Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULV4

- COR1C_HUMAN

UniProt

Q9ULV4 - COR1C_HUMAN

Protein

Coronin-1C

Gene

CORO1C

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in cytokinesis, motility, and signal transduction.By similarity
    Isoform 3: Involved in myogenic differentiation.

    GO - Molecular functioni

    1. actin filament binding Source: RefGenome

    GO - Biological processi

    1. actin cytoskeleton organization Source: RefGenome
    2. phagocytosis Source: ProtInc
    3. signal transduction Source: ProtInc

    Keywords - Ligandi

    Actin-binding

    Enzyme and pathway databases

    SignaLinkiQ9ULV4.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Coronin-1C
    Alternative name(s):
    Coronin-3
    hCRNN4
    Gene namesi
    Name:CORO1C
    Synonyms:CRN2, CRNN4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:2254. CORO1C.

    Subcellular locationi

    Cell membrane 1 Publication. Cell projectionlamellipodium 1 Publication. Cytoplasmcytoskeleton 1 Publication
    Note: All isoforms localize in a diffuse and punctate pattern in the cytosol and are highly enriched in F-actin-rich areas. Isoform 3 colocalizes with the thin filaments of the sarcomere and with the postsynaptic area and the junctional sarcoplasm of motor end plates.

    GO - Cellular componenti

    1. actin cytoskeleton Source: RefGenome
    2. cytoplasm Source: UniProtKB-KW
    3. lamellipodium Source: UniProtKB-SubCell
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26770.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 474474Coronin-1CPRO_0000050926Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei446 – 4461N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9ULV4.
    PaxDbiQ9ULV4.
    PeptideAtlasiQ9ULV4.
    PRIDEiQ9ULV4.

    2D gel databases

    OGPiQ9ULV4.

    PTM databases

    PhosphoSiteiQ9ULV4.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiQ9ULV4.
    BgeeiQ9ULV4.
    CleanExiHS_CORO1C.
    GenevestigatoriQ9ULV4.

    Organism-specific databases

    HPAiHPA041737.

    Interactioni

    Subunit structurei

    Binds F-actin. Isoform 1 and isoform 2 appear as homotrimers, while isoform 3 seems to exist as monomers.2 Publications

    Protein-protein interaction databases

    BioGridi117136. 45 interactions.
    IntActiQ9ULV4. 11 interactions.
    MINTiMINT-1145632.
    STRINGi9606.ENSP00000261401.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULV4.
    SMRiQ9ULV4. Positions 8-391.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati78 – 11841WD 11 PublicationPROSITE-ProRule annotationAdd
    BLAST
    Repeati128 – 16841WD 21 PublicationPROSITE-ProRule annotationAdd
    BLAST
    Repeati172 – 20231WD 31 PublicationPROSITE-ProRule annotationAdd
    BLAST
    Repeati215 – 24935WD 41 PublicationPROSITE-ProRule annotationAdd
    BLAST
    Repeati263 – 30341WD 51 PublicationPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili436 – 474391 PublicationAdd
    BLAST

    Domaini

    The C-terminal coiled-coil domain is essential for cortical membrane localization and oligomerization.

