Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ULV4 (COR1C_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 127. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Coronin-1C
Alternative name(s):
Coronin-3
hCRNN4
Gene names
Name:CORO1C
Synonyms:CRN2, CRNN4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length474 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in cytokinesis, motility, and signal transduction By similarity. Ref.2

Isoform 3:Involved in myogenic differentiation. Ref.2

Subunit structure

Binds F-actin. Isoform 1 and isoform 2 appear as homotrimers, while isoform 3 seems to exist as monomers. Ref.2 Ref.8

Subcellular location

Cell membrane. Cell projectionlamellipodium. Cytoplasmcytoskeleton. Note: All isoforms localize in a diffuse and punctate pattern in the cytosol and are highly enriched in F-actin-rich areas. Isoform 3 colocalizes with the thin filaments of the sarcomere and with the postsynaptic area and the junctional sarcoplasm of motor end plates. Ref.8

Tissue specificity

Ubiquitous.

Domain

The C-terminal coiled-coil domain is essential for cortical membrane localization and oligomerization.

Sequence similarities

Belongs to the WD repeat coronin family.

Contains 5 WD repeats.

Sequence caution

The sequence CAB82406.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ULV4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ULV4-2)

Also known as: CRN2i2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRWKDTM
Isoform 3 (identifier: Q9ULV4-3)

Also known as: CRN2i3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYGPGSQLGKSGNNSWAKERGCSIACQGSLTSARLHAPSIGERPLSHMRWKDTM
Note: Exclusively expressed in well-differentiated myoblasts as well as in mature skeletal muscle.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 474474Coronin-1C
PRO_0000050926

Regions

Repeat78 – 11841WD 1
Repeat128 – 16841WD 2
Repeat172 – 20231WD 3
Repeat215 – 24935WD 4
Repeat263 – 30341WD 5
Coiled coil436 – 47439 Ref.8

Amino acid modifications

Modified residue4461N6-acetyllysine Ref.10

Natural variations

Alternative sequence11M → MRWKDTM in isoform 2.
VSP_047727
Alternative sequence11M → MYGPGSQLGKSGNNSWAKER GCSIACQGSLTSARLHAPSI GERPLSHMRWKDTM in isoform 3.
VSP_047728

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: C7256797C514BB53

FASTA47453,249
        10         20         30         40         50         60 
MRRVVRQSKF RHVFGQAVKN DQCYDDIRVS RVTWDSSFCA VNPRFVAIII EASGGGAFLV 

        70         80         90        100        110        120 
LPLHKTGRID KSYPTVCGHT GPVLDIDWCP HNDQVIASGS EDCTVMVWQI PENGLTLSLT 

       130        140        150        160        170        180 
EPVVILEGHS KRVGIVAWHP TARNVLLSAG CDNAIIIWNV GTGEALINLD DMHSDMIYNV 

       190        200        210        220        230        240 
SWNRNGSLIC TASKDKKVRV IDPRKQEIVA EKEKAHEGAR PMRAIFLADG NVFTTGFSRM 

       250        260        270        280        290        300 
SERQLALWNP KNMQEPIALH EMDTSNGVLL PFYDPDTSII YLCGKGDSSI RYFEITDESP 

       310        320        330        340        350        360 
YVHYLNTFSS KEPQRGMGYM PKRGLDVNKC EIARFFKLHE RKCEPIIMTV PRKSDLFQDD 

       370        380        390        400        410        420 
LYPDTAGPEA ALEAEEWFEG KNADPILISL KHGYIPGKNR DLKVVKKNIL DSKPTANKKC 

       430        440        450        460        470 
DLISIPKKTT DTASVQNEAK LDEILKEIKS IKDTICNQDE RISKLEQQMA KIAA 

« Hide

Isoform 2 (CRN2i2) [UniParc].

Checksum: 75590C081614A540
Show »

FASTA48054,067
Isoform 3 (CRN2i3) [UniParc].

