Q9UMD9 (COHA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen alpha-1(XVII) chain Alternative name(s): 180 kDa bullous pemphigoid antigen 2 Bullous pemphigoid antigen 2 Cleaved into the following 2 chains:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1497 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane. Ref.8 Ref.15 The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies. Ref.8 Ref.15 |
| Subunit structure | Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP. Ref.12 Ref.13 Ref.15 |
| Subcellular location | Cell junction › hemidesmosome. Membrane; Single-pass type II membrane protein. Note: Localized along the plasma membrane of the hemidesmosome. Ref.1 Ref.8 Ref.10 Ref.11 Ref.15 120 kDa linear IgA disease antigen: Secreted › extracellular space › extracellular matrix › basement membrane. Note: Exclusively localized to anchoring filaments. Localized to the epidermal side of split skin. Ref.1 Ref.8 Ref.10 Ref.11 Ref.15 97 kDa linear IgA disease antigen: Secreted › extracellular space › extracellular matrix › basement membrane. Note: Localized in the lamina lucida beneath the hemidesmosomes. Ref.1 Ref.8 Ref.10 Ref.11 Ref.15 |
| Tissue specificity | Stratified squamous epithelia. Found in hemidesmosomes. Expressed in cornea, oral mucosa, esophagus, intestine, kidney collecting ducts, ureter, bladder, urethra and thymus but is absent in lung, blood vessels, skeletal muscle and nerves. Ref.5 Ref.8 |
| Post-translational modification | The intracellular/endo domain is disulfide-linked. Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains. The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-544. |
| Involvement in disease | Generalized atrophic benign epidermolysis bullosa (GABEB) [MIM:226650]: A non-lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities. |
| Miscellaneous | Both the 120 kDa linear IgA disease antigen and the 97 kDa linear IgA disease antigen of COL17A1, represent major antigenic targets of autoantibodies in patients with linear IgA disease (LAD). LAD is a subepidermal blistering disorder characterized by tissue-bound and circulating IgA autoantibodies to the dermal-epidermal junction. These IgA autoantibodies preferentially react with 97 and the 120 kDa forms, but not with the full-length COL17A1, suggesting that the cleavage of the ectodomain generates novel autoantigenic epitopes. |
| Sequence caution | The sequence AAA35605.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAH04478.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UMD9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UMD9-2) The sequence of this isoform differs from the canonical sequence as follows: 922-966: Missing. 1170-1207: GSEFRGIVGPPGPPGPPGIPGNVWSSISVEDLSSYLHT → A | ||||||
| Note: Gene prediction based on EST data. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1497 | 1497 | Collagen alpha-1(XVII) chain | PRO_0000059406 | |||||
| Chain | 524 – 1497 | 974 | 120 kDa linear IgA disease antigen | PRO_0000342555 | |||||
| Chain | 531 – ? | 97 kDa linear IgA disease antigen | PRO_0000342556 | ||||||
Regions | |||||||||
| Topological domain | 1 – 467 | 467 | Cytoplasmic Potential | ||||||
| Transmembrane | 468 – 488 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 489 – 1497 | 1009 | Extracellular Potential | ||||||
| Region | 1 – 566 | 566 | Nonhelical region (NC16) | ||||||
| Region | 145 – 230 | 86 | Necessary for interaction with DST and for the recruitment of DST to hemidesmosome | ||||||
| Region | 567 – 1482 | 916 | Triple-helical region | ||||||
