODiQ9UNH5.
iPTMnetiQ9UNH5.
PhosphoSitePlusiQ9UNH5.

Expressioni

Gene expression databases

BgeeiENSG00000079335.
CleanExiHS_CDC14A.
ExpressionAtlasiQ9UNH5. baseline and differential.
GenevisibleiQ9UNH5. HS.

Organism-specific databases

HPAiHPA023783.

Interactioni

Subunit structurei

Interacts with KIF20A, which is required to localize CDC14 to the midzone of the mitotic spindle.1 Publication

Protein-protein interaction databases

BioGridi114126. 11 interactors.
IntActiQ9UNH5. 1 interactor.
MINTiMINT-8330048.
STRINGi9606.ENSP00000354916.

Chemistry databases

BindingDBiQ9UNH5.

Structurei

3D structure databases

ProteinModelPortaliQ9UNH5.
SMRiQ9UNH5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni7 – 162AAdd BLAST156
Regioni163 – 176LinkerAdd BLAST14
Regioni177 – 343BAdd BLAST167

Domaini

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1720. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiQ9UNH5.
KOiK06639.
OMAiLIGACEF.
OrthoDBiEOG091G04FM.
PhylomeDBiQ9UNH5.
TreeFamiTF101053.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR026070. CDC14.
IPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR23339:SF27. PTHR23339:SF27. 1 hit.
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UNH5-1) [UniParc]FASTAAdd to basket
Also known as: CDC14A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAESGELIG ACEFMKDRLY FATLRNRPKS TVNTHYFSID EELVYENFYA
60 70 80 90 100
DFGPLNLAMV YRYCCKLNKK LKSYSLSRKK IVHYTCFDQR KRANAAFLIG
110 120 130 140 150
AYAVIYLKKT PEEAYRALLS GSNPPYLPFR DASFGNCTYN LTILDCLQGI
160 170 180 190 200
RKGLQHGFFD FETFDVDEYE HYERVENGDF NWIVPGKFLA FSGPHPKSKI
210 220 230 240 250
ENGYPLHAPE AYFPYFKKHN VTAVVRLNKK IYEAKRFTDA GFEHYDLFFI
260 270 280 290 300
DGSTPSDNIV RRFLNICENT EGAIAVHCKA GLGRTGTLIA CYVMKHYRFT
310 320 330 340 350
HAEIIAWIRI CRPGSIIGPQ QHFLEEKQAS LWVQGDIFRS KLKNRPSSEG
360 370 380 390 400
SINKILSGLD DMSIGGNLSK TQNMERFGED NLEDDDVEMK NGITQGDKLR
410 420 430 440 450
ALKSQRQPRT SPSCAFRSDD TKGHPRAVSQ PFRLSSSLQG SAVTLKTSKM
460 470 480 490 500
ALSPSATAKR INRTSLSSGA TVRSFSINSR LASSLGNLNA ATDDPENKKT
510 520 530 540 550
SSSSKAGFTA SPFTNLLNGS SQPTTRNYPE LNNNQYNRSS NSNGGNLNSP
560 570 580 590
PGPHSAKTEE HTTILRPSYT GLSSSSARFL SRSIPSLQSE YVHY
Length:594
Mass (Da):66,574
Last modified:May 1, 2000 - v1
Checksum:iD5552E2BAEEA84DF
GO
Isoform 2 (identifier: Q9UNH5-2) [UniParc]FASTAAdd to basket
Also known as: CDC14A2

The sequence of this isoform differs from the canonical sequence as follows:
     586-594: SLQSEYVHY → VSAQTPPPGPQNPECNFCALPSQPRLPPKKFNSAKEAF

Show »
Length:623
Mass (Da):69,543
Checksum:iCAB2041A59DB3350
GO
Isoform 3 (identifier: Q9UNH5-3) [UniParc]FASTAAdd to basket
Also known as: CDC14A3

The sequence of this isoform differs from the canonical sequence as follows:
     380-383: DNLE → VSFP
     384-594: Missing.

Show »
Length:383
Mass (Da):43,908
Checksum:i28295D04793D00B7
GO
Isoform 4 (identifier: Q9UNH5-4) [UniParc]FASTAAdd to basket
Also known as: CDC14A4

The sequence of this isoform differs from the canonical sequence as follows:
     174-191: RVENGDFNWIVPGKFLAF → VILFTPLKPTFLISKSIM
     192-594: Missing.

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):22,175
Checksum:i14E97BCF291E4D81
GO
Isoform 5 (identifier: Q9UNH5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-594: SLQSEYVHY → CSCLLLVFRKPFLGSPLLSLPISHL

Show »
Length:610
Mass (Da):68,203
Checksum:iCA0AC7B44CAE4947
GO

Sequence cautioni

The sequence AAB88277 differs from that shown. Reason: Frameshift at position 6.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti164F → I in AAB88277 (PubMed:9367992).Curated1
Sequence conflicti182W → C in AAB88277 (PubMed:9367992).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_019957345R → Q.1 PublicationCorresponds to variant rs28364897dbSNPEnsembl.1
Natural variantiVAR_035655493D → Y in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_019958589S → F.1 PublicationCorresponds to variant rs28364923dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012322174 – 191RVENG…KFLAF → VILFTPLKPTFLISKSIM in isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_012323192 – 594Missing in isoform 4. 1 PublicationAdd BLAST403
Alternative sequenceiVSP_012035380 – 383DNLE → VSFP in isoform 3. 2 Publications4
Alternative sequenceiVSP_012036384 – 594Missing in isoform 3. 2 PublicationsAdd BLAST211
Alternative sequenceiVSP_012037586 – 594SLQSEYVHY → VSAQTPPPGPQNPECNFCAL PSQPRLPPKKFNSAKEAF in isoform 2. 1 Publication9
Alternative sequenceiVSP_047597586 – 594SLQSEYVHY → CSCLLLVFRKPFLGSPLLSL PISHL in isoform 5. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000367 mRNA. Translation: AAB88277.1. Frameshift.
AF122013 mRNA. Translation: AAD49217.1.
AF064102 mRNA. Translation: AAC16659.1.
AF064103 mRNA. Translation: AAC16660.1.
DQ530256 mRNA. Translation: ABF74568.1.
AY623111 Genomic DNA. Translation: AAT38107.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70068.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70069.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70070.1.
CH471097 Genomic DNA. Translation: EAW72956.1.
CH471097 Genomic DNA. Translation: EAW72958.1.
CH471097 Genomic DNA. Translation: EAW72959.1.
BC038979 mRNA. Translation: AAH38979.1.
BC093916 mRNA. Translation: AAH93916.1.
BC093918 mRNA. Translation: AAH93918.1.
CCDSiCCDS769.1. [Q9UNH5-1]
CCDS770.1. [Q9UNH5-2]
CCDS771.1. [Q9UNH5-3]
RefSeqiNP_001306139.1. NM_001319210.1. [Q9UNH5-5]
NP_001306140.1. NM_001319211.1.
NP_001306141.1. NM_001319212.1.
NP_003663.2. NM_003672.3. [Q9UNH5-1]
NP_201569.1. NM_033312.2. [Q9UNH5-2]
NP_201570.1. NM_033313.2. [Q9UNH5-3]
UniGeneiHs.127411.

