Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent secretion activator 1

Gene

CADPS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion. However, it may also participate in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Exocytosis, Protein transport, Transport

Keywords - Ligandi

Calcium, Lipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent secretion activator 1
Alternative name(s):
Calcium-dependent activator protein for secretion 1
Short name:
CAPS-1
Gene namesi
Name:CADPS
Synonyms:CAPS, CAPS1, KIAA1121
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:1426. CADPS.

Subcellular locationi

  • Cytoplasmic vesicle membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
  • Cell junctionsynapse By similarity

  • Note: Membrane-associated to vesicles. Strongly enriched in synaptic fractions. Preferentially binds to DCVs but not to SVs. Binds phosphoinosides, with a strong selectivity for PtdIns(4,5)P2 over PtdIns(3,4,5)P3. Probably localizes to different vesicles compared to CADPS2 (By similarity).By similarity

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • cytosol Source: ProtInc
  • presynapse Source: GOC
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26024.

Polymorphism and mutation databases

BioMutaiCADPS.
DMDMi85540963.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13531353Calcium-dependent secretion activator 1PRO_0000053864Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341PhosphoserineBy similarity
Modified residuei91 – 911PhosphoserineBy similarity
Modified residuei98 – 981PhosphoserineBy similarity
Modified residuei261 – 2611PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9ULU8.
MaxQBiQ9ULU8.
PaxDbiQ9ULU8.
PeptideAtlasiQ9ULU8.
PRIDEiQ9ULU8.

PTM databases

iPTMnetiQ9ULU8.
PhosphoSiteiQ9ULU8.
SwissPalmiQ9ULU8.

Expressioni

Tissue specificityi

Specifically expressed in neural and endocrine secretory tissues. Expressed in brain and pancreas and at low level in heart. Also expressed in fetal heart, cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobes, and putamen, as well as weak expression in spinal cord.1 Publication

Gene expression databases

BgeeiQ9ULU8.
CleanExiHS_CADPS.
HS_CAPS.
ExpressionAtlasiQ9ULU8. baseline and differential.
GenevisibleiQ9ULU8. HS.

Organism-specific databases

HPAiHPA059328.

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with RASL10B (By similarity). Interacts with the dopamine receptor DRD2.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FAM9BQ8IZU03EBI-10180690,EBI-10175124
SDCBPO005603EBI-10180690,EBI-727004
ZNF572Q7Z3I73EBI-10180690,EBI-10257016

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114174. 10 interactions.
IntActiQ9ULU8. 7 interactions.
MINTiMINT-1369496.
STRINGi9606.ENSP00000373215.

Structurei

Secondary structure

1
1353
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi522 – 53110Combined sources
Beta strandi533 – 5353Combined sources
Beta strandi540 – 55011Combined sources
Beta strandi553 – 5575Combined sources
Beta strandi561 – 5644Combined sources
Beta strandi569 – 5713Combined sources
Beta strandi576 – 5794Combined sources
Beta strandi590 – 5967Combined sources
Beta strandi601 – 6055Combined sources
Helixi609 – 62315Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WI1NMR-A522-634[»]
ProteinModelPortaliQ9ULU8.
SMRiQ9ULU8. Positions 522-634.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9ULU8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini400 – 48182C2Add
BLAST
Domaini521 – 624104PHPROSITE-ProRule annotationAdd
BLAST
Domaini931 – 1111181MHD1PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni790 – 1129340Interaction with DRD2Add
BLAST
Regioni1177 – 1353177Mediates targeting and association with DCVsBy similarityAdd
BLAST

Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids and plasma membrane. It however does not mediate binding to DCVs (By similarity).By similarity