| Region | 1483 – 1497 | 15 | Nonhelical region (NC1) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 85 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 93 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 148 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 544 | 1 | Phosphoserine; by CK2 Ref.16 | ||||||
| Glycosylation | 1421 | 1 | N-linked (GlcNAc...) Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 922 – 966 | 45 | Missing in isoform 2. | VSP_024940 | |||||
| Alternative sequence | 1170 – 1207 | 38 | GSEFR…SYLHT → A in isoform 2. | VSP_024941 | |||||
| Natural variant | 4 | 1 | T → A. Corresponds to variant rs17116471 [ dbSNP | Ensembl ]. | VAR_048781 | |||||
| Natural variant | 210 | 1 | T → M. Ref.4 Corresponds to variant rs805708 [ dbSNP | Ensembl ]. | VAR_017593 | |||||
| Natural variant | 231 | 1 | M → I. Ref.2 Ref.22 Corresponds to variant rs1054113 [ dbSNP | Ensembl ]. | VAR_017594 | |||||
| Natural variant | 238 | 1 | M → T. Ref.2 | VAR_017595 | |||||
| Natural variant | 265 | 1 | S → C in GABEB. Ref.22 | VAR_017596 | |||||
| Natural variant | 428 | 1 | G → S. Ref.1 Ref.2 Corresponds to variant rs805698 [ dbSNP | Ensembl ]. | VAR_017597 | |||||
| Natural variant | 627 | 1 | G → V in GABEB. Ref.18 Ref.20 | VAR_017598 | |||||
| Natural variant | 633 | 1 | G → D in GABEB. Ref.21 | VAR_017599 | |||||
| Natural variant | 703 | 1 | M → V. Ref.2 Corresponds to variant rs805722 [ dbSNP | Ensembl ]. | VAR_017600 | |||||
| Natural variant | 1303 | 1 | R → Q in GABEB. Ref.19 | VAR_017601 | |||||
| Natural variant | 1370 | 1 | D → G. Ref.2 Corresponds to variant rs17116350 [ dbSNP | Ensembl ]. | VAR_017602 | |||||
Experimental info | |||||||||
| Sequence conflict | 856 | 1 | Q → P in AAA51839. Ref.5 | ||||||
| Sequence conflict | 905 | 1 | S → F in AAA35605. Ref.1 | ||||||
| Sequence conflict | 905 | 1 | S → F in AAB51499. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and primary structural analysis of the bullous pemphigoid autoantigen, BP180." Giudice G.J., Emery D.J., Diaz L.A. J. Invest. Dermatol. 99:243-250(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, VARIANT SER-428. Tissue: Foreskin. |
| [2] | "Cloning of the human type XVII collagen gene (COL17A1), and detection of novel mutations in generalized atrophic benign epidermolysis bullosa." Gatalica B., Pulkkinen L., Li K., Kuokkanen K., Ryynaenen M., McGrath J.A., Uitto J. Am. J. Hum. Genet. 60:352-365(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANTS ILE-231; THR-238; SER-428; VAL-703 AND GLY-1370. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-390, VARIANT MET-210. Tissue: Pancreas. |
| [5] | "Genomic organization of collagenous domains and chromosomal assignment of human 180-kDa bullous pemphigoid antigen-2, a novel collagen of stratified squamous epithelium." Li K.H., Sawamura D., Giudice G.J., Diaz L.A., Mattei M.-G., Chu M.-L., Uitto J. J. Biol. Chem. 266:24064-24069(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 508-856, TISSUE SPECIFICITY. |
| [6] | "The 97-kDa (LABD97) and 120-kDa (LAD-1) fragments of bullous pemphigoid antigen 180/type XVII collagen have different N-termini." Hirako Y., Nishizawa Y., Sitaru C., Opitz A., Marcus K., Meyer H.E., Butt E., Owaribe K., Zillikens D. J. Invest. Dermatol. 121:1554-1556(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 524-535. |
| [7] | "The 97 kDa linear IgA bullous disease antigen is identical to a portion of the extracellular domain of the 180 kDa bullous pemphigoid antigen, BPAg2." Zone J.J., Taylor T.B., Meyer L.J., Petersen M.J. J. Invest. Dermatol. 110:207-210(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 531-546; 554-565; 585-605; 647-666; 680-688; 689-703; 755-765; 842-860; 880-891; 1016-1028; 1062-1069; 1102-1108; 1134-1142; 1227-1247 AND 1248-1260. |
