Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coronin-1C

Gene

CORO1C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in cytokinesis, motility, and signal transduction.By similarity
Isoform 3: Involved in myogenic differentiation.

GO - Molecular functioni

  • actin filament binding Source: UniProtKB

GO - Biological processi

  • actin cytoskeleton organization Source: GO_Central
  • activation of GTPase activity Source: UniProtKB
  • establishment of protein localization Source: UniProtKB
  • negative regulation of epithelial cell migration Source: UniProtKB
  • negative regulation of focal adhesion assembly Source: UniProtKB
  • negative regulation of protein kinase activity by regulation of protein phosphorylation Source: UniProtKB
  • negative regulation of protein phosphorylation Source: UniProtKB
  • negative regulation of substrate adhesion-dependent cell spreading Source: UniProtKB
  • neural crest cell migration Source: UniProtKB
  • phagocytosis Source: ProtInc
  • positive regulation of lamellipodium morphogenesis Source: UniProtKB
  • regulation of epithelial cell migration Source: UniProtKB
  • regulation of fibroblast migration Source: UniProtKB
  • regulation of focal adhesion assembly Source: UniProtKB
  • regulation of protein phosphorylation Source: UniProtKB
  • regulation of ruffle assembly Source: Ensembl
  • regulation of substrate adhesion-dependent cell spreading Source: UniProtKB
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000110880-MONOMER.
SignaLinkiQ9ULV4.
SIGNORiQ9ULV4.

Names & Taxonomyi

Protein namesi
Recommended name:
Coronin-1C
Alternative name(s):
Coronin-3
hCRNN4
Gene namesi
Name:CORO1C
Synonyms:CRN2, CRNN4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:2254. CORO1C.

Subcellular locationi

  • Cell membrane 1 Publication
  • Cell projectionlamellipodium 1 Publication
  • Cytoplasmcytoskeleton 1 Publication

  • Note: All isoforms localize in a diffuse and punctate pattern in the cytosol and are highly enriched in F-actin-rich areas. Isoform 3 colocalizes with the thin filaments of the sarcomere and with the postsynaptic area and the junctional sarcoplasm of motor end plates.

GO - Cellular componenti

  • actin cytoskeleton Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • flotillin complex Source: UniProtKB
  • focal adhesion Source: UniProtKB
  • lamellipodium Source: UniProtKB
  • lateral plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi23603.
OpenTargetsiENSG00000110880.
PharmGKBiPA26770.

Polymorphism and mutation databases

DMDMi12643898.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000509261 – 474Coronin-1CAdd BLAST474

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei446N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9ULV4.
PaxDbiQ9ULV4.
PeptideAtlasiQ9ULV4.
PRIDEiQ9ULV4.

2D gel databases

OGPiQ9ULV4.

PTM databases

iPTMnetiQ9ULV4.
PhosphoSitePlusiQ9ULV4.
SwissPalmiQ9ULV4.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000110880.
CleanExiHS_CORO1C.
ExpressionAtlasiQ9ULV4. baseline and differential.
GenevisibleiQ9ULV4. HS.

Organism-specific databases

HPAiHPA041737.

Interactioni

Subunit structurei

Binds F-actin. Isoform 1 and isoform 2 appear as homotrimers, while isoform 3 seems to exist as monomers.2 Publications

GO - Molecular functioni

  • actin filament binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117136. 103 interactors.
DIPiDIP-33138N.
IntActiQ9ULV4. 40 interactors.
MINTiMINT-1145632.
STRINGi9606.ENSP00000261401.

Structurei

3D structure databases

ProteinModelPortaliQ9ULV4.
SMRiQ9ULV4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati25 – 70WD 1PROSITE-ProRule annotationAdd BLAST46
Repeati78 – 118WD 2PROSITE-ProRule annotation1 PublicationAdd BLAST41
Repeati128 – 168WD 3PROSITE-ProRule annotation1 PublicationAdd BLAST41
Repeati172 – 202WD 4PROSITE-ProRule annotation1 PublicationAdd BLAST31
Repeati215 – 249WD 5PROSITE-ProRule annotation1 PublicationAdd BLAST35
Repeati263 – 303WD 6PROSITE-ProRule annotation1 PublicationAdd BLAST41

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili436 – 4741 PublicationAdd BLAST39

Domaini

The C-terminal coiled-coil domain is essential for cortical membrane localization and oligomerization.

