Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein kinase C-binding protein 1

Gene

ZMYND8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri88 – 13346PHD-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1028 – 106235MYND-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein kinase C-binding protein 1
Alternative name(s):
Cutaneous T-cell lymphoma-associated antigen se14-3
Short name:
CTCL-associated antigen se14-3
Rack7
Zinc finger MYND domain-containing protein 8
Gene namesi
Name:ZMYND8
Synonyms:KIAA1125, PRKCBP1, RACK7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:9397. ZMYND8.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162409890.

Polymorphism and mutation databases

BioMutaiZMYND8.
DMDMi25453223.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11861186Protein kinase C-binding protein 1PRO_0000211209Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei24 – 241PhosphoserineCombined sources
Modified residuei404 – 4041PhosphothreonineCombined sources
Modified residuei406 – 4061PhosphoserineCombined sources
Modified residuei413 – 4131N6-acetyllysineCombined sources
Modified residuei417 – 4171PhosphoserineCombined sources
Modified residuei425 – 4251PhosphoserineCombined sources
Modified residuei432 – 4321PhosphoserineCombined sources
Modified residuei444 – 4441PhosphoserineCombined sources
Modified residuei460 – 4601PhosphoserineCombined sources
Modified residuei462 – 4621PhosphoserineCombined sources
Modified residuei465 – 4651PhosphoserineCombined sources
Modified residuei486 – 4861PhosphoserineCombined sources
Modified residuei490 – 4901PhosphoserineCombined sources
Modified residuei495 – 4951PhosphoserineCombined sources
Modified residuei514 – 5141PhosphoserineCombined sources
Modified residuei523 – 5231PhosphoserineCombined sources
Modified residuei541 – 5411PhosphothreonineCombined sources
Modified residuei547 – 5471PhosphoserineCombined sources
Modified residuei563 – 5631PhosphothreonineCombined sources
Cross-linki611 – 611Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki645 – 645Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei652 – 6521PhosphoserineCombined sources
Modified residuei655 – 6551PhosphoserineCombined sources
Modified residuei668 – 6681PhosphoserineCombined sources
Modified residuei682 – 6821PhosphoserineCombined sources
Modified residuei707 – 7071PhosphoserineCombined sources
Modified residuei709 – 7091PhosphoserineCombined sources
Modified residuei737 – 7371PhosphoserineCombined sources
Modified residuei746 – 7461PhosphothreonineCombined sources
Modified residuei754 – 7541PhosphoserineCombined sources
Modified residuei756 – 7561PhosphoserineCombined sources
Modified residuei1119 – 11191PhosphoserineCombined sources
Modified residuei1141 – 11411PhosphoserineCombined sources
Isoform 5 (identifier: Q9ULU4-5)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 7 (identifier: Q9ULU4-7)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 8 (identifier: Q9ULU4-8)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 10 (identifier: Q9ULU4-10)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 12 (identifier: Q9ULU4-12)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 13 (identifier: Q9ULU4-13)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 14 (identifier: Q9ULU4-14)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 15 (identifier: Q9ULU4-15)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 16 (identifier: Q9ULU4-16)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 17 (identifier: Q9ULU4-17)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 18 (identifier: Q9ULU4-18)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 22 (identifier: Q9ULU4-22)
Cross-linki12 – 12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9ULU4.
MaxQBiQ9ULU4.
PeptideAtlasiQ9ULU4.
PRIDEiQ9ULU4.

PTM databases

iPTMnetiQ9ULU4.
PhosphoSiteiQ9ULU4.

Expressioni

Tissue specificityi

Expressed in all tissues examined with highest expression in brain, lung, pancreas, and placenta. Expressed in cutaneous T-cell lymphomas (CTCL).

Gene expression databases

BgeeiQ9ULU4.
CleanExiHS_ZMYND8.
ExpressionAtlasiQ9ULU4. baseline and differential.
GenevisibleiQ9ULU4. HS.

