Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TP53-target gene 3 protein

Gene

TP53TG3

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May play a significant role in p53/TP53-mediating signaling pathway.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
TP53-target gene 3 protein
Alternative name(s):
TP53-inducible gene 3 protein
Gene namesi
Name:TP53TG3Imported
Synonyms:TP53TG3A
AND
Name:TP53TG3BImported
AND
Name:TP53TG3CImported
AND
Name:TP53TG3DImported
AND
Name:TP53TG3EImported
AND
Name:TP53TG3FImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:30759. TP53TG3.
HGNC:37202. TP53TG3B.
HGNC:42962. TP53TG3C.
HGNC:44657. TP53TG3D.
HGNC:51816. TP53TG3E.
HGNC:51817. TP53TG3F.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183632.
ENSG00000205456.
ENSG00000205457.
ENSG00000261509.
ENSG00000274175.
ENSG00000275034.
ENSG00000275869.
ENSG00000278848.
PharmGKBiPA165450804.

Polymorphism and mutation databases

BioMutaiTP53TG3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003289831 – 132TP53-target gene 3 proteinAdd BLAST132

Proteomic databases

PaxDbiQ9ULZ0.
PRIDEiQ9ULZ0.

PTM databases

iPTMnetiQ9ULZ0.
PhosphoSitePlusiQ9ULZ0.

Expressioni

Tissue specificityi

Strongly expressed in testis. Weakly expressed in heart, placenta and skeletal muscle.1 Publication

Inductioni

By p53/TP53.1 Publication

Gene expression databases

BgeeiENSG00000183632.
ExpressionAtlasiQ9ULZ0. baseline and differential.
GenevisibleiQ9ULZ0. HS.

Organism-specific databases

HPAiHPA047832.

Interactioni

Protein-protein interaction databases

BioGridi117300. 1 interactor.
IntActiQ9ULZ0. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ9ULZ0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410KCDV. Eukaryota.
ENOG4110P2I. LUCA.
GeneTreeiENSGT00390000001729.
HOGENOMiHOG000154671.
InParanoidiQ9ULZ0.
OMAiHAQCGPS.
OrthoDBiEOG091G0TDR.
PhylomeDBiQ9ULZ0.
TreeFamiTF342471.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULZ0-1) [UniParc]FASTAAdd to basket
Also known as: TP53TG3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRASPCISQP AASWHPRPSA LRPTAGSGPD TRTPGTVEDG SAPCPAFRSP
60 70 80 90 100
AVSPCGEEPC CFQISPAEET LELGRLVSPG NCDTLSPRAA GFYACHVRSL
110 120 130
IPCRSTKGRW PLTASAAGLS RHAQCGPSLG LG
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Length:132
Mass (Da):13,627
Last modified:May 1, 2000 - v1
Checksum:i7158291F424405A8
GO
Isoform 2 (identifier: Q9ULZ0-2) [UniParc]FASTAAdd to basket
Also known as: TP53TG3a

The sequence of this isoform differs from the canonical sequence as follows:
     121-132: RHAQCGPSLGLG → SFSG

Show »
Length:124
Mass (Da):12,828
Checksum:iFD05DF7A8D1E79AE
GO
Isoform 3 (identifier: Q9ULZ0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-132: NCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSRHAQCGPSLGLG → CHKSSAPQERRLDPRARCVVHI