Sequence similaritiesi

Belongs to the WD repeat coronin family.Curated
Contains 6 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0303. Eukaryota.
ENOG410XQAD. LUCA.
GeneTreeiENSGT00760000119195.
HOGENOMiHOG000166356.
HOVERGENiHBG059978.
InParanoidiQ9ULV4.
KOiK13886.
OMAiTISCNDK.
OrthoDBiEOG091G03H5.
PhylomeDBiQ9ULV4.
TreeFamiTF314280.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR027333. CORO1C.
IPR015505. Coronin.
IPR015048. DUF1899.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR10856. PTHR10856. 1 hit.
PTHR10856:SF10. PTHR10856:SF10. 1 hit.
PfamiPF08953. DUF1899. 1 hit.
PF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM01166. DUF1899. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRVVRQSKF RHVFGQAVKN DQCYDDIRVS RVTWDSSFCA VNPRFVAIII
60 70 80 90 100
EASGGGAFLV LPLHKTGRID KSYPTVCGHT GPVLDIDWCP HNDQVIASGS
110 120 130 140 150
EDCTVMVWQI PENGLTLSLT EPVVILEGHS KRVGIVAWHP TARNVLLSAG
160 170 180 190 200
CDNAIIIWNV GTGEALINLD DMHSDMIYNV SWNRNGSLIC TASKDKKVRV
210 220 230 240 250
IDPRKQEIVA EKEKAHEGAR PMRAIFLADG NVFTTGFSRM SERQLALWNP
260 270 280 290 300
KNMQEPIALH EMDTSNGVLL PFYDPDTSII YLCGKGDSSI RYFEITDESP
310 320 330 340 350
YVHYLNTFSS KEPQRGMGYM PKRGLDVNKC EIARFFKLHE RKCEPIIMTV
360 370 380 390 400
PRKSDLFQDD LYPDTAGPEA ALEAEEWFEG KNADPILISL KHGYIPGKNR
410 420 430 440 450
DLKVVKKNIL DSKPTANKKC DLISIPKKTT DTASVQNEAK LDEILKEIKS
460 470
IKDTICNQDE RISKLEQQMA KIAA
Length:474
Mass (Da):53,249
Last modified:May 1, 2000 - v1
Checksum:iC7256797C514BB53
GO
Isoform 2 (identifier: Q9ULV4-2) [UniParc]FASTAAdd to basket
Also known as: CRN2i2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRWKDTM

Show »
Length:480
Mass (Da):54,067
Checksum:i75590C081614A540
GO
Isoform 3 (identifier: Q9ULV4-3) [UniParc]FASTAAdd to basket
Also known as: CRN2i3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGPGSQLGKSGNNSWAKERGCSIACQGSLTSARLHAPSIGERPLSHMRWKDTM

Note: Exclusively expressed in well-differentiated myoblasts as well as in mature skeletal muscle.
Show »
Length:527
Mass (Da):58,947
Checksum:i11C115B9F0B8D722
GO

Sequence cautioni

The sequence CAB82406 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0477271M → MRWKDTM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0477281M → MYGPGSQLGKSGNNSWAKER GCSIACQGSLTSARLHAPSI GERPLSHMRWKDTM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030656 mRNA. Translation: BAA83077.1.
AM849477 mRNA. Translation: CAO94662.1.
AM849478 mRNA. Translation: CAO94663.1.
AK096363 mRNA. Translation: BAG53274.1.
AL162070 mRNA. Translation: CAB82406.1. Different initiation.
AC007569 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97826.1.
BC002342 mRNA. Translation: AAH02342.1.
CCDSiCCDS61236.1. [Q9ULV4-3]
CCDS9120.1. [Q9ULV4-1]
RefSeqiNP_001098707.1. NM_001105237.2. [Q9ULV4-3]
NP_001263400.1. NM_001276471.1. [Q9ULV4-1]
NP_055140.1. NM_014325.3. [Q9ULV4-1]
XP_016874610.1. XM_017019121.1. [Q9ULV4-3]
XP_016874611.1. XM_017019122.1. [Q9ULV4-1]
XP_016874612.1. XM_017019123.1. [Q9ULV4-1]
UniGeneiHs.330384.