Organism-specific databases

HPAiHPA020949.

Interactioni

Subunit structurei

Interacts in vitro with PRKCB1.

Binary interactionsi

WithEntry#Exp.IntActNotes
BCL6P411823EBI-765834,EBI-765407

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117146. 56 interactions.
IntActiQ9ULU4. 44 interactions.
MINTiMINT-1183677.

Structurei

Secondary structure

1
1186
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi89 – 913Combined sources
Turni92 – 943Combined sources
Beta strandi104 – 1074Combined sources
Helixi112 – 1154Combined sources
Helixi128 – 13710Combined sources
Helixi139 – 1413Combined sources
Helixi144 – 1474Combined sources
Helixi151 – 16515Combined sources
Helixi171 – 1733Combined sources
Turni179 – 1813Combined sources
Helixi185 – 1884Combined sources
Helixi195 – 2039Combined sources
Helixi210 – 22819Combined sources
Helixi233 – 25422Combined sources
Helixi256 – 2649Combined sources
Helixi269 – 2713Combined sources
Beta strandi280 – 2834Combined sources
Beta strandi291 – 2999Combined sources
Beta strandi302 – 3076Combined sources
Turni308 – 3103Combined sources
Beta strandi313 – 3175Combined sources
Helixi318 – 3203Combined sources
Beta strandi321 – 3233Combined sources
Helixi336 – 35722Combined sources
Helixi375 – 3773Combined sources
Helixi384 – 3863Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4COSX-ray1.67A83-406[»]
ProteinModelPortaliQ9ULU4.
SMRiQ9ULU4. Positions 86-399.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini165 – 23571BromoPROSITE-ProRule annotationAdd
BLAST
Domaini277 – 32751PWWPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1147 – 118640Interacts with PRKCB1Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi43 – 475Poly-Lys
Compositional biasi838 – 85417Poly-GlnAdd
BLAST
Compositional biasi1089 – 10924Poly-Ser

Sequence similaritiesi

Contains 1 bromo domain.PROSITE-ProRule annotation
Contains 1 MYND-type zinc finger.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation
Contains 1 PWWP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri88 – 13346PHD-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1028 – 106235MYND-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00530000063428.
HOGENOMiHOG000230951.
HOVERGENiHBG031823.
InParanoidiQ9ULU4.
OMAiMDFLEKS.
OrthoDBiEOG700875.
PhylomeDBiQ9ULU4.
TreeFamiTF317221.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR021931. DUF3544.
IPR000313. PWWP_dom.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR002893. Znf_MYND.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF12064. DUF3544. 1 hit.
PF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00293. PWWP. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50812. PWWP. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (23)i

Sequence statusi: Complete.