Show »
Length:102
Mass (Da):10,773
Checksum:iFBEECC55159EB007
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03287081 – 132NCDTL…SLGLG → CHKSSAPQERRLDPRARCVV HI in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_032871121 – 132RHAQC…SLGLG → SFSG in isoform 2. 3 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023508 mRNA. Translation: BAA84978.1.
AB023509 mRNA. Translation: BAA84979.1.
CR541650 mRNA. Translation: CAG46451.1.
AK312220 mRNA. Translation: BAG35153.1.
AL133588 mRNA. Translation: CAH10710.1.
BC096700 mRNA. Translation: AAH96700.1.
BC096733 mRNA. Translation: AAH96733.1.
BC098165 mRNA. Translation: AAH98165.1.
BC099842 mRNA. Translation: AAH99842.1.
CCDSiCCDS45475.1. [Q9ULZ0-2]
CCDS45477.1. [Q9ULZ0-2]
CCDS58456.1. [Q9ULZ0-2]
CCDS58458.1. [Q9ULZ0-2]
RefSeqiNP_001093157.1. NM_001099687.3. [Q9ULZ0-2]
NP_001192188.1. NM_001205259.2. [Q9ULZ0-2]
NP_001230651.1. NM_001243722.2. [Q9ULZ0-2]
NP_001316990.1. NM_001330061.1.
NP_001316995.1. NM_001330066.1.
NP_057296.1. NM_016212.4. [Q9ULZ0-2]
XP_006721089.1. XM_006721026.1. [Q9ULZ0-1]
XP_006721137.1. XM_006721074.2. [Q9ULZ0-1]
XP_006721147.1. XM_006721084.1. [Q9ULZ0-1]
XP_006721180.1. XM_006721117.2. [Q9ULZ0-1]
XP_006721181.1. XM_006721118.1. [Q9ULZ0-1]
XP_006724967.1. XM_006724904.3. [Q9ULZ0-1]
XP_006724968.1. XM_006724905.3. [Q9ULZ0-2]
XP_011544081.1. XM_011545779.1. [Q9ULZ0-1]
XP_011544222.1. XM_011545920.1. [Q9ULZ0-1]
XP_011544235.1. XM_011545933.1. [Q9ULZ0-1]
XP_011544334.1. XM_011546032.1. [Q9ULZ0-1]
XP_011544335.1. XM_011546033.1. [Q9ULZ0-1]
XP_011544539.1. XM_011546237.1. [Q9ULZ0-1]
XP_011544540.1. XM_011546238.1. [Q9ULZ0-1]
XP_016878592.1. XM_017023103.1. [Q9ULZ0-1]
XP_016879081.1. XM_017023592.1. [Q9ULZ0-1]
XP_016879082.1. XM_017023593.1. [Q9ULZ0-1]
XP_016879124.1. XM_017023635.1. [Q9ULZ0-1]
XP_016879125.1. XM_017023636.1. [Q9ULZ0-1]
XP_016879126.1. XM_017023637.1. [Q9ULZ0-1]
XP_016879128.1. XM_017023639.1. [Q9ULZ0-1]
XP_016879441.1. XM_017023952.1. [Q9ULZ0-1]
XP_016879442.1. XM_017023953.1. [Q9ULZ0-1]
XP_016879446.1. XM_017023957.1. [Q9ULZ0-1]
XP_016879447.1. XM_017023958.1. [Q9ULZ0-1]
XP_016885615.1. XM_017030126.1. [Q9ULZ0-1]
XP_016885616.1. XM_017030127.1. [Q9ULZ0-1]
UniGeneiHs.513537.
Hs.592038.
Hs.624982.
Hs.706716.

