Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent secretion activator 1

Gene

CADPS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion. However, it may also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Exocytosis, Protein transport, Transport

Keywords - Ligandi

Calcium, Lipid-binding, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163618-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent secretion activator 1
Alternative name(s):
Calcium-dependent activator protein for secretion 1
Short name:
CAPS-1
Gene namesi
Name:CADPS
Synonyms:CAPS, CAPS1, KIAA1121
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:1426. CADPS.

Subcellular locationi

  • Cytoplasmic vesicle membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
  • Cell junctionsynapse By similarity

  • Note: Membrane-associated to vesicles. Strongly enriched in synaptic fractions. Preferentially binds to DCVs but not to SVs. Binds phosphoinosides, with a strong selectivity for PtdIns(4,5)P2 over PtdIns(3,4,5)P3. Probably localizes to different vesicles compared to CADPS2 (By similarity).By similarity

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • cytosol Source: ProtInc
  • presynapse Source: GOC
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi8618.
OpenTargetsiENSG00000163618.
PharmGKBiPA26024.

Polymorphism and mutation databases

BioMutaiCADPS.
DMDMi85540963.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538641 – 1353Calcium-dependent secretion activator 1Add BLAST1353

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei34PhosphoserineBy similarity1
Modified residuei91PhosphoserineBy similarity1
Modified residuei98PhosphoserineBy similarity1
Modified residuei261PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ULU8.
PeptideAtlasiQ9ULU8.
PRIDEiQ9ULU8.

PTM databases

iPTMnetiQ9ULU8.
PhosphoSitePlusiQ9ULU8.
SwissPalmiQ9ULU8.

Expressioni

Tissue specificityi

Specifically expressed in neural and endocrine secretory tissues. Expressed in brain and pancreas and at low level in heart. Also expressed in fetal heart, cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes, and putamen, as well as weak expression in spinal cord.1 Publication

Gene expression databases

BgeeiENSG00000163618.
CleanExiHS_CADPS.
HS_CAPS.
ExpressionAtlasiQ9ULU8. baseline and differential.
GenevisibleiQ9ULU8. HS.

Organism-specific databases

HPAiHPA059328.

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with RASL10B (By similarity). Interacts with the dopamine receptor DRD2.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FAM9BQ8IZU03EBI-10180690,EBI-10175124
SDCBPO005603EBI-10180690,EBI-727004
ZNF572Q7Z3I73EBI-10180690,EBI-10257016

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114174. 10 interactors.
IntActiQ9ULU8. 7 interactors.
MINTiMINT-1369496.
STRINGi9606.ENSP00000373215.

Structurei

Secondary structure

11353
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi522 – 531Combined sources10
Beta strandi533 – 535Combined sources3
Beta strandi540 – 550Combined sources11
Beta strandi553 – 557Combined sources5
Beta strandi561 – 564Combined sources4
Beta strandi569 – 571Combined sources3
Beta strandi576 – 579Combined sources4
Beta strandi590 – 596Combined sources7
Beta strandi601 – 605Combined sources5
Helixi609 – 623Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WI1NMR-A522-634[»]
ProteinModelPortaliQ9ULU8.
SMRiQ9ULU8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9ULU8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini400 – 481C2Add BLAST82
Domaini521 – 624PHPROSITE-ProRule annotationAdd BLAST104
Domaini931 – 1111MHD1PROSITE-ProRule annotationAdd BLAST181

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni790 – 1129Interaction with DRD21 PublicationAdd BLAST340
Regioni1177 – 1353Mediates targeting and association with DCVsBy similarityAdd BLAST177

Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids and plasma membrane. It however does not mediate binding to DCVs (By similarity).By similarity