Checksum: 11C115B9F0B8D722
Show »

FASTA52758,947

References

« Hide 'large scale' references
[1]"Isolation and chromosomal assignment of a novel human gene, CORO1C, homologous to coronin-like actin-binding proteins."
Iizaka M., Han H.-J., Akashi H., Furukawa Y., Nakajima Y., Sugano S., Ogawa M., Nakamura Y.
Cytogenet. Cell Genet. 88:221-224(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Structural and functional diversity of novel coronin 1C (CRN2) isoforms in muscle."
Xavier C.P., Rastetter R.H., Stumpf M., Rosentreter A., Muller R., Reimann J., Cornfine S., Linder S., van Vliet V., Hofmann A., Morgan R.O., Fernandez M.P., Schroder R., Noegel A.A., Clemen C.S.
J. Mol. Biol. 393:287-299(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION (ISOFORM 3), ALTERNATIVE SPLICING, SUBUNIT.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Melanoma.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung.
[8]"Oligomerization, F-actin interaction, and membrane association of the ubiquitous mammalian coronin 3 are mediated by its carboxyl terminus."
Spoerl Z., Stumpf M., Noegel A.A., Hasse A.
J. Biol. Chem. 277:48858-48867(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, COILED-COIL REGION, WD REPEATS, INTERACTION WITH F-ACTIN, SUBCELLULAR LOCATION.
[9]"Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"Lysine acetylation targets protein complexes and co-regulates major cellular functions."
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-446, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB030656 mRNA. Translation: BAA83077.1.
AM849477 mRNA. Translation: CAO94662.1.
AM849478 mRNA. Translation: CAO94663.1.
AK096363 mRNA. Translation: BAG53274.1.
AL162070 mRNA. Translation: CAB82406.1. Different initiation.
AC007569 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97826.1.
BC002342 mRNA. Translation: AAH02342.1.
RefSeqNP_001098707.1. NM_001105237.2.
NP_001263400.1. NM_001276471.1.
NP_055140.1. NM_014325.3.
UniGeneHs.330384.

3D structure databases

ProteinModelPortalQ9ULV4.
SMRQ9ULV4. Positions 8-391.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117136. 53 interactions.
IntActQ9ULV4. 11 interactions.
MINTMINT-1145632.
STRING9606.ENSP00000261401.

PTM databases

PhosphoSiteQ9ULV4.

Polymorphism databases

DMDM12643898.

2D gel databases

OGPQ9ULV4.

Proteomic databases

PaxDbQ9ULV4.
PeptideAtlasQ9ULV4.
PRIDEQ9ULV4.

Protocols and materials databases

DNASU23603.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261401; ENSP00000261401; ENSG00000110880. [Q9ULV4-1]
ENST00000420959; ENSP00000394496; ENSG00000110880. [Q9ULV4-3]
ENST00000541050; ENSP00000438341; ENSG00000110880. [Q9ULV4-1]
ENST00000549772; ENSP00000447534; ENSG00000110880. [Q9ULV4-2]
GeneID23603.
KEGGhsa:23603.
UCSCuc001tnj.4. human. [Q9ULV4-1]

Organism-specific databases

CTD23603.
GeneCardsGC12M109038.
HGNCHGNC:2254. CORO1C.
HPAHPA041737.
MIM605269. gene.
neXtProtNX_Q9ULV4.
PharmGKBPA26770.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2319.
HOGENOMHOG000166356.
HOVERGENHBG059978.
InParanoidQ9ULV4.
KOK13887.
OMAPKISMAS.
OrthoDBEOG7J70FB.
PhylomeDBQ9ULV4.
TreeFamTF314280.

Enzyme and pathway databases

SignaLinkQ9ULV4.

Gene expression databases

ArrayExpressQ9ULV4.
BgeeQ9ULV4.
CleanExHS_CORO1C.
GenevestigatorQ9ULV4.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
InterProIPR027333. CORO1A/1C.
IPR015505. Coronin.
IPR015048. DUF1899.
IPR015049. DUF1900.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERPTHR10856. PTHR10856. 1 hit.
PTHR10856:SF10. PTHR10856:SF10. 1 hit.
PfamPF08953. DUF1899. 1 hit.
PF08954. DUF1900. 1 hit.
PF00400. WD40. 3 hits.
[Graphical view]
SMARTSM00320. WD40. 3 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 1 hit.
PROSITEPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCORO1C. human.
GeneWikiCORO1C.
GenomeRNAi23603.
NextBio35463400.
PROQ9ULV4.
SOURCESearch...

Entry information

Entry nameCOR1C_HUMAN
AccessionPrimary (citable) accession number: Q9ULV4
Secondary accession number(s): A7MAP0 expand/collapse secondary AC list , A7MAP1, B3KU12, Q9NSK5
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: March 19, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM