Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TP53-target gene 3 protein

Gene

TP53TG3

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May play a significant role in p53/TP53-mediating signaling pathway.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
TP53-target gene 3 protein
Alternative name(s):
TP53-inducible gene 3 protein
Gene namesi
Name:TP53TG3Imported
Synonyms:TP53TG3A
AND
Name:TP53TG3BImported
AND
Name:TP53TG3CImported
AND
Name:TP53TG3DImported
AND
Name:TP53TG3EImported
AND
Name:TP53TG3FImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000183632.14
HostDB:ENSG00000205456.11
HostDB:ENSG00000205457.10
HostDB:ENSG00000261509.6
HGNCiHGNC:30759 TP53TG3
HGNC:37202 TP53TG3B
HGNC:42962 TP53TG3C
HGNC:44657 TP53TG3D
HGNC:51816 TP53TG3E
HGNC:51817 TP53TG3F
MIMi617482 gene
neXtProtiNX_Q9ULZ0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183632
ENSG00000205456
ENSG00000205457
PharmGKBiPA165450804

Polymorphism and mutation databases

BioMutaiTP53TG3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003289831 – 132TP53-target gene 3 proteinAdd BLAST132

Proteomic databases

PaxDbiQ9ULZ0
PRIDEiQ9ULZ0

PTM databases

iPTMnetiQ9ULZ0
PhosphoSitePlusiQ9ULZ0

Expressioni

Tissue specificityi

Strongly expressed in testis. Weakly expressed in heart, placenta and skeletal muscle.1 Publication

Inductioni

By p53/TP53.1 Publication

Gene expression databases

BgeeiENSG00000183632
ExpressionAtlasiQ9ULZ0 baseline and differential
GenevisibleiQ9ULZ0 HS

Interactioni

Protein-protein interaction databases

BioGridi117300, 1 interactor
IntActiQ9ULZ0, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ9ULZ0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410KCDV Eukaryota
ENOG4110P2I LUCA
GeneTreeiENSGT00390000001729
HOGENOMiHOG000154671
InParanoidiQ9ULZ0
OMAiEDRSAPC
OrthoDBiEOG09371IB9
PhylomeDBiQ9ULZ0
TreeFamiTF342471

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULZ0-1) [UniParc]FASTAAdd to basket
Also known as: TP53TG3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRASPCISQP AASWHPRPSA LRPTAGSGPD TRTPGTVEDG SAPCPAFRSP
60 70 80 90 100
AVSPCGEEPC CFQISPAEET LELGRLVSPG NCDTLSPRAA GFYACHVRSL
110 120 130
IPCRSTKGRW PLTASAAGLS RHAQCGPSLG LG
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Length:132
Mass (Da):13,627
Last modified:May 1, 2000 - v1
Checksum:i7158291F424405A8
GO
Isoform 2 (identifier: Q9ULZ0-2) [UniParc]FASTAAdd to basket
Also known as: TP53TG3a

The sequence of this isoform differs from the canonical sequence as follows:
     121-132: RHAQCGPSLGLG → SFSG

Show »
Length:124
Mass (Da):12,828
Checksum:iFD05DF7A8D1E79AE
GO
Isoform 3 (identifier: Q9ULZ0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-132: NCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSRHAQCGPSLGLG → CHKSSAPQERRLDPRARCVVHI

