Q9UNH5 (CC14A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase CDC14A EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): CDC14 cell division cycle 14 homolog A | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 594 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis. Ref.1 Ref.9 Ref.10 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Interacts with KIF20A, which is required to localize CDC14 to the midzone of the mitotic spindle. Ref.11 |
| Subcellular location | Nucleus. Cytoplasm › cytoskeleton › centrosome. Cytoplasm › cytoskeleton › spindle. Note: Centrosomal during interphase, released into the cytoplasm at the onset of mitosis. Subsequently localizes to the midzone of the mitotic spindle. Ref.1 Ref.8 Ref.9 Ref.10 Ref.11 |
| Domain | Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold By similarity. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily. |
| Sequence caution | The sequence AAB88277.1 differs from that shown. Reason: Frameshift at position 6. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UNH5-1) Also known as: CDC14A1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UNH5-2) Also known as: CDC14A2; The sequence of this isoform differs from the canonical sequence as follows: 586-594: SLQSEYVHY → VSAQTPPPGPQNPECNFCALPSQPRLPPKKFNSAKEAF | ||||||
| Isoform 3 (identifier: Q9UNH5-3) Also known as: CDC14A3; The sequence of this isoform differs from the canonical sequence as follows: 380-383: DNLE → VSFP 384-594: Missing. | ||||||
| Isoform 4 (identifier: Q9UNH5-4) Also known as: CDC14A4; The sequence of this isoform differs from the canonical sequence as follows: 174-191: RVENGDFNWIVPGKFLAF → VILFTPLKPTFLISKSIM 192-594: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 594 | 594 | Dual specificity protein phosphatase CDC14A | PRO_0000094876 | |||||
Regions | |||||||||
| Region | 7 – 162 | 156 | A | ||||||
| Region | 163 – 176 | 14 | Linker | ||||||
| Region | 177 – 343 | 167 | B | ||||||
Sites | |||||||||
| Active site | 278 | 1 | Phosphocysteine intermediate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 174 – 191 | 18 | RVENG…KFLAF → VILFTPLKPTFLISKSIM in isoform 4. | VSP_012322 | |||||
| Alternative sequence | 192 – 594 | 403 | Missing in isoform 4. | VSP_012323 | |||||
| Alternative sequence | 380 – 383 | 4 | DNLE → VSFP in isoform 3. | VSP_012035 | |||||
| Alternative sequence | 384 – 594 | 211 | Missing in isoform 3. | VSP_012036 | |||||
| Alternative sequence | 586 – 594 | 9 | SLQSEYVHY → VSAQTPPPGPQNPECNFCAL PSQPRLPPKKFNSAKEAF in isoform 2. | VSP_012037 | |||||
| Natural variant | 345 | 1 | R → Q. Ref.4 Corresponds to variant rs28364897 [ dbSNP | Ensembl ]. | VAR_019957 | |||||
| Natural variant | 493 | 1 | D → Y in a colorectal cancer sample; somatic mutation. Ref.12 | VAR_035655 | |||||
| Natural variant | 589 | 1 | S → F. Ref.4 Corresponds to variant rs28364923 [ dbSNP | Ensembl ]. | VAR_019958 | |||||
Experimental info | |||||||||
| Mutagenesis | 251 | 1 | D → A: Loss of phosphatase activity. Ref.9 | ||||||
| Mutagenesis | 278 | 1 | C → S: Loss of phosphatase activity. Ref.8 Ref.9 | ||||||
| Mutagenesis | 284 | 1 | R → A: Loss of phosphatase activity. Ref.9 | ||||||
| Mutagenesis | 362 | 1 | M → A: Inappropriate nucleolar localization; when associated with A-364. Ref.10 | ||||||
| Mutagenesis | 364 | 1 | I → A: Inappropriate nucleolar localization; when associated with A-362. Ref.10 | ||||||
| Sequence conflict | 164 | 1 | F → I in AAB88277. Ref.1 | ||||||
| Sequence conflict | 182 | 1 | W → C in AAB88277. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A family of putative tumor suppressors is structurally and functionally conserved in humans and yeast." Li L., Ernsting B.R., Wishart M.J., Lohse D.L., Dixon J.E. J. Biol. Chem. 272:29403-29406(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. |
| [2] | "Genomic structure, chromosomal location, and mutation analysis of the human CDC14A gene." Wong A.K.C., Chen Y., Lian L., Ha P.C., Petersen K., Laity K., Carillo A., Emerson M., Heichman K., Gupte J., Tavtigian S.V., Teng D.H.-F. Genomics 59:248-251(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Hao L., Baskerville C., Charbonneau H. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 2 AND 3). Tissue: Placenta. |