This entry describes 23 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDISTRSKDP GSAERTAQKR KFPSPPHSSN GHSPQDTSTS PIKKKKKPGL
60 70 80 90 100
LNSNNKEQSE LRHGPFYYMK QPLTTDPVDV VPQDGRNDFY CWVCHREGQV
110 120 130 140 150
LCCELCPRVY HAKCLRLTSE PEGDWFCPEC EKITVAECIE TQSKAMTMLT
160 170 180 190 200
IEQLSYLLKF AIQKMKQPGT DAFQKPVPLE QHPDYAEYIF HPMDLCTLEK
210 220 230 240 250
NAKKKMYGCT EAFLADAKWI LHNCIIYNGG NHKLTQIAKV VIKICEHEMN
260 270 280 290 300
EIEVCPECYL AACQKRDNWF CEPCSNPHPL VWAKLKGFPF WPAKALRDKD
310 320 330 340 350
GQVDARFFGQ HDRAWVPINN CYLMSKEIPF SVKKTKSIFN SAMQEMEVYV
360 370 380 390 400
ENIRRKFGVF NYSPFRTPYT PNSQYQMLLD PTNPSAGTAK IDKQEKVKLN
410 420 430 440 450
FDMTASPKIL MSKPVLSGGT GRRISLSDMP RSPMSTNSSV HTGSDVEQDA
460 470 480 490 500
EKKATSSHFS ASEESMDFLD KSTASPASTK TGQAGSLSGS PKPFSPQLSA
510 520 530 540 550
PITTKTDKTS TTGSILNLNL DRSKAEMDLK ELSESVQQQS TPVPLISPKR
560 570 580 590 600
QIRSRFQLNL DKTIESCKAQ LGINEISEDV YTAVEHSDSE DSEKSDSSDS
610 620 630 640 650
EYISDDEQKS KNEPEDTEDK EGCQMDKEPS AVKKKPKPTN PVEIKEELKS
660 670 680 690 700
TSPASEKADP GAVKDKASPE PEKDFSEKAK PSPHPIKDKL KGKDETDSPT
710 720 730 740 750
VHLGLDSDSE SELVIDLGED HSGREGRKNK KEPKEPSPKQ DVVGKTPPST
760 770 780 790 800
TVGSHSPPET PVLTRSSAQT SAAGATATTS TSSTVTVTAP APAATGSPVK
810 820 830 840 850
KQRPLLPKET APAVQRVVWN SSSKFQTSSQ KWHMQKMQRQ QQQQQQQNQQ
860 870 880 890 900
QQPQSSQGTR YQTRQAVKAV QQKEITQSPS TSTITLVTST QSSPLVTSSG
910 920 930 940 950
SMSTLVSSVN ADLPIATASA DVAADIAKYT SKMMDAIKGT MTEIYNDLSK
960 970 980 990 1000
NTTGSTIAEI RRLRIEIEKL QWLHQQELSE MKHNLELTMA EMRQSLEQER
1010 1020 1030 1040 1050
DRLIAEVKKQ LELEKQQAVD ETKKKQWCAN CKKEAIFYCC WNTSYCDYPC
1060 1070 1080 1090 1100
QQAHWPEHMK SCTQSATAPQ QEADAEVNTE TLNKSSQGSS SSTQSAPSET
1110 1120 1130 1140 1150
ASASKEKETS AEKSKESGST LDLSGSRETP SSILLGSNQG SDHSRSNKSS
1160 1170 1180
WSSSDEKRGS TRSDHNTSTS TKSLLPKESR LDTFWD
Note: No experimental confirmation available.
Length:1,186
Mass (Da):131,692
Last modified:November 25, 2002 - v2
Checksum:iBAE8CDEF240E647A
GO
Isoform 2 (identifier: Q9ULU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-526: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:614
Mass (Da):66,961
Checksum:i8E6EF67059803EF7
GO
Isoform 3 (identifier: Q9ULU4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:995
Mass (Da):109,683
Checksum:i9FE7BB1FB8105F83
GO
Isoform 4 (identifier: Q9ULU4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-376: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:764
Mass (Da):82,691
Checksum:iC403C40DE69E8BB3
GO
Isoform 5 (identifier: Q9ULU4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.

Show »
Length:1,181
Mass (Da):131,058
Checksum:i03A6396E9A94AD94
GO
Isoform 6 (identifier: Q9ULU4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,023
Mass (Da):112,892
Checksum:i37EB9CAA51A856E3
GO
Isoform 7 (identifier: Q9ULU4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,234
Mass (Da):137,168
Checksum:i10471430CE043C09
GO
Isoform 8 (identifier: Q9ULU4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     742-868: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,107
Mass (Da):123,518
Checksum:i3EF5E50B6BAA5800
GO
Isoform 9 (identifier: Q9ULU4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,168
Mass (Da):129,315
Checksum:i871DE79731D3654E
GO
Isoform 10 (identifier: Q9ULU4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM

Show »
Length:1,206
Mass (Da):133,958
Checksum:i3CB6DF728E65DE2E
GO
Isoform 11 (identifier: Q9ULU4-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,214
Mass (Da):134,902
Checksum:i6BCD191178126950
GO
Isoform 12 (identifier: Q9ULU4-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,160
Mass (Da):128,371
Checksum:i9780CF6CACFCCC9A
GO
Isoform 13 (identifier: Q9ULU4-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,188
Mass (Da):131,580
Checksum:iC10B9CA76DB23389
GO
Isoform 14 (identifier: Q9ULU4-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,135
Mass (Da):125,471
Checksum:i0CAAD0AFD252C3A2
GO
Isoform 15 (identifier: Q9ULU4-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,088
Mass (Da):120,828
Checksum:i89769DB84068AE00
GO
Isoform 16 (identifier: Q9ULU4-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,163
Mass (Da):128,680
Checksum:i1BBBE722ED85361C
GO
Isoform 17 (identifier: Q9ULU4-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     742-868: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,054
Mass (Da):117,408
Checksum:iC01B7C094F9C970C
GO
Isoform 18 (identifier: Q9ULU4-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,134
Mass (Da):126,415
Checksum:i64F9746E9458BB1B
GO
Isoform 19 (identifier: Q9ULU4-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFLEEFEARSCLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,241
Mass (Da):138,030
Checksum:i20A285CF0B00832B
GO
Isoform 20 (identifier: Q9ULU4-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFSSLQKSFNLAEEEIKTEQEVVEGM
     58-82: Missing.

Note: No experimental confirmation available.
Show »
Length:1,186
Mass (Da):131,647
Checksum:iD94974DC1C82F30B
GO
Isoform 21 (identifier: Q9ULU4-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Note: No experimental confirmation available.
Show »
Length:1,115
Mass (Da):123,205
Checksum:i521DADD47EDA30FA
GO
Isoform 22 (identifier: Q9ULU4-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     933-959: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: Gene prediction based on EST data.Combined sources
Show »
Length:1,161
Mass (Da):128,662
Checksum:iDF2932354478AD04
GO
Isoform 23 (identifier: Q9ULU4-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     132-169: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,105
Mass (Da):122,116
Checksum:i1FC56CEF2DEDD752
GO

Sequence cautioni

The sequence AAC72244.1 differs from that shown. Reason: Frameshift at position 816. Curated
The sequence BAA86439.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti119 – 1191S → P in BAH11794 (PubMed:14702039).Curated
Sequence conflicti202 – 2021A → T in BAH12176 (PubMed:14702039).Curated
Sequence conflicti325 – 3251S → F in BAH12176 (PubMed:14702039).Curated
Sequence conflicti391 – 3911I → V in AAL50790 (PubMed:11149944).Curated
Sequence conflicti399 – 3991L → P in BAH11794 (PubMed:14702039).Curated
Sequence conflicti470 – 4701D → G in BAH11794 (PubMed:14702039).Curated
Sequence conflicti874 – 8741E → G in BAG53824 (PubMed:14702039).Curated
Sequence conflicti894 – 8941P → A in AAG34905 (PubMed:11149944).Curated
Sequence conflicti894 – 8941P → A in AAL50790 (PubMed:11149944).Curated
Sequence conflicti967 – 9671I → T in CAE46008 (PubMed:17974005).Curated
Isoform 2 (identifier: Q9ULU4-2)
Sequence conflicti297 – 2971T → S in AAF71262 (PubMed:11003709).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti752 – 7521V → A.1 Publication
Corresponds to variant rs2275801 [ dbSNP | Ensembl ].
VAR_055559

