Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquilin-1

Gene

UBQLN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome (PubMed:15147878). Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome (PubMed:19822669, PubMed:18307982). Isoform 1, isoform 2 and isoform 3 play a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress (PubMed:18953672). Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion (PubMed:19148225, PubMed:20529957, PubMed:23459205). Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway (PubMed:21695056). Isoform 1 and isoform 3 play a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis (PubMed:21143716). Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently downregulating the ORAI1-mediated Ca2+ mobilization (PubMed:23307288). Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing (By similarity).1 PublicationBy similarity9 Publications

GO - Molecular functioni

  • kinase binding Source: UniProtKB
  • polyubiquitin binding Source: UniProtKB

GO - Biological processi

  • aggrephagy Source: UniProtKB
  • autophagosome assembly Source: GO_Central
  • autophagosome maturation Source: GO_Central
  • cellular response to hypoxia Source: BHF-UCL
  • ER-associated ubiquitin-dependent protein catabolic process Source: UniProtKB
  • macroautophagy Source: GO_Central
  • negative regulation of store-operated calcium channel activity Source: UniProtKB
  • negative regulation of toll-like receptor 3 signaling pathway Source: Ensembl
  • positive regulation of ER-associated ubiquitin-dependent protein catabolic process Source: UniProtKB
  • positive regulation of protein ubiquitination Source: UniProtKB
  • regulation of oxidative stress-induced intrinsic apoptotic signaling pathway Source: BHF-UCL
  • regulation of protein ubiquitination Source: HGNC
  • response to endoplasmic reticulum stress Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Autophagy

Enzyme and pathway databases

ReactomeiR-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquilin-1
Alternative name(s):
Protein linking IAP with cytoskeleton 1
Short name:
PLIC-1
Short name:
hPLIC-1
Gene namesi
Name:UBQLN1
Synonyms:DA41, PLIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:12508. UBQLN1.

Subcellular locationi

GO - Cellular componenti

  • aggresome Source: UniProtKB
  • autophagosome Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • cytoplasmic vesicle Source: UniProtKB-KW
  • endoplasmic reticulum Source: UniProtKB
  • nucleoplasm Source: HPA
  • perinuclear region of cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB
  • proteasome complex Source: UniProtKB-KW
  • protein complex Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Nucleus, Proteasome

Pathology & Biotechi

Organism-specific databases

DisGeNETi29979.
OpenTargetsiENSG00000135018.
PharmGKBiPA37155.

Polymorphism and mutation databases

BioMutaiUBQLN1.
DMDMi48475013.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002110082 – 589Ubiquilin-1Add BLAST588

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Post-translational modificationi

Degraded during both macroautophagy and during chaperone-mediated autophagy (CMA).1 Publication
Phosphorylated.1 Publication
Ubiquitinated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9UMX0.
PaxDbiQ9UMX0.
PeptideAtlasiQ9UMX0.
PRIDEiQ9UMX0.

2D gel databases

REPRODUCTION-2DPAGEIPI00071180.

PTM databases

iPTMnetiQ9UMX0.
PhosphoSitePlusiQ9UMX0.

Expressioni

Tissue specificityi

Brain (at protein level) (PubMed:18953672). Ubiquitous. Highly expressed throughout the brain; detected in neurons and in neuropathological lesions, such as neurofibrillary tangles and Lewy bodies. Highly expressed in heart, placenta, pancreas, lung, liver, skeletal muscle and kidney.3 Publications

Gene expression databases

BgeeiENSG00000135018.
CleanExiHS_UBQLN1.
ExpressionAtlasiQ9UMX0. baseline and differential.
GenevisibleiQ9UMX0. HS.

Organism-specific databases

HPAiCAB037256.
HPA054143.

Interactioni

Subunit structurei

Monomer and homodimer. Heterodimer with UBQLN2 (PubMed:16813565). Binds CD47, NBL1, GABRA1, GABRA2, GABRA3, GABRA6, GABRB1, GABRB2 and GABRB3 (By similarity). Binds UBE3A, BTRC, P4HB and MTOR. Interacts with the proteasome 19S subunit. Interacts (via ubiquitin-like domain) with TREX1; the interaction is direct and may control TREX1 subcellular location. Forms a complex with UBXN4 and VCP. Interacts (via UBA domain) with UBQLN4 (via ubiquitin-like domain). Found in a complex with UBQLN2 and MAP1LC3A/B/C. The monomeric form interacts with PSEN2 and the monomeric forms of isoform 1 and isoform 3 interact with PSEN1. Interacts with ORAI1. Interacts (via UBA domain) with TICAM1. Interacts with EPS15. Interacts (via UBA domain) with UBA52 and (via ubiquitin-like domain) with PSMD3 and PSMD4. Interacts with HERPUD1. Interacts with MAP1LC3A/B/C in the presence of UBQLN4. Interacts (via ubiquitin-like domain) with EPS15 (via UIM domains) and both the ubiquitinated and non-ubiquitinated forms can interact with EPS15. Interacts (via ubiquitin-like domain) with EPS15L1, HGS (via UIM domain) and STAM2 (via UIM domain).By similarity17 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-741480,EBI-741480
Q8WU023EBI-10173939,EBI-747182
Q96FB23EBI-10173939,EBI-2857623
ACOT7O001543EBI-10173939,EBI-948905
ADRM1Q161864EBI-741480,EBI-954387
AGPAT5Q9NUQ23EBI-741480,EBI-6916385
AGR2O959945EBI-741480,EBI-712648
AGR3Q8TD063EBI-10173939,EBI-3925742
BPIFA1Q9NP553EBI-10173939,EBI-953896
C1QTNF2Q9BXJ53EBI-10173939,EBI-2817707
CALUO438523EBI-10173939,EBI-1171069
CCL7P800983EBI-10173939,EBI-718759
CD99L2Q8TCZ23EBI-10173939,EBI-2824782
COL10A1Q036925EBI-741480,EBI-2528309
COL1A2P081235EBI-741480,EBI-983038
COLGALT2Q8IYK43EBI-10173939,EBI-10263496
COMTD1Q86VU53EBI-10173939,EBI-2836030
CSTF2P332406EBI-741480,EBI-711360
CSTF2TQ9H0L44EBI-741480,EBI-747012
CTAG1BP783587EBI-741480,EBI-1188472
CTAG2O756383EBI-10173939,EBI-10188927
CYB5R1Q9UHQ93EBI-10173939,EBI-953870
DEFA6Q015243EBI-741480,EBI-10222451
EFEMP2O959674EBI-741480,EBI-743414
EPS15P425665EBI-741480,EBI-396684
ERP27Q96DN03EBI-741480,EBI-953772
ETNK1Q9HBU63EBI-741480,EBI-2834493
FAM127AA6ZKI35EBI-741480,EBI-10174072
FAM127BQ9BWD34EBI-741480,EBI-741643
FAM127CQ17RB05EBI-741480,EBI-10238588
FCGR2AP123183EBI-741480,EBI-1395970
FKBP2P268853EBI-10173939,EBI-719873
FN1P027513EBI-741480,EBI-1220319
FZD7O750843EBI-741480,EBI-746917
GABRDO147644EBI-741480,EBI-744352
GHRLQ9UBU33EBI-741480,EBI-10319458
GPX3P223523EBI-10173939,EBI-2832946
GRM2Q144163EBI-10173939,EBI-10232876
GYPBP060283EBI-10173939,EBI-10194756
HK2P527894EBI-741480,EBI-741469
HSD17B12Q53GQ03EBI-10173939,EBI-2963255
HSPA13P487237EBI-741480,EBI-750892
IGL@Q6PIK13EBI-741480,EBI-10253735
IGL@Q6PIQ73EBI-741480,EBI-6677651
IGL@Q8N3554EBI-741480,EBI-748681
IL6STQ17RA03EBI-10173939,EBI-10238517
IST1P539903EBI-741480,EBI-945994
ITPRIPL1Q6GPH63EBI-741480,EBI-953819
KLHL42Q9P2K63EBI-741480,EBI-739890
LITAFQ997324EBI-741480,EBI-725647
MANBALQ9NQG13EBI-10173939,EBI-3867271
MCM7P339933EBI-10173939,EBI-355924
MIEF1Q9NQG63EBI-10173939,EBI-740987
MIEF2Q96C034EBI-741480,EBI-750153
MLLT6P551983EBI-10173939,EBI-740216
NAXDQ8IW453EBI-741480,EBI-8650724
NBL1P412713EBI-10173939,EBI-10208650
NGLY1Q96IV05EBI-741480,EBI-6165879
NME3Q132325EBI-741480,EBI-713684
NPPAP011603EBI-741480,EBI-953859
NUP58Q9BVL23EBI-10173939,EBI-2811583
PAUFC3PTT63EBI-741480,EBI-3505892
PBXIP1Q96AQ63EBI-10173939,EBI-740845
PIK3IP1Q96FE73EBI-741480,EBI-10285708
PLA2G16P538166EBI-741480,EBI-746318
PNMA1Q8ND904EBI-741480,EBI-302345
PPIBP232843EBI-741480,EBI-359252
PPICP458773EBI-10173939,EBI-953909
PRAP1Q96NZ93EBI-741480,EBI-2116102
PRB1A5D9033EBI-10173939,EBI-10173935
PSMD4P550366EBI-741480,EBI-359318
PSMD6Q150083EBI-10173939,EBI-359701
RIC8AQ9NPQ83EBI-741480,EBI-717509
RIC8AQ9NPQ8-43EBI-741480,EBI-9091816
RNF208Q9H0X63EBI-741480,EBI-751555
RPN1P048433EBI-741480,EBI-355963
RSRC2Q7L4I2-23EBI-741480,EBI-10256202
SCG5P054083EBI-741480,EBI-722635
SCMH1Q96GD33EBI-10173939,EBI-713793
SERPINE1P051213EBI-741480,EBI-953978
SERPINI2O758306EBI-741480,EBI-750144
SIL1Q9H1733EBI-741480,EBI-2840325
SMIM2Q9BVW63EBI-741480,EBI-10300146
SMR3BP028143EBI-10173939,EBI-738612
SRGNP101245EBI-741480,EBI-744915
TMCO6Q96DC73EBI-741480,EBI-746174
TMCO6Q96DC7-23EBI-741480,EBI-10284552
TMEM31Q5JXX73EBI-10173939,EBI-10244617
TMUB2Q71RG43EBI-10173939,EBI-2820477
TRIM32Q130498EBI-741480,EBI-742790
TXNDC12O958813EBI-741480,EBI-2564581
UBBQ5U5U63EBI-741480,EBI-1642104
UBCP0CG483EBI-741480,EBI-3390054
UBCQ96C323EBI-741480,EBI-745483
UBE2V1Q134045EBI-741480,EBI-1050671
UBQLN4Q9NRR58EBI-741480,EBI-711226
UBXN1Q043233EBI-10173939,EBI-1058647
UBXN4Q925753EBI-741480,EBI-723441
XPO4Q0VG753EBI-741480,EBI-10226948
ZFAND2BQ8WV993EBI-10173939,EBI-747823
ZG16O608446EBI-741480,EBI-746479
ZMYM4Q5VZL53EBI-741480,EBI-2514659
ZNF343Q6P1L63EBI-741480,EBI-10252492

GO - Molecular functioni

  • kinase binding Source: UniProtKB
  • polyubiquitin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119007. 223 interactors.
DIPiDIP-41629N.
IntActiQ9UMX0. 168 interactors.
MINTiMINT-150317.
STRINGi9606.ENSP00000365576.

Structurei

Secondary structure

1589
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi37 – 42Combined sources6
Beta strandi47 – 52Combined sources6
Helixi58 – 69Combined sources12
Helixi73 – 75Combined sources3
Beta strandi76 – 80Combined sources5
Beta strandi83 – 85Combined sources3
Helixi92 – 94Combined sources3
Beta strandi101 – 106Combined sources6
Turni543 – 547Combined sources5
Helixi548 – 556Combined sources9
Helixi562 – 572Combined sources11
Helixi576 – 583Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JY5NMR-A541-586[»]
2JY6NMR-B541-586[»]
2KLCNMR-A34-112[»]
ProteinModelPortaliQ9UMX0.
SMRiQ9UMX0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UMX0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 111Ubiquitin-likePROSITE-ProRule annotationAdd BLAST75
Domaini182 – 210STI1 1Sequence analysisAdd BLAST29
Domaini212 – 251STI1 2Sequence analysisAdd BLAST40
Domaini387 – 434STI1 3Sequence analysisAdd BLAST48
Domaini438 – 470STI1 4Sequence analysisAdd BLAST33
Domaini546 – 586UBAPROSITE-ProRule annotationAdd BLAST41

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni178 – 428Interaction with UBXN41 PublicationAdd BLAST251

Domaini

The UBA domain mediates binding to PSEN1 and PSEN2. It also binds ubiquitin with micromolar affinity, independently of polyubiquitin linkage type. Essential for its association with microtubule-associated protein 1 light chain 3 (MAP1LC3).3 Publications
The ubiquitin-like domain mediates its association with the subunits of the proteasome.1 Publication
Dimerization is dependent upon the central region of the protein containing the STI1 domains and is independent of its ubiquitin-like and UBA domains.1 Publication

Sequence similaritiesi

Contains 4 STI1 domains.Sequence analysis
Contains 1 UBA domain.PROSITE-ProRule annotation
Contains 1 ubiquitin-like domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0010. Eukaryota.
COG5272. LUCA.
GeneTreeiENSGT00390000005720.
HOVERGENiHBG064537.
InParanoidiQ9UMX0.
KOiK04523.
OMAiTTEPGNQ.
OrthoDBiEOG091G08WB.
PhylomeDBiQ9UMX0.
TreeFamiTF314412.

Family and domain databases

InterProiIPR006636. STI1_HS-bd.
IPR015940. UBA.
IPR009060. UBA-like.
IPR015496. Ubiquilin.
IPR028430. Ubiquilin-1/2.
IPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PANTHERiPTHR10677. PTHR10677. 1 hit.
PTHR10677:SF5. PTHR10677:SF5. 1 hit.
PfamiPF00627. UBA. 1 hit.
PF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 4 hits.
SM00165. UBA. 1 hit.
SM00213. UBQ. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UMX0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESGESGGP PGSQDSAAGA EGAGAPAAAA SAEPKIMKVT VKTPKEKEEF
60 70 80 90 100
AVPENSSVQQ FKEEISKRFK SHTDQLVLIF AGKILKDQDT LSQHGIHDGL
110 120 130 140 150
TVHLVIKTQN RPQDHSAQQT NTAGSNVTTS STPNSNSTSG SATSNPFGLG
160 170 180 190 200
GLGGLAGLSS LGLNTTNFSE LQSQMQRQLL SNPEMMVQIM ENPFVQSMLS
210 220 230 240 250
NPDLMRQLIM ANPQMQQLIQ RNPEISHMLN NPDIMRQTLE LARNPAMMQE
260 270 280 290 300
MMRNQDRALS NLESIPGGYN ALRRMYTDIQ EPMLSAAQEQ FGGNPFASLV
310 320 330 340 350
SNTSSGEGSQ PSRTENRDPL PNPWAPQTSQ SSSASSGTAS TVGGTTGSTA
360 370 380 390 400
SGTSGQSTTA PNLVPGVGAS MFNTPGMQSL LQQITENPQL MQNMLSAPYM
410 420 430 440 450
RSMMQSLSQN PDLAAQMMLN NPLFAGNPQL QEQMRQQLPT FLQQMQNPDT
460 470 480 490 500
LSAMSNPRAM QALLQIQQGL QTLATEAPGL IPGFTPGLGA LGSTGGSSGT
510 520 530 540 550
NGSNATPSEN TSPTAGTTEP GHQQFIQQML QALAGVNPQL QNPEVRFQQQ
560 570 580
LEQLSAMGFL NREANLQALI ATGGDINAAI ERLLGSQPS
Length:589
Mass (Da):62,519
Last modified:March 1, 2002 - v2
Checksum:i8B4756B6113B7025
GO
Isoform 2 (identifier: Q9UMX0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     417-444: Missing.