Genome annotation databases

EnsembliENST00000341305; ENSP00000339405; ENSG00000261509. [Q9ULZ0-2]
ENST00000360260; ENSP00000353397; ENSG00000205457. [Q9ULZ0-3]
ENST00000380148; ENSP00000454398; ENSG00000205456. [Q9ULZ0-1]
ENST00000398664; ENSP00000455596; ENSG00000205456. [Q9ULZ0-2]
ENST00000398682; ENSP00000381672; ENSG00000183632. [Q9ULZ0-2]
ENST00000561509; ENSP00000455132; ENSG00000205457. [Q9ULZ0-2]
ENST00000565622; ENSP00000455448; ENSG00000183632. [Q9ULZ0-1]
ENST00000567137; ENSP00000454442; ENSG00000205457. [Q9ULZ0-3]
ENST00000567724; ENSP00000457303; ENSG00000261509. [Q9ULZ0-1]
ENST00000569420; ENSP00000457452; ENSG00000183632. [Q9ULZ0-3]
ENST00000569719; ENSP00000457790; ENSG00000205457. [Q9ULZ0-1]
ENST00000569741; ENSP00000456831; ENSG00000261509. [Q9ULZ0-3]
ENST00000611321; ENSP00000482283; ENSG00000275034. [Q9ULZ0-3]
ENST00000617705; ENSP00000481405; ENSG00000278848. [Q9ULZ0-3]
ENST00000623042; ENSP00000485635; ENSG00000278848. [Q9ULZ0-2]
ENST00000623491; ENSP00000485467; ENSG00000275034. [Q9ULZ0-2]
GeneIDi102723655.
102723713.
102724101.
102724127.
24150.
653550.
729264.
729355.
KEGGihsa:102723655.
hsa:102723713.
hsa:102724101.
hsa:102724127.
hsa:24150.
hsa:653550.
hsa:729264.
hsa:729355.
UCSCiuc002edd.5. human. [Q9ULZ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023508 mRNA. Translation: BAA84978.1.
AB023509 mRNA. Translation: BAA84979.1.
CR541650 mRNA. Translation: CAG46451.1.
AK312220 mRNA. Translation: BAG35153.1.
AL133588 mRNA. Translation: CAH10710.1.
BC096700 mRNA. Translation: AAH96700.1.
BC096733 mRNA. Translation: AAH96733.1.
BC098165 mRNA. Translation: AAH98165.1.
BC099842 mRNA. Translation: AAH99842.1.
CCDSiCCDS45475.1. [Q9ULZ0-2]
CCDS45477.1. [Q9ULZ0-2]
CCDS58456.1. [Q9ULZ0-2]
CCDS58458.1. [Q9ULZ0-2]
RefSeqiNP_001093157.1. NM_001099687.3. [Q9ULZ0-2]
NP_001192188.1. NM_001205259.2. [Q9ULZ0-2]
NP_001230651.1. NM_001243722.2. [Q9ULZ0-2]
NP_001316990.1. NM_001330061.1.
NP_001316995.1. NM_001330066.1.
NP_057296.1. NM_016212.4. [Q9ULZ0-2]
XP_006721089.1. XM_006721026.1. [Q9ULZ0-1]
XP_006721137.1. XM_006721074.2. [Q9ULZ0-1]
XP_006721147.1. XM_006721084.1. [Q9ULZ0-1]
XP_006721180.1. XM_006721117.2. [Q9ULZ0-1]
XP_006721181.1. XM_006721118.1. [Q9ULZ0-1]
XP_006724967.1. XM_006724904.3. [Q9ULZ0-1]
XP_006724968.1. XM_006724905.3. [Q9ULZ0-2]
XP_011544081.1. XM_011545779.1. [Q9ULZ0-1]
XP_011544222.1. XM_011545920.1. [Q9ULZ0-1]
XP_011544235.1. XM_011545933.1. [Q9ULZ0-1]
XP_011544334.1. XM_011546032.1. [Q9ULZ0-1]
XP_011544335.1. XM_011546033.1. [Q9ULZ0-1]
XP_011544539.1. XM_011546237.1. [Q9ULZ0-1]
XP_011544540.1. XM_011546238.1. [Q9ULZ0-1]
XP_016878592.1. XM_017023103.1. [Q9ULZ0-1]
XP_016879081.1. XM_017023592.1. [Q9ULZ0-1]
XP_016879082.1. XM_017023593.1. [Q9ULZ0-1]
XP_016879124.1. XM_017023635.1. [Q9ULZ0-1]
XP_016879125.1. XM_017023636.1. [Q9ULZ0-1]
XP_016879126.1. XM_017023637.1. [Q9ULZ0-1]
XP_016879128.1. XM_017023639.1. [Q9ULZ0-1]
XP_016879441.1. XM_017023952.1. [Q9ULZ0-1]
XP_016879442.1. XM_017023953.1. [Q9ULZ0-1]
XP_016879446.1. XM_017023957.1. [Q9ULZ0-1]
XP_016879447.1. XM_017023958.1. [Q9ULZ0-1]
XP_016885615.1. XM_017030126.1. [Q9ULZ0-1]
XP_016885616.1. XM_017030127.1. [Q9ULZ0-1]
UniGeneiHs.513537.
Hs.592038.
Hs.624982.
Hs.706716.

