Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Targeting protein for Xklp2

Gene

TPX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules (PubMed:18663142, PubMed:19208764). Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation (PubMed:18663142, PubMed:19208764). TPX2 is inactivated upon binding to importin-alpha (PubMed:26165940). At the onset of mitosis, GOLGA2 interacts with importin-alpha, liberating TPX2 from importin-alpha, allowing TPX2 to activates AURKA kinase and stimulates local microtubule nucleation (PubMed:26165940).3 Publications

GO - Molecular functioni

  • ATP binding Source: ProtInc
  • GTP binding Source: ProtInc
  • importin-alpha family protein binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • activation of protein kinase activity Source: UniProtKB
  • apoptotic process Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • cell proliferation Source: ProtInc
  • mitotic cell cycle Source: ProtInc
  • mitotic spindle assembly Source: UniProtKB
  • regulation of G2/M transition of mitotic cell cycle Source: Reactome
  • regulation of mitotic spindle organization Source: UniProtKB
  • regulation of signal transduction by p53 class mediator Source: Reactome

Keywordsi

Biological processApoptosis, Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-6804756. Regulation of TP53 Activity through Phosphorylation.
R-HSA-8854518. AURKA Activation by TPX2.

Names & Taxonomyi

Protein namesi
Recommended name:
Targeting protein for Xklp2
Alternative name(s):
Differentially expressed in cancerous and non-cancerous lung cells 2
Short name:
DIL-2
Hepatocellular carcinoma-associated antigen 519
Hepatocellular carcinoma-associated antigen 90
Protein fls353
Restricted expression proliferation-associated protein 100
Short name:
p100
Gene namesi
Name:TPX2
Synonyms:C20orf1, C20orf2, DIL2, HCA519
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000088325.15.
HGNCiHGNC:1249. TPX2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi22974.
OpenTargetsiENSG00000088325.
PharmGKBiPA25638.

Chemistry databases

ChEMBLiCHEMBL5389.

Polymorphism and mutation databases

BioMutaiTPX2.
DMDMi13124096.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000655811 – 747Targeting protein for Xklp2Add BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei59PhosphothreonineCombined sources1
Modified residuei72PhosphothreonineCombined sources1
Modified residuei121PhosphoserineCombined sources1
Modified residuei125PhosphoserineCombined sources1
Modified residuei128N6-acetyllysineBy similarity1
Modified residuei147PhosphothreonineCombined sources1
Modified residuei257PhosphoserineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei305N6-acetyllysineCombined sources1
Modified residuei310PhosphoserineCombined sources1
Modified residuei338PhosphothreonineCombined sources1
Modified residuei359PhosphoserineCombined sources1
Modified residuei369PhosphothreonineCombined sources1
Modified residuei375N6-acetyllysineBy similarity1
Cross-linki477Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei486PhosphoserineCombined sources1
Modified residuei499PhosphothreonineCombined sources1
Cross-linki500Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki641Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei738PhosphoserineCombined sources1
Cross-linki740Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9ULW0.
PaxDbiQ9ULW0.
PeptideAtlasiQ9ULW0.
PRIDEiQ9ULW0.

PTM databases

iPTMnetiQ9ULW0.
PhosphoSitePlusiQ9ULW0.

Expressioni

Tissue specificityi

Expressed in lung carcinoma cell lines but not in normal lung tissues.

Developmental stagei

Exclusively expressed in proliferating cells from the transition G1/S until the end of cytokinesis.

Gene expression databases

BgeeiENSG00000088325.
CleanExiHS_TPX2.
ExpressionAtlasiQ9ULW0. baseline and differential.
GenevisibleiQ9ULW0. HS.

Organism-specific databases

HPAiHPA005487.

Interactioni

Subunit structurei

Interacts with AURKA (PubMed:14580337, PubMed:18662907, PubMed:18663142). Interacts with importin-alpha; leading to inactivate TPX2 (PubMed:26165940). Interacts with HNRNPU; this interaction recruits HNRNPU to spindle microtubules (MTs) (PubMed:21242313, PubMed:25986610).6 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • importin-alpha family protein binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116624. 41 interactors.
CORUMiQ9ULW0.
DIPiDIP-36727N.
DIP-46212N.
IntActiQ9ULW0. 20 interactors.
MINTiMINT-4720346.
STRINGi9606.ENSP00000300403.

Structurei

Secondary structure

1747
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni19 – 21Combined sources3
Helixi30 – 32Combined sources3
Helixi33 – 41Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OL5X-ray2.50B1-43[»]
3E5AX-ray2.30B1-43[»]
3HA6X-ray2.36B1-43[»]
4C3PX-ray2.69B/E1-43[»]
5LXMX-ray2.08D6-43[»]
ProteinModelPortaliQ9ULW0.
SMRiQ9ULW0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9ULW0.

Family & Domainsi

Sequence similaritiesi

Belongs to the TPX2 family.Curated

Phylogenomic databases

eggNOGiENOG410IIEY. Eukaryota.
ENOG4110SQ6. LUCA.
GeneTreeiENSGT00390000009842.
HOGENOMiHOG000231739.
HOVERGENiHBG057334.
InParanoidiQ9ULW0.
KOiK16812.
OMAiSRPCPTK.
OrthoDBiEOG091G0MIV.
PhylomeDBiQ9ULW0.
TreeFamiTF328997.