    Sequence similaritiesi

    Belongs to the WD repeat coronin family.Curated
    Contains 5 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000166356.
    HOVERGENiHBG059978.
    InParanoidiQ9ULV4.
    KOiK13887.
    OMAiPKISMAS.
    OrthoDBiEOG7J70FB.
    PhylomeDBiQ9ULV4.
    TreeFamiTF314280.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR027333. CORO1C.
    IPR015505. Coronin.
    IPR015048. DUF1899.
    IPR015049. DUF1900.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PANTHERiPTHR10856. PTHR10856. 1 hit.
    PTHR10856:SF10. PTHR10856:SF10. 1 hit.
    PfamiPF08953. DUF1899. 1 hit.
    PF08954. DUF1900. 1 hit.
    PF00400. WD40. 3 hits.
    [Graphical view]
    SMARTiSM00320. WD40. 3 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ULV4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRRVVRQSKF RHVFGQAVKN DQCYDDIRVS RVTWDSSFCA VNPRFVAIII    50
    EASGGGAFLV LPLHKTGRID KSYPTVCGHT GPVLDIDWCP HNDQVIASGS 100
    EDCTVMVWQI PENGLTLSLT EPVVILEGHS KRVGIVAWHP TARNVLLSAG 150
    CDNAIIIWNV GTGEALINLD DMHSDMIYNV SWNRNGSLIC TASKDKKVRV 200
    IDPRKQEIVA EKEKAHEGAR PMRAIFLADG NVFTTGFSRM SERQLALWNP 250
    KNMQEPIALH EMDTSNGVLL PFYDPDTSII YLCGKGDSSI RYFEITDESP 300
    YVHYLNTFSS KEPQRGMGYM PKRGLDVNKC EIARFFKLHE RKCEPIIMTV 350
    PRKSDLFQDD LYPDTAGPEA ALEAEEWFEG KNADPILISL KHGYIPGKNR 400
    DLKVVKKNIL DSKPTANKKC DLISIPKKTT DTASVQNEAK LDEILKEIKS 450
    IKDTICNQDE RISKLEQQMA KIAA 474
    Length:474
    Mass (Da):53,249
    Last modified:May 1, 2000 - v1
    Checksum:iC7256797C514BB53
    GO
    Isoform 2 (identifier: Q9ULV4-2) [UniParc]FASTAAdd to Basket

    Also known as: CRN2i2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRWKDTM

    Show »
    Length:480
    Mass (Da):54,067
    Checksum:i75590C081614A540
    GO
    Isoform 3 (identifier: Q9ULV4-3) [UniParc]FASTAAdd to Basket

    Also known as: CRN2i3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MYGPGSQLGKSGNNSWAKERGCSIACQGSLTSARLHAPSIGERPLSHMRWKDTM

    Note: Exclusively expressed in well-differentiated myoblasts as well as in mature skeletal muscle.

    Show »
    Length:527
    Mass (Da):58,947
    Checksum:i11C115B9F0B8D722
    GO

    Sequence cautioni

    The sequence CAB82406.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MRWKDTM in isoform 2. 1 PublicationVSP_047727
    Alternative sequencei1 – 11M → MYGPGSQLGKSGNNSWAKER GCSIACQGSLTSARLHAPSI GERPLSHMRWKDTM in isoform 3. 1 PublicationVSP_047728

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB030656 mRNA. Translation: BAA83077.1.
    AM849477 mRNA. Translation: CAO94662.1.
    AM849478 mRNA. Translation: CAO94663.1.
    AK096363 mRNA. Translation: BAG53274.1.
    AL162070 mRNA. Translation: CAB82406.1. Different initiation.
    AC007569 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97826.1.
    BC002342 mRNA. Translation: AAH02342.1.
    CCDSiCCDS61236.1. [Q9ULV4-3]
    CCDS9120.1. [Q9ULV4-1]
    RefSeqiNP_001098707.1. NM_001105237.2. [Q9ULV4-3]
    NP_001263400.1. NM_001276471.1. [Q9ULV4-1]
    NP_055140.1. NM_014325.3. [Q9ULV4-1]
    UniGeneiHs.330384.

    Genome annotation databases

    EnsembliENST00000261401; ENSP00000261401; ENSG00000110880. [Q9ULV4-1]
    ENST00000420959; ENSP00000394496; ENSG00000110880. [Q9ULV4-3]
    ENST00000541050; ENSP00000438341; ENSG00000110880. [Q9ULV4-1]
    ENST00000549772; ENSP00000447534; ENSG00000110880. [Q9ULV4-2]
    GeneIDi23603.
    KEGGihsa:23603.
    UCSCiuc001tnj.4. human. [Q9ULV4-1]

    Polymorphism databases

    DMDMi12643898.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB030656 mRNA. Translation: BAA83077.1 .
    AM849477 mRNA. Translation: CAO94662.1 .
    AM849478 mRNA. Translation: CAO94663.1 .
    AK096363 mRNA. Translation: BAG53274.1 .
    AL162070 mRNA. Translation: CAB82406.1 . Different initiation.
    AC007569 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97826.1 .
    BC002342 mRNA. Translation: AAH02342.1 .
    CCDSi CCDS61236.1. [Q9ULV4-3 ]
    CCDS9120.1. [Q9ULV4-1 ]
    RefSeqi NP_001098707.1. NM_001105237.2. [Q9ULV4-3 ]
    NP_001263400.1. NM_001276471.1. [Q9ULV4-1 ]
    NP_055140.1. NM_014325.3. [Q9ULV4-1 ]
    UniGenei Hs.330384.