3D structure databases

ProteinModelPortaliQ9ULZ0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117300. 1 interactor.
IntActiQ9ULZ0. 1 interactor.

PTM databases

iPTMnetiQ9ULZ0.
PhosphoSitePlusiQ9ULZ0.

Polymorphism and mutation databases

BioMutaiTP53TG3.

Proteomic databases

PaxDbiQ9ULZ0.
PRIDEiQ9ULZ0.

Protocols and materials databases

DNASUi24150.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341305; ENSP00000339405; ENSG00000261509. [Q9ULZ0-2]
ENST00000360260; ENSP00000353397; ENSG00000205457. [Q9ULZ0-3]
ENST00000380148; ENSP00000454398; ENSG00000205456. [Q9ULZ0-1]
ENST00000398664; ENSP00000455596; ENSG00000205456. [Q9ULZ0-2]
ENST00000398682; ENSP00000381672; ENSG00000183632. [Q9ULZ0-2]
ENST00000561509; ENSP00000455132; ENSG00000205457. [Q9ULZ0-2]
ENST00000565622; ENSP00000455448; ENSG00000183632. [Q9ULZ0-1]
ENST00000567137; ENSP00000454442; ENSG00000205457. [Q9ULZ0-3]
ENST00000567724; ENSP00000457303; ENSG00000261509. [Q9ULZ0-1]
ENST00000569420; ENSP00000457452; ENSG00000183632. [Q9ULZ0-3]
ENST00000569719; ENSP00000457790; ENSG00000205457. [Q9ULZ0-1]
ENST00000569741; ENSP00000456831; ENSG00000261509. [Q9ULZ0-3]
ENST00000611321; ENSP00000482283; ENSG00000275034. [Q9ULZ0-3]
ENST00000617705; ENSP00000481405; ENSG00000278848. [Q9ULZ0-3]
ENST00000623042; ENSP00000485635; ENSG00000278848. [Q9ULZ0-2]
ENST00000623491; ENSP00000485467; ENSG00000275034. [Q9ULZ0-2]
GeneIDi102723655.
102723713.
102724101.
102724127.
24150.
653550.
729264.
729355.
KEGGihsa:102723655.
hsa:102723713.
hsa:102724101.
hsa:102724127.
hsa:24150.
hsa:653550.
hsa:729264.
hsa:729355.
UCSCiuc002edd.5. human. [Q9ULZ0-1]

Organism-specific databases

CTDi102724101.
102724127.
24150.
653550.
729264.
729355.
GeneCardsiTP53TG3.
TP53TG3B.
TP53TG3C.
TP53TG3D.
H-InvDBHIX0038748.
HIX0059557.
HIX0173204.
HIX0173288.
HIX0173289.
HGNCiHGNC:30759. TP53TG3.
HGNC:37202. TP53TG3B.
HGNC:42962. TP53TG3C.
HGNC:44657. TP53TG3D.
HGNC:51816. TP53TG3E.
HGNC:51817. TP53TG3F.
HPAiHPA047832.
neXtProtiNX_Q9ULZ0.
OpenTargetsiENSG00000183632.
ENSG00000205456.
ENSG00000205457.
ENSG00000261509.
ENSG00000274175.
ENSG00000275034.
ENSG00000275869.
ENSG00000278848.
PharmGKBiPA165450804.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KCDV. Eukaryota.
ENOG4110P2I. LUCA.
GeneTreeiENSGT00390000001729.
HOGENOMiHOG000154671.
InParanoidiQ9ULZ0.
OMAiHAQCGPS.
OrthoDBiEOG091G0TDR.
PhylomeDBiQ9ULZ0.
TreeFamiTF342471.

Miscellaneous databases

PROiQ9ULZ0.

Gene expression databases

BgeeiENSG00000183632.
ExpressionAtlasiQ9ULZ0. baseline and differential.
GenevisibleiQ9ULZ0. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiT53G3_HUMAN
AccessioniPrimary (citable) accession number: Q9ULZ0
Secondary accession number(s): B2R5K6, Q4KN31, Q9ULY9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.