Genome annotation databases

EnsembliENST00000261401; ENSP00000261401; ENSG00000110880. [Q9ULV4-1]
ENST00000420959; ENSP00000394496; ENSG00000110880. [Q9ULV4-3]
ENST00000541050; ENSP00000438341; ENSG00000110880. [Q9ULV4-1]
ENST00000549772; ENSP00000447534; ENSG00000110880. [Q9ULV4-2]
GeneIDi23603.
KEGGihsa:23603.
UCSCiuc001tnj.6. human. [Q9ULV4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030656 mRNA. Translation: BAA83077.1.
AM849477 mRNA. Translation: CAO94662.1.
AM849478 mRNA. Translation: CAO94663.1.
AK096363 mRNA. Translation: BAG53274.1.
AL162070 mRNA. Translation: CAB82406.1. Different initiation.
AC007569 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97826.1.
BC002342 mRNA. Translation: AAH02342.1.
CCDSiCCDS61236.1. [Q9ULV4-3]
CCDS9120.1. [Q9ULV4-1]
RefSeqiNP_001098707.1. NM_001105237.2. [Q9ULV4-3]
NP_001263400.1. NM_001276471.1. [Q9ULV4-1]
NP_055140.1. NM_014325.3. [Q9ULV4-1]
XP_016874610.1. XM_017019121.1. [Q9ULV4-3]
XP_016874611.1. XM_017019122.1. [Q9ULV4-1]
XP_016874612.1. XM_017019123.1. [Q9ULV4-1]
UniGeneiHs.330384.

3D structure databases

ProteinModelPortaliQ9ULV4.
SMRiQ9ULV4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117136. 103 interactors.
DIPiDIP-33138N.
IntActiQ9ULV4. 40 interactors.
MINTiMINT-1145632.
STRINGi9606.ENSP00000261401.

PTM databases

iPTMnetiQ9ULV4.
PhosphoSitePlusiQ9ULV4.
SwissPalmiQ9ULV4.

Polymorphism and mutation databases

DMDMi12643898.

2D gel databases

OGPiQ9ULV4.

Proteomic databases

EPDiQ9ULV4.
PaxDbiQ9ULV4.
PeptideAtlasiQ9ULV4.
PRIDEiQ9ULV4.

Protocols and materials databases

DNASUi23603.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261401; ENSP00000261401; ENSG00000110880. [Q9ULV4-1]
ENST00000420959; ENSP00000394496; ENSG00000110880. [Q9ULV4-3]
ENST00000541050; ENSP00000438341; ENSG00000110880. [Q9ULV4-1]
ENST00000549772; ENSP00000447534; ENSG00000110880. [Q9ULV4-2]
GeneIDi23603.
KEGGihsa:23603.
UCSCiuc001tnj.6. human. [Q9ULV4-1]

Organism-specific databases

CTDi23603.
DisGeNETi23603.
GeneCardsiCORO1C.
HGNCiHGNC:2254. CORO1C.
HPAiHPA041737.
MIMi605269. gene.
neXtProtiNX_Q9ULV4.
OpenTargetsiENSG00000110880.
PharmGKBiPA26770.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0303. Eukaryota.
ENOG410XQAD. LUCA.
GeneTreeiENSGT00760000119195.
HOGENOMiHOG000166356.
HOVERGENiHBG059978.
InParanoidiQ9ULV4.
KOiK13886.
OMAiTISCNDK.
OrthoDBiEOG091G03H5.
PhylomeDBiQ9ULV4.
TreeFamiTF314280.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000110880-MONOMER.
SignaLinkiQ9ULV4.
SIGNORiQ9ULV4.

Miscellaneous databases

ChiTaRSiCORO1C. human.
GeneWikiiCORO1C.
GenomeRNAii23603.
PROiQ9ULV4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000110880.
CleanExiHS_CORO1C.
ExpressionAtlasiQ9ULV4. baseline and differential.
GenevisibleiQ9ULV4. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR027333. CORO1C.
IPR015505. Coronin.
IPR015048. DUF1899.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR10856. PTHR10856. 1 hit.
PTHR10856:SF10. PTHR10856:SF10. 1 hit.
PfamiPF08953. DUF1899. 1 hit.
PF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM01166. DUF1899. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOR1C_HUMAN
AccessioniPrimary (citable) accession number: Q9ULV4
Secondary accession number(s): A7MAP0
, A7MAP1, B3KU12, Q9NSK5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 154 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.