Sequence similaritiesi

Contains 1 C2 domain.Curated
Contains 1 MHD1 (MUNC13 homology domain 1) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ9ULU8.
KOiK19933.
OMAiFCLASQV.
OrthoDBiEOG7K0ZD0.
PhylomeDBiQ9ULU8.
TreeFamiTF312963.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 2 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULU8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLDPSSSEEE SDEIVEEESG KEVLGSAPSG ARLSPSRTSE GSAGSAGLGG
60 70 80 90 100
GGAGAGAGVG AGGGGGSGAS SGGGAGGLQP SSRAGGGRPS SPSPSVVSEK
110 120 130 140 150
EKEELERLQK EEEERKKRLQ LYVFVMRCIA YPFNAKQPTD MARRQQKISK
160 170 180 190 200
QQLQTVKDRF QAFLNGETQI MADEAFMNAV QSYYEVFLKS DRVARMVQSG
210 220 230 240 250
GCSANDSREV FKKHIEKRVR SLPEIDGLSK ETVLSSWMAK FDAIYRGEED
260 270 280 290 300
PRKQQARMTA SAASELILSK EQLYEMFQNI LGIKKFEHQL LYNACQLDNP
310 320 330 340 350
DEQAAQIRRE LDGRLQMADQ IARERKFPKF VSKEMENMYI EELKSSVNLL
360 370 380 390 400
MANLESMPVS KGGEFKLQKL KRSHNASIID MGEESENQLS KSDVVLSFSL
410 420 430 440 450
EVVIMEVQGL KSLAPNRIVY CTMEVEGGEK LQTDQAEASK PTWGTQGDFS
460 470 480 490 500
TTHALPAVKV KLFTESTGVL ALEDKELGRV ILHPTPNSPK QSEWHKMTVS
510 520 530 540 550
KNCPDQDLKI KLAVRMDKPQ NMKHSGYLWA IGKNVWKRWK KRFFVLVQVS
560 570 580 590 600
QYTFAMCSYR EKKAEPQELL QLDGYTVDYT DPQPGLEGGR AFFNAVKEGD
610 620 630 640 650
TVIFASDDEQ DRILWVQAMY RATGQSHKPV PPTQVQKLNA KGGNVPQLDA
660 670 680 690 700
PISQFYADRA QKHGMDEFIS SNPCNFDHAS LFEMVQRLTL DHRLNDSYSC
710 720 730 740 750
LGWFSPGQVF VLDEYCARNG VRGCHRHLCY LRDLLERAEN GAMIDPTLLH
760 770 780 790 800
YSFAFCASHV HGNRPDGIGT VTVEEKERFE EIKERLRVLL ENQITHFRYC
810 820 830 840 850
FPFGRPEGAL KATLSLLERV LMKDIVTPVP QEEVKTVIRK CLEQAALVNY
860 870 880 890 900
SRLSEYAKIE ENQKDAENVG RLITPAKKLE DTIRLAELVI EVLQQNEEHH
910 920 930 940 950
AEPHVDKGEA FAWWSDLMVE HAETFLSLFA VDMDAALEVQ PPDTWDSFPL
960 970 980 990 1000
FQLLNDFLRT DYNLCNGKFH KHLQDLFAPL VVRYVDLMES SIAQSIHRGF
1010 1020 1030 1040 1050
ERESWEPVKS LTSNLPNVNL PNVNLPKVPN LPVNIPLGIP QMPTFSAPSW
1060 1070 1080 1090 1100
MAAIYDADNG SGTSEDLFWK LDALQTFIRD LHWPEEEFGK HLEQRLKLMA
1110 1120 1130 1140 1150
SDMIESCVKR TRIAFEVKLQ KTSRSTDFRV PQSICTMFNV MVDAKAQSTK
1160 1170 1180 1190 1200
LCSMEMGQEH QYHSKIDELI EETVKEMITL LVAKFVTILE GVLAKLSRYD
1210 1220 1230 1240 1250
EGTLFSSFLS FTVKAASKYV DVPKPGMDVA DAYVTFVRHS QDVLRDKVNE
1260 1270 1280 1290 1300
EMYIERLFDQ WYNSSMNVIC TWLTDRMDLQ LHIYQLKTLI RMVKKTYRDF
1310 1320 1330 1340 1350
RLQGVLDSTL NSKTYETIRN RLTVEEATAS VSEGGGLQGI SMKDSDEEDE

EDD
Length:1,353
Mass (Da):152,786
Last modified:January 10, 2006 - v3
Checksum:i9911C50B3A507112
GO
Isoform 2 (identifier: Q9ULU8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     685-701: Missing.
     861-866: Missing.
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Show »
Length:1,274
Mass (Da):144,084
Checksum:iB253C07E4964F651
GO
Isoform 3 (identifier: Q9ULU8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-867: ENQKDAE → GKKREMYEHPVFCLASQVMDLTIQ
     902-908: Missing.
     1009-1058: KSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDAD → N

Note: No experimental confirmation available.
Show »
Length:1,314
Mass (Da):148,776
Checksum:i096F89AE6506C1CC
GO
Isoform 4 (identifier: Q9ULU8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1159-1159: E → EFAKMW

Show »
Length:1,358
Mass (Da):153,450
Checksum:i384A4097EC5B41A4
GO
Isoform 5 (identifier: Q9ULU8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     443-457: WGTQGDFSTTHALPA → VIRRNRREQLPHSAI
     458-1353: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):50,236
Checksum:i06A44C79DF4DE69B
GO

Sequence cautioni

The sequence AAA79701.1 differs from that shown. Reason: Frameshift at positions 1305 and 1317. Curated
The sequence AAH15754.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA86435.2 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti62 – 621G → S in AAM61861 (PubMed:12659812).Curated
Sequence conflicti1197 – 11971S → Y in AAA79701 (PubMed:9289490).Curated
Sequence conflicti1230 – 12301A → P in AAA79701 (PubMed:9289490).Curated
Sequence conflicti1237 – 12371V → G in AAA79701 (PubMed:9289490).Curated
Sequence conflicti1250 – 12501E → G in AAM61861 (PubMed:12659812).Curated
Sequence conflicti1250 – 12501E → G in CAD38751 (PubMed:17974005).Curated
Sequence conflicti1292 – 12921M → V in BAA86435 (PubMed:10574461).Curated
Sequence conflicti1310 – 13101L → F in AAM61861 (PubMed:12659812).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei443 – 45715WGTQG…HALPA → VIRRNRREQLPHSAI in isoform 5. 1 PublicationVSP_016801Add
BLAST
Alternative sequencei458 – 1353896Missing in isoform 5. 1 PublicationVSP_016802Add
BLAST
Alternative sequencei685 – 70117Missing in isoform 2. 1 PublicationVSP_016803Add
BLAST
Alternative sequencei861 – 8677ENQKDAE → GKKREMYEHPVFCLASQVMD LTIQ in isoform 3. 1 PublicationVSP_016804
Alternative sequencei861 – 8666Missing in isoform 2. 1 PublicationVSP_016805
Alternative sequencei902 – 9087Missing in isoform 2 and isoform 3. 2 PublicationsVSP_016806
Alternative sequencei1009 – 105850KSLTS…IYDAD → N in isoform 2 and isoform 3. 2 PublicationsVSP_016807Add
BLAST
Alternative sequencei1159 – 11591E → EFAKMW in isoform 4. 2 PublicationsVSP_016808

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF458662 mRNA. Translation: AAM61861.1.
AB032947 mRNA. Translation: BAA86435.2. Different initiation.
AC104161 Genomic DNA. No translation available.
AL833895 mRNA. Translation: CAD38751.1.
U36448 mRNA. Translation: AAA79701.1. Frameshift.
BC015754 mRNA. Translation: AAH15754.1. Different initiation.
BC029460 mRNA. Translation: AAH29460.1.
BC072684 mRNA. Translation: AAH72684.1.
CCDSiCCDS2898.1. [Q9ULU8-2]
CCDS2899.1. [Q9ULU8-3]
CCDS46858.1. [Q9ULU8-1]
RefSeqiNP_003707.2. NM_003716.3. [Q9ULU8-1]
NP_899630.1. NM_183393.2. [Q9ULU8-2]
NP_899631.1. NM_183394.2. [Q9ULU8-3]
UniGeneiHs.654933.