| [8] | "LAD-1, the linear IgA bullous dermatosis autoantigen, is a novel 120-kDa anchoring filament protein synthesized by epidermal cells." Marinkovich M.P., Taylor T.B., Keene D.R., Burgeson R.E., Zone J.J. J. Invest. Dermatol. 106:734-738(1996) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, FUNCTION, TISSUE SPECIFICITY. |
| [9] | Erratum Marinkovich M.P., Taylor T.B., Keene D.R., Burgeson R.E., Zone J.J. J. Invest. Dermatol. 106:1343-1343(1996) |
| [10] | "97-kDa linear IgA bullous dermatosis (LAD) antigen localizes to the lamina lucida of the epidermal basement membrane." Ishiko A., Shimizu H., Masunaga T., Hashimoto T., Dmochowski M., Wojnarowska F., Bhogal B.S., Black M.M., Nishikawa T. J. Invest. Dermatol. 106:739-743(1996) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "Evidence that the 180-kD bullous pemphigoid antigen is a transmembrane collagen, type XVII, in a triple-helical conformation and in type II transmembrane topography." Limardo M., Arffman A., Aho S., Utto J. J. Invest. Dermatol. 106:860-860(1996) Cited for: SUBCELLULAR LOCATION. |
| [12] | "Two forms of collagen XVII in keratinocytes. A full-length transmembrane protein and a soluble ectodomain." Schaecke H., Schumann H., Hammami-Hauasli N., Raghunath M., Bruckner-Tuderman L. J. Biol. Chem. 273:25937-25943(1998) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, PROTEOLYTIC PROCESSING, GLYCOSYLATION AT ASN-1421, DOMAINS. |
| [13] | "The N terminus of the transmembrane protein BP180 interacts with the N-terminal domain of BP230, thereby mediating keratin cytoskeleton anchorage to the cell surface at the site of the hemidesmosome." Hopkinson S.B., Jones J.C. Mol. Biol. Cell 11:277-286(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DSP. |
| [14] | "Transmembrane collagen XVII, an epithelial adhesion protein, is shed from the cell surface by ADAMs." Franzke C.-W., Tasanen K., Schaecke H., Zhou Z., Tryggvason K., Mauch C., Zigrino P., Sunnarborg S., Lee D.C., Fahrenholz F., Bruckner-Tuderman L. EMBO J. 21:5026-5035(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SHEDDING. |
| [15] | "Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly." Koster J., Geerts D., Favre B., Borradori L., Sonnenberg A. J. Cell Sci. 116:387-399(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DSP; DST; ITGB4 AND PLEC, SUBCELLULAR LOCATION. |
| [16] | "Extracellular phosphorylation of collagen XVII by ecto-casein kinase 2 inhibits ectodomain shedding." Zimina E.P., Fritsch A., Schermer B., Bakulina A.Y., Bashkurov M., Benzing T., Bruckner-Tuderman L. J. Biol. Chem. 282:22737-22746(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-544. |
| [17] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [18] | "Compound heterozygosity for a dominant glycine substitution and a recessive internal duplication mutation in the type XVII collagen gene results in junctional epidermolysis bullosa and abnormal dentition." McGrath J.A., Gatalica B., Li K., Dunnill M.G.S., McMillan J.R., Christiano A.M., Eady R.A.J., Uitto J. Am. J. Pathol. 148:1787-1796(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB VAL-627. |
| [19] | "Three novel homozygous point mutations and a new polymorphism in the COL17A1 gene: relation to biological and clinical phenotypes of junctional epidermolysis bullosa." Schumann H., Hammami-Hauasli N., Pulkkinen L., Mauviel A., Kuester W., Luethi U., Owaribe K., Uitto J., Bruckner-Tuderman L. Am. J. Hum. Genet. 60:1344-1353(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB GLN-1303. |