Show »
Length:102
Mass (Da):10,773
Checksum:iFBEECC55159EB007
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03287081 – 132NCDTL…SLGLG → CHKSSAPQERRLDPRARCVV HI in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_032871121 – 132RHAQC…SLGLG → SFSG in isoform 2. 3 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023508 mRNA Translation: BAA84978.1
AB023509 mRNA Translation: BAA84979.1
CR541650 mRNA Translation: CAG46451.1
AK312220 mRNA Translation: BAG35153.1
AL133588 mRNA Translation: CAH10710.1
BC096700 mRNA Translation: AAH96700.1
BC096733 mRNA Translation: AAH96733.1
BC098165 mRNA Translation: AAH98165.1
BC099842 mRNA Translation: AAH99842.1
CCDSiCCDS45475.1 [Q9ULZ0-2]
CCDS45477.1 [Q9ULZ0-2]
CCDS58456.1 [Q9ULZ0-2]
CCDS58458.1 [Q9ULZ0-2]
RefSeqiNP_001093157.1, NM_001099687.3 [Q9ULZ0-2]
NP_001192188.1, NM_001205259.2 [Q9ULZ0-2]
NP_001230651.1, NM_001243722.2 [Q9ULZ0-2]
NP_001316990.1, NM_001330061.1 [Q9ULZ0-2]
NP_001316995.1, NM_001330066.1 [Q9ULZ0-2]
NP_057296.1, NM_016212.4 [Q9ULZ0-2]
XP_006721089.1, XM_006721026.1 [Q9ULZ0-1]
XP_006721137.1, XM_006721074.2 [Q9ULZ0-1]
XP_006721147.1, XM_006721084.1 [Q9ULZ0-1]
XP_006721180.1, XM_006721117.2 [Q9ULZ0-1]
XP_006721181.1, XM_006721118.1 [Q9ULZ0-1]
XP_006724967.1, XM_006724904.3 [Q9ULZ0-1]
XP_006724968.1, XM_006724905.3 [Q9ULZ0-2]
XP_011544081.1, XM_011545779.1 [Q9ULZ0-1]
XP_011544222.1, XM_011545920.1 [Q9ULZ0-1]
XP_011544235.1, XM_011545933.1 [Q9ULZ0-1]
XP_011544334.1, XM_011546032.1 [Q9ULZ0-1]
XP_011544335.1, XM_011546033.1 [Q9ULZ0-1]
XP_011544539.1, XM_011546237.1 [Q9ULZ0-1]
XP_011544540.1, XM_011546238.1 [Q9ULZ0-1]
XP_016878592.1, XM_017023103.1 [Q9ULZ0-1]
XP_016879081.1, XM_017023592.1 [Q9ULZ0-1]
XP_016879082.1, XM_017023593.1 [Q9ULZ0-1]
XP_016879124.1, XM_017023635.1 [Q9ULZ0-1]
XP_016879125.1, XM_017023636.1 [Q9ULZ0-1]
XP_016879126.1, XM_017023637.1 [Q9ULZ0-1]
XP_016879128.1, XM_017023639.1 [Q9ULZ0-1]
XP_016879441.1, XM_017023952.1 [Q9ULZ0-1]
XP_016879442.1, XM_017023953.1 [Q9ULZ0-1]
XP_016879446.1, XM_017023957.1 [Q9ULZ0-1]
XP_016879447.1, XM_017023958.1 [Q9ULZ0-1]
XP_016885615.1, XM_017030126.1 [Q9ULZ0-1]
XP_016885616.1, XM_017030127.1 [Q9ULZ0-1]
UniGeneiHs.513537
Hs.592038
Hs.624982
Hs.706716

Genome annotation databases

EnsembliENST00000341305; ENSP00000339405; ENSG00000261509 [Q9ULZ0-2]
ENST00000360260; ENSP00000353397; ENSG00000205457 [Q9ULZ0-3]
ENST00000380148; ENSP00000454398; ENSG00000205456 [Q9ULZ0-1]
ENST00000398664; ENSP00000455596; ENSG00000205456 [Q9ULZ0-2]
ENST00000398682; ENSP00000381672; ENSG00000183632 [Q9ULZ0-2]
ENST00000561509; ENSP00000455132; ENSG00000205457 [Q9ULZ0-2]
ENST00000565622; ENSP00000455448; ENSG00000183632 [Q9ULZ0-1]
ENST00000567137; ENSP00000454442; ENSG00000205457 [Q9ULZ0-3]
ENST00000567724; ENSP00000457303; ENSG00000261509 [Q9ULZ0-1]
ENST00000569420; ENSP00000457452; ENSG00000183632 [Q9ULZ0-3]
ENST00000569719; ENSP00000457790; ENSG00000205457 [Q9ULZ0-1]
ENST00000569741; ENSP00000456831; ENSG00000261509 [Q9ULZ0-3]
ENST00000611321; ENSP00000482283; ENSG00000275034 [Q9ULZ0-3]
ENST00000617705; ENSP00000481405; ENSG00000278848 [Q9ULZ0-3]
ENST00000623042; ENSP00000485635; ENSG00000278848 [Q9ULZ0-2]
ENST00000623491; ENSP00000485467; ENSG00000275034 [Q9ULZ0-2]
GeneIDi102723655
102723713
102724101
102724127
24150
653550
729264
729355
KEGGihsa:102723655
hsa:102723713
hsa:102724101
hsa:102724127
hsa:24150
hsa:653550
hsa:729264
hsa:729355
UCSCiuc002edd.5 human [Q9ULZ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiT53G3_HUMAN
AccessioniPrimary (citable) accession number: Q9ULZ0
Secondary accession number(s): B2R5K6, Q4KN31, Q9ULY9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 1, 2000
Last modified: April 25, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health