Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptopodin-2

Gene

SYNPO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an actin-binding and actin-bundling activity. Can induce the formation of F-actin networks in an isoform-specific manner (PubMed:24005909, PubMed:23225103). At the sarcomeric Z lines is proposed to act as adapter protein that links nascent myofibers to the sarcolemma via ZYX and may play a role in early assembly and stabilization of the Z lines. Involved in autophagosome formation. May play a role in chaperone-assisted selective autophagy (CASA) involved in Z lines maintenance in striated muscle under mechanical tension; may link the client-processing CASA chaperone machinery to a membrane-tethering and fusion complex providing autophagosome membranes (By similarity). Involved in regulation of cell migration (PubMed:22915763, PubMed:25883213). May be a tumor suppressor (PubMed:16885336).By similarity2 Publications4 Publications
Isoform 1: Involved in regulation of cell migration. Can induce formation of thick, irregular actin bundles in the cell body.2 Publications
Isoform 2: Involved in regulation of cell migration. Can induce long, well-organized actin bundles frequently orientated in parallel along the long axis of the cell showing characteristics of contractile ventral stress fibers.2 Publications
Isoform 3: Involved in regulation of cell migration. Can induce an amorphous actin meshwork throughout the cell body containing a mixture of long and short, randomly organized thick and thin actin bundles.2 Publications
Isoform 4: Can induce long, well-organized actin bundles frequently orientated in parallel along the long axis of the cell showing characteristics of contractile ventral stress fibers.1 Publication
Isoform 5: Involved in regulation of cell migration in part dependent on the Rho-ROCK cascade; can promote formation of nascent focal adhesions, actin bundles at the leading cell edge and lamellipodia (PubMed:22915763, PubMed:25883213). Can induce formation of thick, irregular actin bundles in the cell body; the induced actin network is associated with enhanced cell migration in vitro.3 Publications

GO - Molecular functioni

  • 14-3-3 protein binding Source: UniProtKB
  • actin binding Source: GO_Central
  • alpha-actinin binding Source: UniProtKB
  • filamin binding Source: UniProtKB
  • muscle alpha-actinin binding Source: UniProtKB

GO - Biological processi

  • autophagosome assembly Source: Ensembl
  • positive regulation of actin filament bundle assembly Source: UniProtKB
  • positive regulation of cell migration Source: UniProtKB
  • regulation of Rho-dependent protein serine/threonine kinase activity Source: UniProtKB

Keywordsi

Molecular functionActin-binding, Muscle protein

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptopodin-2
Alternative name(s):
Genethonin-2
Myopodin
Gene namesi
Name:SYNPO2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:17732. SYNPO2.

Subcellular locationi

  • Nucleus By similarity
  • Cytoplasm By similarity
  • Cytoplasmcytoskeleton 1 Publication
  • CytoplasmmyofibrilsarcomereZ line 1 Publication
  • Cell junctionfocal adhesion 1 Publication

  • Note: Shuttles between the nucleus and the cytoplasm in a differentiation-dependent and stress-induced fashion. In undifferentiated myoblasts strongly expressed in the nucleus, after induction of myotube differentiation is located to both nucleus and cytoplasm along acting filaments, and in differentiated myotubes is located at the Z lines. Upon stress redistributes from cytoplasm of myoblasts and myotubes to the nucleus. Nuclear import is KPNA2-dependent and promoted by phosphorylation by PKA and/or CaMK2, and inhibition of calcineurin. The nuclear export is XPO1-dependent (By similarity). Localized in a fiber-like pattern, partly overlapping with filamentous actin (PubMed:18371299).By similarity1 Publication
Isoform 1 :
  • Cytoplasmcytoskeleton 1 Publication

  • Note: Localizes to induced actin bundles with contiguous staining.1 Publication
Isoform 2 :
  • Cytoplasmcytoskeleton 1 Publication

  • Note: Localizes to induced actin bundles with punctuate staining.1 Publication
Isoform 3 :
  • Cytoplasmcytoskeleton 1 Publication