| [20] | "Collagen XVII is destabilized by a glycine substitution mutation in the cell adhesion domain Col15." Tasanen K., Eble J.A., Aumailley M., Schumann H., Baetge J., Tu H., Bruckner P., Bruckner-Tuderman L. J. Biol. Chem. 275:3093-3099(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB VAL-627. |
| [21] | "Hemizygosity for a glycine substitution in collagen XVII: unfolding and degradation of the ectodomain." Tasanen K., Floeth M., Schumann H., Bruckner-Tuderman L. J. Invest. Dermatol. 115:207-212(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB ASP-633. |
| [22] | "A novel homozygous point mutation in the COL17A1 gene in a Chinese family with generalized atrophic benign epidermolysis bullosa." Wu Y., Li G., Zhu X. J. Dermatol. Sci. 28:181-186(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB CYS-265, VARIANT ILE-231. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M91669 mRNA. Translation: AAA35605.1. Different initiation. U76604 U76603 Genomic DNA. Translation: AAB51499.1.AL138761 Genomic DNA. Translation: CAC00589.1. AL138761 Genomic DNA. Translation: CAI12398.1. BC004478 mRNA. Translation: AAH04478.1. Sequence problems. M63730 mRNA. Translation: AAA51839.1. |
| IPI | IPI00398272. IPI00643731. |
| PIR | A61262. I56325. |
| RefSeq | NP_000485.3. NM_000494.3. |
| UniGene | Hs.117938. Hs.732773. |
3D structure databases | |
| ProteinModelPortal | Q9UMD9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000340937. |
Protein family/group databases | |
| Allergome | 8213. Hom s BP180. 8226. Hom s BP180.0101. |
PTM databases | |
| PhosphoSite | Q9UMD9. |
Polymorphism databases | |
| DMDM | 146345399. |
Proteomic databases | |
| PaxDb | Q9UMD9. |
| PRIDE | Q9UMD9. |
Protocols and materials databases | |
| DNASU | 1308. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000353479; ENSP00000340937; ENSG00000065618. ENST00000369733; ENSP00000358748; ENSG00000065618. |
| GeneID | 1308. |
| KEGG | hsa:1308. |
| UCSC | uc001kxr.3. human. |
Organism-specific databases | |
| CTD | 1308. |
| GeneCards | GC10M105781. |
| H-InvDB | HIX0035327. |
| HGNC | HGNC:2194. COL17A1. |
| HPA | HPA043673. |
| MIM | 113811. gene+phenotype. 226650. phenotype. |
| neXtProt | NX_Q9UMD9. |
| Orphanet | 79402. Generalized junctional epidermolysis bullosa, non-Herlitz type. 251393. Localized junctional epidermolysis bullosa, non-Herlitz type. |
| PharmGKB | PA26710. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG309396. |
| HOGENOM | HOG000111885. |
| HOVERGEN | HBG051065. |
| InParanoid | Q9UMD9. |
| KO | K07603. |
| OMA | LDYAELS. |
| OrthoDB | EOG4RNB7V. |
| PhylomeDB | Q9UMD9. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | a6b1_a6b4_integrin_pathway. a6b1 and a6b4 Integrin signaling. |
| Reactome | REACT_111155. Cell-Cell communication. REACT_118779. Extracellular matrix organization. |
Gene expression databases | |
| ArrayExpress | Q9UMD9. |
| Bgee | Q9UMD9. |
| CleanEx | HS_COL17A1. |
| Genevestigator | Q9UMD9. |
| GermOnline | ENSG00000065618. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. [Graphical view] |
| Pfam | PF01391. Collagen. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 1308. |
| NextBio | 5353. |
| PMAP-CutDB | Q9UMD9. |
| SOURCE | Search... |
Entry information
| Entry name | COHA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UMD9 Secondary accession number(s): Q02802 Q9UC14 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