Genome annotation databases

EnsembliENST00000283269; ENSP00000283269; ENSG00000163618. [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618. [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618. [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618. [Q9ULU8-5]
GeneIDi8618.
KEGGihsa:8618.
UCSCiuc003dll.3. human. [Q9ULU8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF458662 mRNA. Translation: AAM61861.1.
AB032947 mRNA. Translation: BAA86435.2. Different initiation.
AC104161 Genomic DNA. No translation available.
AL833895 mRNA. Translation: CAD38751.1.
U36448 mRNA. Translation: AAA79701.1. Frameshift.
BC015754 mRNA. Translation: AAH15754.1. Different initiation.
BC029460 mRNA. Translation: AAH29460.1.
BC072684 mRNA. Translation: AAH72684.1.
CCDSiCCDS2898.1. [Q9ULU8-2]
CCDS2899.1. [Q9ULU8-3]
CCDS46858.1. [Q9ULU8-1]
RefSeqiNP_003707.2. NM_003716.3. [Q9ULU8-1]
NP_899630.1. NM_183393.2. [Q9ULU8-2]
NP_899631.1. NM_183394.2. [Q9ULU8-3]
UniGeneiHs.654933.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WI1NMR-A522-634[»]
ProteinModelPortaliQ9ULU8.
SMRiQ9ULU8. Positions 522-634.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114174. 10 interactions.
IntActiQ9ULU8. 7 interactions.
MINTiMINT-1369496.
STRINGi9606.ENSP00000373215.

PTM databases

iPTMnetiQ9ULU8.
PhosphoSiteiQ9ULU8.
SwissPalmiQ9ULU8.

Polymorphism and mutation databases

BioMutaiCADPS.
DMDMi85540963.

Proteomic databases

EPDiQ9ULU8.
MaxQBiQ9ULU8.
PaxDbiQ9ULU8.
PeptideAtlasiQ9ULU8.
PRIDEiQ9ULU8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000283269; ENSP00000283269; ENSG00000163618. [Q9ULU8-3]
ENST00000357948; ENSP00000350632; ENSG00000163618. [Q9ULU8-2]
ENST00000383710; ENSP00000373215; ENSG00000163618. [Q9ULU8-1]
ENST00000490353; ENSP00000418736; ENSG00000163618. [Q9ULU8-5]
GeneIDi8618.
KEGGihsa:8618.
UCSCiuc003dll.3. human. [Q9ULU8-1]

Organism-specific databases

CTDi8618.
GeneCardsiCADPS.
H-InvDBHIX0003415.
HGNCiHGNC:1426. CADPS.
HPAiHPA059328.
MIMi604667. gene.
neXtProtiNX_Q9ULU8.
PharmGKBiPA26024.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ9ULU8.
KOiK19933.
OMAiFCLASQV.
OrthoDBiEOG7K0ZD0.
PhylomeDBiQ9ULU8.
TreeFamiTF312963.

Miscellaneous databases

ChiTaRSiCADPS. human.
EvolutionaryTraceiQ9ULU8.
GeneWikiiCADPS.
GenomeRNAii8618.
PROiQ9ULU8.
SOURCEiSearch...

Gene expression databases

BgeeiQ9ULU8.
CleanExiHS_CADPS.
HS_CAPS.
ExpressionAtlasiQ9ULU8. baseline and differential.
GenevisibleiQ9ULU8. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 2 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of human CADPS and CADPS2, new members of the Ca2+-dependent activator for secretion protein family."
    Cisternas F.A., Vincent J.B., Scherer S.W., Ray P.N.
    Genomics 81:279-291(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
  2. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 116-1353 (ISOFORM 3).
    Tissue: Amygdala.
  6. "Novel Ca2+-binding protein (CAPS) related to UNC-31 required for Ca2+-activated exocytosis."
    Ann K., Kowalchyk J.A., Loyet K.M., Martin T.F.J.
    J. Biol. Chem. 272:19637-19640(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1108-1353 (ISOFORM 4).
    Tissue: Brain.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1109-1353 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 320-1353 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1121-1353.
    Tissue: PNS and Skin.
  8. "Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium-dependent activator protein for secretion (CAPS)."
    Binda A.V., Kabbani N., Levenson R.
    Biochem. Pharmacol. 69:1451-1461(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DRD2.
  9. "Solution structure of the PH domain of human calcium-dependent activator protein for secretion (CAPS)."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 522-634.

Entry informationi

Entry nameiCAPS1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULU8
Secondary accession number(s): A6NF60
, Q13339, Q6GQQ6, Q8N2Z5, Q8N3M7, Q8NFR0, Q96BC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: July 6, 2016
This is version 130 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.