  • Note: Localizes to induced irregular actin bundles with contiguous and punctuated staining.1 Publication
Isoform 4 :
  • Cytoplasmcytoskeleton 1 Publication

  • Note: Localizes to induced actin bundles with punctuate staining.1 Publication
Isoform 5 :
  • Cytoplasmcytoskeleton 1 Publication

  • Note: Localizes to induced actin bundles with contiguous staining.1 Publication

GO - Cellular componenti

  • actin cytoskeleton Source: LIFEdb
  • cytosol Source: HPA
  • focal adhesion Source: UniProtKB
  • intracellular membrane-bounded organelle Source: HPA
  • nucleus Source: UniProtKB
  • stress fiber Source: UniProtKB
  • tethering complex Source: Ensembl
  • Z disc Source: UniProtKB

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNETi171024.
OpenTargetsiENSG00000172403.
PharmGKBiPA38244.

Polymorphism and mutation databases

BioMutaiSYNPO2.
DMDMi51702160.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001876731 – 1093Synaptopodin-2Add BLAST1093

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei274PhosphoserineCombined sources1
Modified residuei310PhosphoserineBy similarity1
Modified residuei549PhosphoserineBy similarity1
Modified residuei551PhosphoserineBy similarity1
Modified residuei604PhosphoserineBy similarity1
Modified residuei610Phosphothreonine; by PKA and CaMK2Combined sourcesBy similarity1
Modified residuei611PhosphoserineCombined sources1
Modified residuei622PhosphotyrosineCombined sources1
Modified residuei626PhosphothreonineCombined sources1
Modified residuei729PhosphoserineCombined sources1
Modified residuei755PhosphothreonineCombined sources1
Modified residuei774PhosphothreonineCombined sources1
Modified residuei777PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei902PhosphoserineCombined sources1
Modified residuei906PhosphoserineCombined sources1
Modified residuei1056PhosphoserineCombined sources1
Isoform 4 (identifier: Q9UMS6-4)
Modified residuei1107PhosphoserineCombined sources1
Isoform 2 (identifier: Q9UMS6-2)
Modified residuei1138PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by PKA, and by CaMK2 at multiple sites. Dephosphorylated by calcineurin; abrogating interaction with YWHAB and impairing nuclear import (By similarity). Phosphorylated by ILK.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9UMS6.
PeptideAtlasiQ9UMS6.
PRIDEiQ9UMS6.

PTM databases

iPTMnetiQ9UMS6.
PhosphoSitePlusiQ9UMS6.

Expressioni

Tissue specificityi

Expressed in heart muscle. Isoform 5 is specifically expressed in skeletal muscle.2 Publications

Developmental stagei

Detected in myoblasts within 24 h after induction of myogenic differentiation preceeding the expression of sarcomeric alpha-actinin. Specifically at early stages colocalizes with ZYX at focal adhesions.1 Publication

Inductioni

Down-regulated in muscle cell lines derived from patients with Duchenne muscular dystrophy (DMD).1 Publication

Gene expression databases

BgeeiENSG00000172403.
CleanExiHS_SYNPO2.
ExpressionAtlasiQ9UMS6. baseline and differential.
GenevisibleiQ9UMS6. HS.

Organism-specific databases

HPAiCAB037231.
HPA030665.
HPA049707.
HPA068563.

Interactioni

Subunit structurei

May self-associate in muscle cells under oxidative stress. Binds F-actin (PubMed:23225103). Interacts with ACTN2; ACTN2 is proposed to anchor SYOP2 at Z lines in mature myocytes (PubMed:20554076). Interacts with AKAP6, PPP3CA and CAMK2A. Interacts (phosphorylated form) with YWHAB; YWHAB competes with ACTN2 for interaction with SYNPO2. Interacts with KPNA2; mediating nuclear import of SYNOP2; dependent on interaction with YWHAB (By similarity). Interacts with IPO13; may be implicated in SYNOP2 nuclear import (PubMed:17828378). Interacts with ZYX, FLNC, ILK (PubMed:16885336, PubMed:20554076, PubMed:21643011). Interacts with BAG3 (via WW 1 domain). May associate with the CASA complex consisting of HSPA8, HSPB8 and BAG3. Interacts with VPS18 (PubMed:23434281).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ILKQ134186EBI-3453434,EBI-747644

GO - Molecular functioni

  • 14-3-3 protein binding Source: UniProtKB
  • actin binding Source: GO_Central
  • alpha-actinin binding Source: UniProtKB
  • filamin binding Source: UniProtKB
  • muscle alpha-actinin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi128105. 20 interactors.
DIPiDIP-47311N.
IntActiQ9UMS6. 7 interactors.
MINTiMINT-4541802.
STRINGi9606.ENSP00000306015.

Structurei

3D structure databases

ProteinModelPortaliQ9UMS6.
SMRiQ9UMS6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 88PDZPROSITE-ProRule annotationAdd BLAST83

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 180Interaction with VPS181 PublicationAdd BLAST180
Regioni481 – 663Interaction with ACTN21 PublicationAdd BLAST183
Regioni534 – 663F-actin binding1 PublicationAdd BLAST130
Regioni607 – 811Interaction with YWHABBy similarityAdd BLAST205
Regioni615 – 626Interaction with BAG31 PublicationAdd BLAST12
Regioni664 – 924Interaction with ACTN21 PublicationAdd BLAST261
Regioni664 – 916F-actin bundling activity1 PublicationAdd BLAST253
Regioni664 – 803F-actin binding1 PublicationAdd BLAST140
Regioni751 – 900Actin bindingBy similarityAdd BLAST150
Regioni810 – 1093Interaction with FLNC1 PublicationAdd BLAST284
Regioni901 – 1093Interaction with ACTN21 PublicationAdd BLAST193
Regioni1000 – 1019Interaction with ZYX1 PublicationAdd BLAST20

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi398 – 406Nuclear localization signalBy similarity9
Motifi619 – 622PPPY motif1 Publication4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi400 – 405Poly-Arg6
Compositional biasi423 – 426Poly-Glu4
Compositional biasi591 – 658Pro-richAdd BLAST68
Compositional biasi756 – 818Pro-richAdd BLAST63
Compositional biasi767 – 770Poly-Ser4

Domaini

The PPPY motif interacts with the WW domain 1 of BAG3.1 Publication

Sequence similaritiesi

Belongs to the synaptopodin family.Curated

Phylogenomic databases

eggNOGiENOG410IIQE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG079226.
InParanoidiQ9UMS6.
OMAiRERMDQI.
OrthoDBiEOG091G01MS.
PhylomeDBiQ9UMS6.
TreeFamiTF330867.

Family and domain databases

InterProiView protein in InterPro
IPR001478. PDZ.
PfamiView protein in Pfam
PF00595. PDZ. 1 hit.
SMARTiView protein in SMART
SM00228. PDZ. 1 hit.
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiView protein in PROSITE
PS50106. PDZ. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UMS6-1) [UniParc]FASTAAdd to basket
Also known as: Myo1, SYNOPb, Synop2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTGDFICIS MTGGAPWGFR LQGGKEQKQP LQVAKIRNQS KASGSGLCEG
60 70 80 90 100
DEVVSINGNP CADLTYPEVI KLMESITDSL QMLIKRPSSG ISEALISENE
110 120 130 140 150
NKNLEHLTHG GYVESTTLQI RPATKTQCTE FFLAPVKTEV PLAENQRSGP
160 170 180 190 200
DCAGSLKEET GPSYQRAPQM PDSQRGRVAE ELILREKVEA VQPGPVVELQ
210 220 230 240 250
LSLSQERHKG ASGPLVALPG AEKSKSPDPD PNLSHDRIVH INSIPTNEKA
260 270 280 290 300
DPFLRSSKII QISSGRELRV IQESEAGDAG LPRVEVILDC SDRQKTEGCR
310 320 330 340 350
LQAGKECVDS PVEGGQSEAP PSLVSFAVSS EGTEQGEDPR SEKDHSRPHK
360 370 380 390 400
HRARHARLRR SESLSEKQVK EAKSKCKSIA LLLTDAPNPN SKGVLMFKKR
410 420 430 440 450
RRRARKYTLV SYGTGELERE ADEEEEGDKE DTCEVAFLGA SESEVDEELL
460 470 480 490 500
SDVDDNTQVV NFDWDSGLVD IEKKLNRGDK MEMLPDTTGK GALMFAKRRE
510 520 530 540 550
RMDQITAQKE EDKVGGTPSR EQDAAQTDGL RTTTSYQRKE EESVRTQSSV
560 570 580 590 600
SKSYIEVSHG LGHVPQQNGF SGTSETANIQ RMVPMNRTAK PFPGSVNQPA
610 620 630 640 650
TPFSPTRNMT SPIADFPAPP PYSAVTPPPD AFSRGVSSPI AGPAQPPPWP
660 670 680 690 700
QPAPWSQPAF YDSSERIASR DERISVPAKR TGILQEAKRR STTKPMFTFK
710 720 730 740 750
EPKVSPNPEL LSLLQNSEGK RGTGAGGDSG PEEDYLSLGA EACNFMQSSS
760 770 780 790 800
AKQKTPPPVA PKPAVKSSSS QPVTPVSPVW SPGVAPTQPP AFPTSNPSKG
810 820 830 840 850
TVVSSIKIAQ PSYPPARPAS TLNVAGPFKG PQAAVASQNY TPKPTVSTPT
860 870 880 890 900
VNAVQPGAVG PSNELPGMSG RGAQLFAKRQ SRMEKYVVDS DTVQAHAARA
910 920 930 940 950
QSPTPSLPAS WKYSSNVRAP PPVAYNPIHS PSYPLAALKS QPSAAQPSKM
960 970 980 990 1000
GKKKGKKPLN ALDVMKHQPY QLNASLFTFQ PPDAKDGLPQ KSSVKVNSAL
1010 1020 1030 1040 1050
AMKQALPPRP VNAASPTNVQ ASSVYSVPAY TSPPSFFAEA SSPVSASPVP
1060 1070 1080 1090
VGIPTSPKQE SASSSYFVAP RPKFSAKKSG VTIQVWKPSV VEE
Note: Produced by alternative promoter usage.
Length:1,093
Mass (Da):117,514
Last modified:August 31, 2004 - v2
Checksum:i8DF6F4D2823B444D
GO
Isoform 2 (identifier: Q9UMS6-2) [UniParc]FASTAAdd to basket
Also known as: Myo3, SYNOPa, Synop2C

The sequence of this isoform differs from the canonical sequence as follows:
     1085-1093: VWKPSVVEE → ESGRSLSLPG...PHPRGWRRQT

Note: =Produced by alternative splicing of isoform 1.Combined sources
Show »
Length:1,261
Mass (Da):136,342
Checksum:iE38B72200E742404
GO
Isoform 3 (identifier: Q9UMS6-3) [UniParc]FASTAAdd to basket
Also known as: Myo2, SYNOPc, Synop2B

The sequence of this isoform differs from the canonical sequence as follows:
     1086-1093: WKPSVVEE → KCKSGIHSQDIIRTYFPAYLSSST

Note: =Produced by alternative splicing of isoform 1.
Show »
Length:1,109
Mass (Da):119,244
Checksum:i1AECA76771126803
GO
Isoform 4 (identifier: Q9UMS6-4) [UniParc]FASTAAdd to basket
Also known as: Myo4, Synop2D

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAK → MVTQ
     1085-1093: VWKPSVVEE → ESGRSLSLPG...PHPRGWRRQT

Note: =Produced by alternative splicing of isoform 1.Combined sources
Show »
Length:1,230
Mass (Da):133,081
Checksum:iC54DF3CE60B6BAEE
GO
Isoform 5 (identifier: Q9UMS6-5) [UniParc]FASTAAdd to basket
Also known as: (delta)N-MYO1, SYNOPd, SYNOP2As

The sequence of this isoform differs from the canonical sequence as follows:
     1-395: Missing.