| [4] | NIEHS SNPs program Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-345 AND PHE-589. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| [8] | "Regulation of the anaphase-promoting complex by the dual specificity phosphatase human Cdc14a." Bembenek J., Yu H. J. Biol. Chem. 276:48237-48242(2001) [PubMed] [Europe PMC] [Abstract] Cited for: DEPHOSPHORYLATION OF FZR1, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-278. |
| [9] | "Disruption of centrosome structure, chromosome segregation, and cytokinesis by misexpression of human Cdc14A phosphatase." Kaiser B.K., Zimmerman Z.A., Charbonneau H., Jackson P.K. Mol. Biol. Cell 13:2289-2300(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBSTRATE SPECIFICITY, FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-251; CYS-278 AND ARG-284. |
| [10] | "Deregulated human Cdc14A phosphatase disrupts centrosome separation and chromosome segregation." Mailand N., Lukas C., Kaiser B.K., Jackson P.K., Bartek J., Lukas J. Nat. Cell Biol. 4:317-322(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF MET-362 AND ILE-364. |
| [11] | "Relocation of Aurora B from centromeres to the central spindle at the metaphase to anaphase transition requires MKlp2." Gruneberg U., Neef R., Honda R., Nigg E.A., Barr F.A. J. Cell Biol. 166:167-172(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KIF20A, SUBCELLULAR LOCATION. |
| [12] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] TYR-493. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF000367 mRNA. Translation: AAB88277.1. Frameshift. AF122013 mRNA. Translation: AAD49217.1. AF064102 mRNA. Translation: AAC16659.1. AF064103 mRNA. Translation: AAC16660.1. AY623111 Genomic DNA. Translation: AAT38107.1. AL589990, AC104457 Genomic DNA. Translation: CAH70068.1. AL589990, AC104457 Genomic DNA. Translation: CAH70069.1. AL589990, AC104457 Genomic DNA. Translation: CAH70070.1. CH471097 Genomic DNA. Translation: EAW72956.1. CH471097 Genomic DNA. Translation: EAW72958.1. CH471097 Genomic DNA. Translation: EAW72959.1. BC038979 mRNA. Translation: AAH38979.1. BC093916 mRNA. Translation: AAH93916.1. BC093918 mRNA. Translation: AAH93918.1. |
| IPI | IPI00021145. IPI00031770. IPI00217676. IPI00219831. |
| RefSeq | NP_003663.2. NM_003672.3. NP_201569.1. NM_033312.2. NP_201570.1. NM_033313.2. |
| UniGene | Hs.127411. |
3D structure databases | |
| ProteinModelPortal | Q9UNH5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000354916. |
PTM databases | |
| PhosphoSite | Q9UNH5. |
Polymorphism databases | |
| DMDM | 55976620. |
Proteomic databases | |
| PaxDb | Q9UNH5. |
| PRIDE | Q9UNH5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000336454; ENSP00000336739; ENSG00000079335. ENST00000361544; ENSP00000354916; ENSG00000079335. ENST00000370124; ENSP00000359142; ENSG00000079335. ENST00000370125; ENSP00000359143; ENSG00000079335. |
| GeneID | 8556. |
| KEGG | hsa:8556. |
| UCSC | uc001dtf.2. human. uc001dtg.4. human. uc009wec.1. human. |
Organism-specific databases | |
| CTD | 8556. |
| GeneCards | GC01P100817. |
| HGNC | HGNC:1718. CDC14A. |
| HPA | HPA023783. |
| MIM | 603504. gene. |
| neXtProt | NX_Q9UNH5. |
| PharmGKB | PA26254. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2453. |
| HOVERGEN | HBG050818. |
| KO | K06639. |
| OMA | ACEFMKD. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. |
Gene expression databases | |
| ArrayExpress | Q9UNH5. |
| Bgee | Q9UNH5. |
| CleanEx | HS_CDC14A. |
| Genevestigator | Q9UNH5. |
| GermOnline | ENSG00000079335. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR026068. Dual_Pase_CDC14. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. [Graphical view] |
| PANTHER | PTHR23339:SF27. PTHR23339:SF27. 1 hit. |
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] |
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9UNH5. |
| ChEMBL | CHEMBL1772926. |
| GenomeRNAi | 8556. |
| NextBio | 32065. |
| SOURCE | Search... |
Entry information
| Entry name | CC14A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UNH5 Secondary accession number(s): B1AQ14 Q8IXX0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