Sequence similaritiesi

Contains 1 C2 domain.Curated
Contains 1 MHD1 (MUNC13 homology domain 1) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ9ULU8.
KOiK19933.
OMAiFCLASQV.
OrthoDBiEOG091G00HB.
PhylomeDBiQ9ULU8.
TreeFamiTF312963.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 2 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULU8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLDPSSSEEE SDEIVEEESG KEVLGSAPSG ARLSPSRTSE GSAGSAGLGG
60 70 80 90 100
GGAGAGAGVG AGGGGGSGAS SGGGAGGLQP SSRAGGGRPS SPSPSVVSEK
110 120 130 140 150
EKEELERLQK EEEERKKRLQ LYVFVMRCIA YPFNAKQPTD MARRQQKISK
160 170 180 190 200
QQLQTVKDRF QAFLNGETQI MADEAFMNAV QSYYEVFLKS DRVARMVQSG
210 220 230 240 250
GCSANDSREV FKKHIEKRVR SLPEIDGLSK ETVLSSWMAK FDAIYRGEED
260 270 280 290 300
PRKQQARMTA SAASELILSK EQLYEMFQNI LGIKKFEHQL LYNACQLDNP
310 320 330 340 350
DEQAAQIRRE LDGRLQMADQ IARERKFPKF VSKEMENMYI EELKSSVNLL
360 370 380 390 400
MANLESMPVS KGGEFKLQKL KRSHNASIID MGEESENQLS KSDVVLSFSL
410 420 430 440 450
EVVIMEVQGL KSLAPNRIVY CTMEVEGGEK LQTDQAEASK PTWGTQGDFS
460 470 480 490 500
TTHALPAVKV KLFTESTGVL ALEDKELGRV ILHPTPNSPK QSEWHKMTVS
510 520 530 540 550
KNCPDQDLKI KLAVRMDKPQ NMKHSGYLWA IGKNVWKRWK KRFFVLVQVS
560 570 580 590 600
QYTFAMCSYR EKKAEPQELL QLDGYTVDYT DPQPGLEGGR AFFNAVKEGD
610 620 630 640 650
TVIFASDDEQ DRILWVQAMY RATGQSHKPV PPTQVQKLNA KGGNVPQLDA
660 670 680 690 700
PISQFYADRA QKHGMDEFIS SNPCNFDHAS LFEMVQRLTL DHRLNDSYSC
710 720 730 740 750
LGWFSPGQVF VLDEYCARNG VRGCHRHLCY LRDLLERAEN GAMIDPTLLH
760 770 780 790 800
YSFAFCASHV HGNRPDGIGT VTVEEKERFE EIKERLRVLL ENQITHFRYC
810 820 830 840 850
FPFGRPEGAL KATLSLLERV LMKDIVTPVP QEEVKTVIRK CLEQAALVNY
860 870 880 890 900
SRLSEYAKIE ENQKDAENVG RLITPAKKLE DTIRLAELVI EVLQQNEEHH
910 920 930 940 950
AEPHVDKGEA FAWWSDLMVE HAETFLSLFA VDMDAALEVQ PPDTWDSFPL
960 970 980 990 1000
FQLLNDFLRT DYNLCNGKFH KHLQDLFAPL VVRYVDLMES SIAQSIHRGF
1010 1020 1030 1040 1050
ERESWEPVKS LTSNLPNVNL PNVNLPKVPN LPVNIPLGIP QMPTFSAPSW
1060 1070 1080 1090 1100
MAAIYDADNG SGTSEDLFWK LDALQTFIRD LHWPEEEFGK HLEQRLKLMA
1110 1120 1130 1140 1150
SDMIESCVKR TRIAFEVKLQ KTSRSTDFRV PQSICTMFNV MVDAKAQSTK
1160 1170 1180 1190 1200
LCSMEMGQEH QYHSKIDELI EETVKEMITL LVAKFVTILE GVLAKLSRYD
1210 1220 1230 1240 1250
EGTLFSSFLS FTVKAASKYV DVPKPGMDVA DAYVTFVRHS QDVLRDKVNE
1260 1270 1280 1290 1300
EMYIERLFDQ WYNSSMNVIC TWLTDRMDLQ LHIYQLKTLI RMVKKTYRDF
1310 1320 1330 1340 1350
RLQGVLDSTL NSKTYETIRN RLTVEEATAS VSEGGGLQGI SMKDSDEEDE

EDD
Length:1,353
Mass (Da):152,786
Last modified:January 10, 2006 - v3
Checksum:i9911C50B3A507112
GO
Isoform 2 (identifier: Q9ULU8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     685-701: Missing.
     861-866: Missing.
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Show »
Length:1,274
Mass (Da):144,084
Checksum:iB253C07E4964F651
GO
Isoform 3 (identifier: Q9ULU8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-867: ENQKDAE → GKKREMYEHPVFCLASQVMDLTIQ
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Note: No experimental confirmation available.
Show »
Length:1,314
Mass (Da):148,776
Checksum:i096F89AE6506C1CC
GO
Isoform 4 (identifier: Q9ULU8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1159-1159: E → EFAKMW

Show »
Length:1,358
Mass (Da):153,450
Checksum:i384A4097EC5B41A4
GO
Isoform 5 (identifier: Q9ULU8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     443-457: WGTQGDFSTTHALPA → VIRRNRREQLPHSAI
     458-1353: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):50,236
Checksum:i06A44C79DF4DE69B
GO