Note: No experimental confirmation available.
Show »
Length:561
Mass (Da):59,220
Checksum:i1E0BC42EC5BA4DA6
GO
Isoform 3 (identifier: Q9UMX0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-237: Missing.

Show »
Length:412
Mass (Da):43,038
Checksum:i61264678FFCAA699
GO
Isoform 4 (identifier: Q9UMX0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-181: GGLGGLAGLSSLGLNTTNFSELQSQMQRQLLS → DVGTCQESSNDAGDDEEPGPSFEQPRKHPRGI
     182-589: Missing.

Show »
Length:181
Mass (Da):18,910
Checksum:i92A3D97BF619E306
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25A → T in AAH39294 (PubMed:15489334).Curated1
Sequence conflicti41V → A in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti61F → S in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti91L → S in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti125S → G in CAB66578 (PubMed:11230166).Curated1
Sequence conflicti202P → H in AAH39294 (PubMed:15489334).Curated1
Sequence conflicti537 – 538NP → YS in BAB20436 (PubMed:10807547).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05768961 – 237Missing in isoform 3. 1 PublicationAdd BLAST177
Alternative sequenceiVSP_057690150 – 181GGLGG…RQLLS → DVGTCQESSNDAGDDEEPGP SFEQPRKHPRGI in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_057691182 – 589Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_009787417 – 444Missing in isoform 2. 2 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176069 mRNA. Translation: AAD49751.3.
AF293384 mRNA. Translation: AAG02473.1.
AB035275 mRNA. Translation: BAB20436.1.
HM005532 mRNA. Translation: AEE61129.1.
AL136643 mRNA. Translation: CAB66578.1.
AL354920 Genomic DNA. Translation: CAI15100.1.
AL354920 Genomic DNA. Translation: CAI15101.1.
CH471089 Genomic DNA. Translation: EAW62659.1.
CH471089 Genomic DNA. Translation: EAW62661.1.
CH471089 Genomic DNA. Translation: EAW62664.1.
BC010066 mRNA. Translation: AAH10066.1.
BC039294 mRNA. Translation: AAH39294.1.
AK074535 mRNA. No translation available.
CCDSiCCDS6663.1. [Q9UMX0-1]
CCDS6664.1. [Q9UMX0-2]
RefSeqiNP_038466.2. NM_013438.4. [Q9UMX0-1]
NP_444295.1. NM_053067.2. [Q9UMX0-2]
UniGeneiHs.9589.

Genome annotation databases

EnsembliENST00000257468; ENSP00000257468; ENSG00000135018. [Q9UMX0-2]
ENST00000376395; ENSP00000365576; ENSG00000135018. [Q9UMX0-1]
GeneIDi29979.
KEGGihsa:29979.
UCSCiuc004amv.4. human. [Q9UMX0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176069 mRNA. Translation: AAD49751.3.
AF293384 mRNA. Translation: AAG02473.1.
AB035275 mRNA. Translation: BAB20436.1.
HM005532 mRNA. Translation: AEE61129.1.
AL136643 mRNA. Translation: CAB66578.1.
AL354920 Genomic DNA. Translation: CAI15100.1.
AL354920 Genomic DNA. Translation: CAI15101.1.
CH471089 Genomic DNA. Translation: EAW62659.1.
CH471089 Genomic DNA. Translation: EAW62661.1.
CH471089 Genomic DNA. Translation: EAW62664.1.
BC010066 mRNA. Translation: AAH10066.1.
BC039294 mRNA. Translation: AAH39294.1.
AK074535 mRNA. No translation available.
CCDSiCCDS6663.1. [Q9UMX0-1]
CCDS6664.1. [Q9UMX0-2]
RefSeqiNP_038466.2. NM_013438.4. [Q9UMX0-1]
NP_444295.1. NM_053067.2. [Q9UMX0-2]
UniGeneiHs.9589.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JY5NMR-A541-586[»]
2JY6NMR-B541-586[»]
2KLCNMR-A34-112[»]
ProteinModelPortaliQ9UMX0.
SMRiQ9UMX0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119007. 223 interactors.
DIPiDIP-41629N.
IntActiQ9UMX0. 168 interactors.
MINTiMINT-150317.
STRINGi9606.ENSP00000365576.

PTM databases

iPTMnetiQ9UMX0.
PhosphoSitePlusiQ9UMX0.

Polymorphism and mutation databases

BioMutaiUBQLN1.
DMDMi48475013.

2D gel databases

REPRODUCTION-2DPAGEIPI00071180.

Proteomic databases

EPDiQ9UMX0.
PaxDbiQ9UMX0.
PeptideAtlasiQ9UMX0.
PRIDEiQ9UMX0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257468; ENSP00000257468; ENSG00000135018. [Q9UMX0-2]
ENST00000376395; ENSP00000365576; ENSG00000135018. [Q9UMX0-1]
GeneIDi29979.
KEGGihsa:29979.
UCSCiuc004amv.4. human. [Q9UMX0-1]

Organism-specific databases

CTDi29979.
DisGeNETi29979.
GeneCardsiUBQLN1.
HGNCiHGNC:12508. UBQLN1.
HPAiCAB037256.
HPA054143.
MIMi605046. gene.
neXtProtiNX_Q9UMX0.
OpenTargetsiENSG00000135018.
PharmGKBiPA37155.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0010. Eukaryota.
COG5272. LUCA.
GeneTreeiENSGT00390000005720.
HOVERGENiHBG064537.
InParanoidiQ9UMX0.
KOiK04523.
OMAiTTEPGNQ.
OrthoDBiEOG091G08WB.
PhylomeDBiQ9UMX0.
TreeFamiTF314412.

Enzyme and pathway databases

ReactomeiR-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiUBQLN1. human.
EvolutionaryTraceiQ9UMX0.
GeneWikiiUBQLN1.
GenomeRNAii29979.
PROiQ9UMX0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135018.
CleanExiHS_UBQLN1.
ExpressionAtlasiQ9UMX0. baseline and differential.
GenevisibleiQ9UMX0. HS.

Family and domain databases

InterProiIPR006636. STI1_HS-bd.
IPR015940. UBA.
IPR009060. UBA-like.
IPR015496. Ubiquilin.
IPR028430. Ubiquilin-1/2.
IPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PANTHERiPTHR10677. PTHR10677. 1 hit.
PTHR10677:SF5. PTHR10677:SF5. 1 hit.
PfamiPF00627. UBA. 1 hit.
PF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 4 hits.
SM00165. UBA. 1 hit.
SM00213. UBQ. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUBQL1_HUMAN
AccessioniPrimary (citable) accession number: Q9UMX0
Secondary accession number(s): A0A024R284
, Q5T6J5, Q5T6J9, Q8IXS9, Q8N2Q3, Q9H0T8, Q9H3R4, Q9HAZ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.