    3D structure databases

    ProteinModelPortali Q9ULV4.
    SMRi Q9ULV4. Positions 8-391.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117136. 45 interactions.
    IntActi Q9ULV4. 11 interactions.
    MINTi MINT-1145632.
    STRINGi 9606.ENSP00000261401.

    PTM databases

    PhosphoSitei Q9ULV4.

    Polymorphism databases

    DMDMi 12643898.

    2D gel databases

    OGPi Q9ULV4.

    Proteomic databases

    MaxQBi Q9ULV4.
    PaxDbi Q9ULV4.
    PeptideAtlasi Q9ULV4.
    PRIDEi Q9ULV4.

    Protocols and materials databases

    DNASUi 23603.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261401 ; ENSP00000261401 ; ENSG00000110880 . [Q9ULV4-1 ]
    ENST00000420959 ; ENSP00000394496 ; ENSG00000110880 . [Q9ULV4-3 ]
    ENST00000541050 ; ENSP00000438341 ; ENSG00000110880 . [Q9ULV4-1 ]
    ENST00000549772 ; ENSP00000447534 ; ENSG00000110880 . [Q9ULV4-2 ]
    GeneIDi 23603.
    KEGGi hsa:23603.
    UCSCi uc001tnj.4. human. [Q9ULV4-1 ]

    Organism-specific databases

    CTDi 23603.
    GeneCardsi GC12M109038.
    HGNCi HGNC:2254. CORO1C.
    HPAi HPA041737.
    MIMi 605269. gene.
    neXtProti NX_Q9ULV4.
    PharmGKBi PA26770.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000166356.
    HOVERGENi HBG059978.
    InParanoidi Q9ULV4.
    KOi K13887.
    OMAi PKISMAS.
    OrthoDBi EOG7J70FB.
    PhylomeDBi Q9ULV4.
    TreeFami TF314280.

    Enzyme and pathway databases

    SignaLinki Q9ULV4.

    Miscellaneous databases

    ChiTaRSi CORO1C. human.
    GeneWikii CORO1C.
    GenomeRNAii 23603.
    NextBioi 35463400.
    PROi Q9ULV4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULV4.
    Bgeei Q9ULV4.
    CleanExi HS_CORO1C.
    Genevestigatori Q9ULV4.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR027333. CORO1C.
    IPR015505. Coronin.
    IPR015048. DUF1899.
    IPR015049. DUF1900.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    PANTHERi PTHR10856. PTHR10856. 1 hit.
    PTHR10856:SF10. PTHR10856:SF10. 1 hit.
    Pfami PF08953. DUF1899. 1 hit.
    PF08954. DUF1900. 1 hit.
    PF00400. WD40. 3 hits.
    [Graphical view ]
    SMARTi SM00320. WD40. 3 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and chromosomal assignment of a novel human gene, CORO1C, homologous to coronin-like actin-binding proteins."
      Iizaka M., Han H.-J., Akashi H., Furukawa Y., Nakajima Y., Sugano S., Ogawa M., Nakamura Y.
      Cytogenet. Cell Genet. 88:221-224(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION (ISOFORM 3), ALTERNATIVE SPLICING, SUBUNIT.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Melanoma.
    5. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    8. "Oligomerization, F-actin interaction, and membrane association of the ubiquitous mammalian coronin 3 are mediated by its carboxyl terminus."
      Spoerl Z., Stumpf M., Noegel A.A., Hasse A.
      J. Biol. Chem. 277:48858-48867(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT, COILED-COIL REGION, WD REPEATS, INTERACTION WITH F-ACTIN, SUBCELLULAR LOCATION.
    9. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
      Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
      Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-446, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCOR1C_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULV4
    Secondary accession number(s): A7MAP0
    , A7MAP1, B3KU12, Q9NSK5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 131 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3