Sequence cautioni

The sequence AAA79701 differs from that shown. Reason: Frameshift at positions 1305 and 1317.Curated
The sequence AAH15754 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA86435 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti62G → S in AAM61861 (PubMed:12659812).Curated1
Sequence conflicti1197S → Y in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1230A → P in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1237V → G in AAA79701 (PubMed:9289490).Curated1
Sequence conflicti1250E → G in AAM61861 (PubMed:12659812).Curated1
Sequence conflicti1250E → G in CAD38751 (PubMed:17974005).Curated1
Sequence conflicti1292M → V in BAA86435 (PubMed:10574461).Curated1
Sequence conflicti1310L → F in AAM61861 (PubMed:12659812).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016801443 – 457WGTQG…HALPA → VIRRNRREQLPHSAI in isoform 5. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_016802458 – 1353Missing in isoform 5. 1 PublicationAdd BLAST896
Alternative sequenceiVSP_016803685 – 701Missing in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_016804861 – 867ENQKDAE → GKKREMYEHPVFCLASQVMD LTIQ in isoform 3. 1 Publication7
Alternative sequenceiVSP_016805861 – 866Missing in isoform 2. 1 Publication6
Alternative sequenceiVSP_016806902 – 908Missing in isoform 2 and isoform 3. 2 Publications7
Alternative sequenceiVSP_0168071009 – 1058KSLTS…IYDAD → N in isoform 2 and isoform 3. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_0168081159E → EFAKMW in isoform 4. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF458662 mRNA. Translation: AAM61861.1.
AB032947 mRNA. Translation: BAA86435.2. Different initiation.
AC104161 Genomic DNA. No translation available.
AL833895 mRNA. Translation: CAD38751.1.
U36448 mRNA. Translation: AAA79701.1. Frameshift.
BC015754 mRNA. Translation: AAH15754.1. Different initiation.
BC029460 mRNA. Translation: AAH29460.1.
BC072684 mRNA. Translation: AAH72684.1.
CCDSiCCDS2898.1. [Q9ULU8-2]
CCDS2899.1. [Q9ULU8-3]
CCDS46858.1. [Q9ULU8-1]
RefSeqiNP_003707.2. NM_003716.3. [Q9ULU8-1]
NP_899630.1. NM_183393.2. [Q9ULU8-2]
NP_899631.1. NM_183394.2. [Q9ULU8-3]
UniGeneiHs.654933.

Genome annotation databases

EnsembliENST00000283269; ENSP00000283269; ENSG00000163618. [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618. [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618. [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618. [Q9ULU8-5]
GeneIDi8618.
KEGGihsa:8618.
UCSCiuc003dll.3. human. [Q9ULU8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF458662 mRNA. Translation: AAM61861.1.
AB032947 mRNA. Translation: BAA86435.2. Different initiation.
AC104161 Genomic DNA. No translation available.
AL833895 mRNA. Translation: CAD38751.1.
U36448 mRNA. Translation: AAA79701.1. Frameshift.
BC015754 mRNA. Translation: AAH15754.1. Different initiation.
BC029460 mRNA. Translation: AAH29460.1.
BC072684 mRNA. Translation: AAH72684.1.
CCDSiCCDS2898.1. [Q9ULU8-2]
CCDS2899.1. [Q9ULU8-3]
CCDS46858.1. [Q9ULU8-1]
RefSeqiNP_003707.2. NM_003716.3. [Q9ULU8-1]
NP_899630.1. NM_183393.2. [Q9ULU8-2]
NP_899631.1. NM_183394.2. [Q9ULU8-3]
UniGeneiHs.654933.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WI1NMR-A522-634[»]
ProteinModelPortaliQ9ULU8.
SMRiQ9ULU8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114174. 10 interactors.
IntActiQ9ULU8. 7 interactors.
MINTiMINT-1369496.
STRINGi9606.ENSP00000373215.

PTM databases

iPTMnetiQ9ULU8.
PhosphoSitePlusiQ9ULU8.
SwissPalmiQ9ULU8.

Polymorphism and mutation databases

BioMutaiCADPS.
DMDMi85540963.

Proteomic databases

PaxDbiQ9ULU8.
PeptideAtlasiQ9ULU8.
PRIDEiQ9ULU8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000283269; ENSP00000283269; ENSG00000163618. [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618. [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618. [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618. [Q9ULU8-5]
GeneIDi8618.
KEGGihsa:8618.
UCSCiuc003dll.3. human. [Q9ULU8-1]

Organism-specific databases

CTDi8618.
DisGeNETi8618.
GeneCardsiCADPS.
H-InvDBHIX0003415.
HGNCiHGNC:1426. CADPS.
HPAiHPA059328.
MIMi604667. gene.
neXtProtiNX_Q9ULU8.
OpenTargetsiENSG00000163618.
PharmGKBiPA26024.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ9ULU8.
KOiK19933.
OMAiFCLASQV.
OrthoDBiEOG091G00HB.
PhylomeDBiQ9ULU8.
TreeFamiTF312963.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163618-MONOMER.

Miscellaneous databases

ChiTaRSiCADPS. human.
EvolutionaryTraceiQ9ULU8.
GeneWikiiCADPS.
GenomeRNAii8618.
PROiQ9ULU8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163618.
CleanExiHS_CADPS.
HS_CAPS.
ExpressionAtlasiQ9ULU8. baseline and differential.
GenevisibleiQ9ULU8. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 2 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAPS1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULU8
Secondary accession number(s): A6NF60
, Q13339, Q6GQQ6, Q8N2Z5, Q8N3M7, Q8NFR0, Q96BC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: November 2, 2016
This is version 133 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.