Note: Produced by alternative promoter usage.1 Publication
Show »
Length:698
Mass (Da):74,762
Checksum:i19E5AE7E74491FB6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti61C → R in AL832031 (PubMed:17974005).Curated1
Sequence conflicti147Missing in AL832031 (PubMed:17974005).Curated1
Sequence conflicti263 – 266SSGR → IRHE in CAB51856 (PubMed:11673475).Curated4
Sequence conflicti508Q → P in AGS94404 (PubMed:24005909).Curated1
Sequence conflicti667I → M in AL832031 (PubMed:17974005).Curated1
Sequence conflicti969P → L in AAI50630 (PubMed:15489334).Curated1
Sequence conflicti987G → V in AAI50630 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057256154G → A1 PublicationCorresponds to variant dbSNP:rs12645298Ensembl.1
Natural variantiVAR_057257174Q → H. Corresponds to variant dbSNP:rs17263971Ensembl.1
Natural variantiVAR_057258179A → T. Corresponds to variant dbSNP:rs17050152Ensembl.1
Natural variantiVAR_019670573T → A5 PublicationsCorresponds to variant dbSNP:rs7698598Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0588871 – 395Missing in isoform 5. Add BLAST395
Alternative sequenceiVSP_0537711 – 35MGTGD…LQVAK → MVTQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0412221085 – 1093VWKPSVVEE → ESGRSLSLPGRSVPPPISTS PWVYQPTYSYSSKPTDGLEK ANKRPTPWEAAAKSPLGLVD DAFQPRNIQESIVANVVSAA RRKVLPGPPEDWNERLSYIP QTQKAYMGSCGRQEYNVTAN NNMSTTSQYGSQLPYAYYRQ ASRNDSAIMSMETRSDYCLP VADYNYNPHPRGWRRQT in isoform 2 and isoform 4. 2 Publications9
Alternative sequenceiVSP_0412231086 – 1093WKPSVVEE → KCKSGIHSQDIIRTYFPAYL SSST in isoform 3. 1 Publication8

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU481975 mRNA. Translation: ACC93875.1.
KF147165 mRNA. Translation: AGS94404.1.
AL832031 mRNA. No translation available.
AL833294 mRNA. No translation available.
AC096745 Genomic DNA. No translation available.
AC107048 Genomic DNA. No translation available.
AC108030 Genomic DNA. No translation available.
CH471229 Genomic DNA. Translation: EAW73659.1.
FN422000 mRNA. Translation: CAZ66141.1.
BC150629 mRNA. Translation: AAI50630.1.
AJ010482 mRNA. Translation: CAB51856.1.
AF177291 mRNA. Translation: AAD55264.1.
CCDSiCCDS34054.1. [Q9UMS6-2]
CCDS47128.1. [Q9UMS6-3]
CCDS47129.1. [Q9UMS6-1]
CCDS75185.1. [Q9UMS6-4]
RefSeqiNP_001122405.1. NM_001128933.2. [Q9UMS6-1]
NP_001122406.1. NM_001128934.2. [Q9UMS6-3]
NP_001273683.1. NM_001286754.1. [Q9UMS6-4]
NP_597734.2. NM_133477.2. [Q9UMS6-2]
UniGeneiHs.655519.

Genome annotation databases

EnsembliENST00000307142; ENSP00000306015; ENSG00000172403. [Q9UMS6-2]
ENST00000429713; ENSP00000395143; ENSG00000172403. [Q9UMS6-1]
ENST00000434046; ENSP00000390965; ENSG00000172403. [Q9UMS6-3]
ENST00000610556; ENSP00000484885; ENSG00000172403. [Q9UMS6-4]
GeneIDi171024.
KEGGihsa:171024.
UCSCiuc003icm.6. human. [Q9UMS6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU481975 mRNA. Translation: ACC93875.1.
KF147165 mRNA. Translation: AGS94404.1.
AL832031 mRNA. No translation available.
AL833294 mRNA. No translation available.
AC096745 Genomic DNA. No translation available.
AC107048 Genomic DNA. No translation available.
AC108030 Genomic DNA. No translation available.
CH471229 Genomic DNA. Translation: EAW73659.1.
FN422000 mRNA. Translation: CAZ66141.1.
BC150629 mRNA. Translation: AAI50630.1.
AJ010482 mRNA. Translation: CAB51856.1.
AF177291 mRNA. Translation: AAD55264.1.
CCDSiCCDS34054.1. [Q9UMS6-2]
CCDS47128.1. [Q9UMS6-3]
CCDS47129.1. [Q9UMS6-1]
CCDS75185.1. [Q9UMS6-4]
RefSeqiNP_001122405.1. NM_001128933.2. [Q9UMS6-1]
NP_001122406.1. NM_001128934.2. [Q9UMS6-3]
NP_001273683.1. NM_001286754.1. [Q9UMS6-4]
NP_597734.2. NM_133477.2. [Q9UMS6-2]
UniGeneiHs.655519.

3D structure databases

ProteinModelPortaliQ9UMS6.
SMRiQ9UMS6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128105. 20 interactors.
DIPiDIP-47311N.
IntActiQ9UMS6. 7 interactors.
MINTiMINT-4541802.
STRINGi9606.ENSP00000306015.

PTM databases

iPTMnetiQ9UMS6.
PhosphoSitePlusiQ9UMS6.

Polymorphism and mutation databases

BioMutaiSYNPO2.
DMDMi51702160.

Proteomic databases

PaxDbiQ9UMS6.
PeptideAtlasiQ9UMS6.
PRIDEiQ9UMS6.

Protocols and materials databases

DNASUi171024.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307142; ENSP00000306015; ENSG00000172403. [Q9UMS6-2]
ENST00000429713; ENSP00000395143; ENSG00000172403. [Q9UMS6-1]
ENST00000434046; ENSP00000390965; ENSG00000172403. [Q9UMS6-3]
ENST00000610556; ENSP00000484885; ENSG00000172403. [Q9UMS6-4]
GeneIDi171024.
KEGGihsa:171024.
UCSCiuc003icm.6. human. [Q9UMS6-1]

Organism-specific databases

CTDi171024.
DisGeNETi171024.
GeneCardsiSYNPO2.
HGNCiHGNC:17732. SYNPO2.
HPAiCAB037231.
HPA030665.
HPA049707.
HPA068563.
neXtProtiNX_Q9UMS6.
OpenTargetsiENSG00000172403.
PharmGKBiPA38244.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIQE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG079226.
InParanoidiQ9UMS6.
OMAiRERMDQI.
OrthoDBiEOG091G01MS.
PhylomeDBiQ9UMS6.
TreeFamiTF330867.

Miscellaneous databases

ChiTaRSiSYNPO2. human.
GeneWikiiSYNPO2.
GenomeRNAii171024.
PROiPR:Q9UMS6.

Gene expression databases

BgeeiENSG00000172403.
CleanExiHS_SYNPO2.
ExpressionAtlasiQ9UMS6. baseline and differential.
GenevisibleiQ9UMS6. HS.

Family and domain databases

InterProiView protein in InterPro
IPR001478. PDZ.
PfamiView protein in Pfam
PF00595. PDZ. 1 hit.
SMARTiView protein in SMART
SM00228. PDZ. 1 hit.
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiView protein in PROSITE
PS50106. PDZ. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSYNP2_HUMAN
AccessioniPrimary (citable) accession number: Q9UMS6
Secondary accession number(s): B2RWP6
, B2Y8J9, C6H0M7, Q9UK89, S5XAM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: June 7, 2017
This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.