Family and domain databases

InterProiView protein in InterPro
IPR015128. Aurora-A-bd.
IPR027329. TPX2_C.
IPR027330. TPX2_central_dom.
IPR009675. TPX2_fam.
PANTHERiPTHR14326. PTHR14326. 1 hit.
PfamiView protein in Pfam
PF09041. Aurora-A_bind. 1 hit.
PF06886. TPX2. 1 hit.
PF12214. TPX2_importin. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQVKSSYSY DAPSDFINFS SLDDEGDTQN IDSWFEEKAN LENKLLGKNG
60 70 80 90 100
TGGLFQGKTP LRKANLQQAI VTPLKPVDNT YYKEAEKENL VEQSIPSNAC
110 120 130 140 150
SSLEVEAAIS RKTPAQPQRR SLRLSAQKDL EQKEKHHVKM KAKRCATPVI
160 170 180 190 200
IDEILPSKKM KVSNNKKKPE EEGSAHQDTA EKNASSPEKA KGRHTVPCMP
210 220 230 240 250
PAKQKFLKST EEQELEKSMK MQQEVVEMRK KNEEFKKLAL AGIGQPVKKS
260 270 280 290 300
VSQVTKSVDF HFRTDERIKQ HPKNQEEYKE VNFTSELRKH PSSPARVTKG
310 320 330 340 350
CTIVKPFNLS QGKKRTFDET VSTYVPLAQQ VEDFHKRTPN RYHLRSKKDD
360 370 380 390 400
INLLPSKSSV TKICRDPQTP VLQTKHRARA VTCKSTAELE AEELEKLQQY
410 420 430 440 450
KFKARELDPR ILEGGPILPK KPPVKPPTEP IGFDLEIEKR IQERESKKKT
460 470 480 490 500
EDEHFEFHSR PCPTKILEDV VGVPEKKVLP ITVPKSPAFA LKNRIRMPTK
510 520 530 540 550
EDEEEDEPVV IKAQPVPHYG VPFKPQIPEA RTVEICPFSF DSRDKERQLQ
560 570 580 590 600
KEKKIKELQK GEVPKFKALP LPHFDTINLP EKKVKNVTQI EPFCLETDRR
610 620 630 640 650
GALKAQTWKH QLEEELRQQK EAACFKARPN TVISQEPFVP KKEKKSVAEG
660 670 680 690 700
LSGSLVQEPF QLATEKRAKE RQELEKRMAE VEAQKAQQLE EARLQEEEQK
710 720 730 740
KEELARLRRE LVHKANPIRK YQGLEIKSSD QPLTVPVSPK FSTRFHC
Length:747
Mass (Da):85,653
Last modified:February 21, 2001 - v2
Checksum:iE028E0BB50BBCA0F
GO
Isoform 2 (identifier: Q9ULW0-2) [UniParc]FASTAAdd to basket
Also known as: HCA90

The sequence of this isoform differs from the canonical sequence as follows:
     351-351: I → IKTGSCSVTQAGVQWRDHGSLQCPTPGLKQSSCLSLP

Note: No experimental confirmation available.
Show »
Length:783
Mass (Da):89,393
Checksum:i10C8E4122A53BF9E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti182K → N in BAA76931 (Ref. 3) Curated1
Sequence conflicti273K → E in BAA85893 (PubMed:10512675).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036269464T → N in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057355351I → IKTGSCSVTQAGVQWRDHGS LQCPTPGLKQSSCLSLP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027467 mRNA. Translation: BAA85893.1.
AF098158 mRNA. Translation: AAF03248.1.
AB024704 mRNA. Translation: BAA76931.1.
AF146731 mRNA. Translation: AAD33965.1.
AF287265 mRNA. Translation: AAK83033.1.
AL160175 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW76418.1.
CH471077 Genomic DNA. Translation: EAW76422.1.
BC004136 mRNA. Translation: AAH04136.1.
BC020207 mRNA. Translation: AAH20207.1.
AL117534 mRNA. Translation: CAB55982.1.
AF244547 mRNA. Translation: AAF81695.1.
CCDSiCCDS13190.1. [Q9ULW0-1]
PIRiT17292.
RefSeqiNP_036244.2. NM_012112.4. [Q9ULW0-1]
XP_011526999.1. XM_011528697.2. [Q9ULW0-1]
XP_011527001.1. XM_011528699.2. [Q9ULW0-1]
UniGeneiHs.244580.

Genome annotation databases

EnsembliENST00000300403; ENSP00000300403; ENSG00000088325. [Q9ULW0-1]
ENST00000340513; ENSP00000341145; ENSG00000088325. [Q9ULW0-2]
GeneIDi22974.
KEGGihsa:22974.
UCSCiuc002wwp.2. human. [Q9ULW0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTPX2_HUMAN
AccessioniPrimary (citable) accession number: Q9ULW0
Secondary accession number(s): Q96RR5
, Q9H1R4, Q9NRA3, Q9UFN9, Q9UL00, Q9Y2M1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 21, 2001
Last modified: November 22, 2017
This is version 171 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families