Genome annotation databases

EnsembliENST00000336454; ENSP00000336739; ENSG00000079335. [Q9UNH5-1]
ENST00000361544; ENSP00000354916; ENSG00000079335. [Q9UNH5-2]
ENST00000370124; ENSP00000359142; ENSG00000079335. [Q9UNH5-3]
GeneIDi8556.
KEGGihsa:8556.
UCSCiuc001dte.5. human. [Q9UNH5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000367 mRNA. Translation: AAB88277.1. Frameshift.
AF122013 mRNA. Translation: AAD49217.1.
AF064102 mRNA. Translation: AAC16659.1.
AF064103 mRNA. Translation: AAC16660.1.
DQ530256 mRNA. Translation: ABF74568.1.
AY623111 Genomic DNA. Translation: AAT38107.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70068.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70069.1.
AL589990, AC104457 Genomic DNA. Translation: CAH70070.1.
CH471097 Genomic DNA. Translation: EAW72956.1.
CH471097 Genomic DNA. Translation: EAW72958.1.
CH471097 Genomic DNA. Translation: EAW72959.1.
BC038979 mRNA. Translation: AAH38979.1.
BC093916 mRNA. Translation: AAH93916.1.
BC093918 mRNA. Translation: AAH93918.1.
CCDSiCCDS769.1. [Q9UNH5-1]
CCDS770.1. [Q9UNH5-2]
CCDS771.1. [Q9UNH5-3]
RefSeqiNP_001306139.1. NM_001319210.1. [Q9UNH5-5]
NP_001306140.1. NM_001319211.1.
NP_001306141.1. NM_001319212.1.
NP_003663.2. NM_003672.3. [Q9UNH5-1]
NP_201569.1. NM_033312.2. [Q9UNH5-2]
NP_201570.1. NM_033313.2. [Q9UNH5-3]
UniGeneiHs.127411.

3D structure databases

ProteinModelPortaliQ9UNH5.
SMRiQ9UNH5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114126. 11 interactors.
IntActiQ9UNH5. 1 interactor.
MINTiMINT-8330048.
STRINGi9606.ENSP00000354916.

Chemistry databases

BindingDBiQ9UNH5.
ChEMBLiCHEMBL1772926.

PTM databases

DEPODiQ9UNH5.
iPTMnetiQ9UNH5.
PhosphoSitePlusiQ9UNH5.

Polymorphism and mutation databases

BioMutaiCDC14A.
DMDMi55976620.

Proteomic databases

EPDiQ9UNH5.
PaxDbiQ9UNH5.
PeptideAtlasiQ9UNH5.
PRIDEiQ9UNH5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336454; ENSP00000336739; ENSG00000079335. [Q9UNH5-1]
ENST00000361544; ENSP00000354916; ENSG00000079335. [Q9UNH5-2]
ENST00000370124; ENSP00000359142; ENSG00000079335. [Q9UNH5-3]
GeneIDi8556.
KEGGihsa:8556.
UCSCiuc001dte.5. human. [Q9UNH5-1]

Organism-specific databases

CTDi8556.
DisGeNETi8556.
GeneCardsiCDC14A.
HGNCiHGNC:1718. CDC14A.
HPAiHPA023783.
MIMi603504. gene.
neXtProtiNX_Q9UNH5.
OpenTargetsiENSG00000079335.
PharmGKBiPA26254.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1720. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiQ9UNH5.
KOiK06639.
OMAiLIGACEF.
OrthoDBiEOG091G04FM.
PhylomeDBiQ9UNH5.
TreeFamiTF101053.

Enzyme and pathway databases

BioCyciZFISH:HS01322-MONOMER.
ReactomeiR-HSA-176407. Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase.
R-HSA-5687128. MAPK6/MAPK4 signaling.
SIGNORiQ9UNH5.

Miscellaneous databases

GeneWikiiCDC14A.
GenomeRNAii8556.
PROiQ9UNH5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079335.
CleanExiHS_CDC14A.
ExpressionAtlasiQ9UNH5. baseline and differential.
GenevisibleiQ9UNH5. HS.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR026070. CDC14.
IPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR23339:SF27. PTHR23339:SF27. 1 hit.
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCC14A_HUMAN
AccessioniPrimary (citable) accession number: Q9UNH5
Secondary accession number(s): A6MA65
, B1AQ14, B1AQ15, O43171, O60727, O60728, Q52LH9, Q8IXX0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.