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 526526Missing in isoform 2. 1 PublicationVSP_000566Add
BLAST
Alternative sequencei1 – 376376Missing in isoform 4. 1 PublicationVSP_000565Add
BLAST
Alternative sequencei1 – 145145Missing in isoform 3 and isoform 6. 2 PublicationsVSP_000564Add
BLAST
Alternative sequencei1 – 11M → MVFLEEFEARSCLAEEEIKT EQEVVEGM in isoform 19. 1 PublicationVSP_054810
Alternative sequencei1 – 11M → MFSSLQKSFNLAEEEIKTEQ EVVEGM in isoform 20. 1 PublicationVSP_054811
Alternative sequencei1 – 11M → MHPQSLAEEEIKTEQEVVEG M in isoform 5, isoform 7, isoform 8, isoform 10, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18 and isoform 22. 3 PublicationsVSP_000563
Alternative sequencei58 – 8225Missing in isoform 5, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21 and isoform 23. 3 PublicationsVSP_000567Add
BLAST
Alternative sequencei132 – 16938Missing in isoform 23. 1 PublicationVSP_054812Add
BLAST
Alternative sequencei474 – 52047Missing in isoform 15 and isoform 18. 1 PublicationVSP_053400Add
BLAST
Alternative sequencei742 – 868127Missing in isoform 8 and isoform 17. 2 PublicationsVSP_017096Add
BLAST
Alternative sequencei823 – 86947SKFQT…QAVKA → T in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 21, isoform 22 and isoform 23. 6 PublicationsVSP_000568Add
BLAST
Alternative sequencei933 – 95927Missing in isoform 22. CuratedVSP_054814Add
BLAST
Alternative sequencei1142 – 11421D → VSKRCDKQPAYAPTTTDHQP HPNYPAQKY in isoform 6, isoform 7, isoform 8, isoform 9, isoform 11, isoform 13, isoform 16, isoform 19, isoform 22 and isoform 23. 5 PublicationsVSP_000570

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233453 mRNA. Translation: AAF71262.1.
U48251 mRNA. Translation: AAC72244.1. Frameshift.
AF454056 mRNA. Translation: AAL50790.1.
AF273045 mRNA. Translation: AAG34905.1.
DQ082998 mRNA. Translation: AAY85630.1.
DQ082999 mRNA. Translation: AAY85631.1.
DQ368669 mRNA. Translation: ABC86680.1.
DQ368670 mRNA. Translation: ABC86681.1.
DQ368671 mRNA. Translation: ABC86682.1.
DQ368672 mRNA. Translation: ABC86683.1.
DQ368673 mRNA. Translation: ABC86684.1.
DQ368674 mRNA. Translation: ABC86685.1.
DQ368677 mRNA. Translation: ABC86688.1.
DQ368678 mRNA. Translation: ABC86689.1.
DQ368679 mRNA. Translation: ABC86690.1.
DQ368680 mRNA. Translation: ABC86691.1.
AB032951 mRNA. Translation: BAA86439.1. Different initiation.
AK122966 mRNA. Translation: BAG53824.1.
AK294511 mRNA. Translation: BAH11794.1.
AK295747 mRNA. Translation: BAH12176.1.
AK299899 mRNA. Translation: BAH13166.1.
BX641005 mRNA. Translation: CAE46008.1.
AL031666, AL049540, AL022342 Genomic DNA. Translation: CAI21842.1.
AL049540, AL031666, AL022342 Genomic DNA. Translation: CAI23169.1.
AL049540, AL031666, AL390212 Genomic DNA. Translation: CAI23168.1.
CH471077 Genomic DNA. Translation: EAW75703.1.
CH471077 Genomic DNA. Translation: EAW75706.1.
CH471077 Genomic DNA. Translation: EAW75709.1.
CH471077 Genomic DNA. Translation: EAW75711.1.
CH471077 Genomic DNA. Translation: EAW75712.1.
CH471077 Genomic DNA. Translation: EAW75715.1.
BC030721 mRNA. Translation: AAH30721.2.
BC136608 mRNA. Translation: AAI36609.1.
BC144289 mRNA. Translation: AAI44290.1.
CCDSiCCDS13404.1. [Q9ULU4-12]
CCDS13405.1. [Q9ULU4-13]
CCDS46613.1. [Q9ULU4-14]
CCDS63300.1. [Q9ULU4-11]
CCDS63301.1. [Q9ULU4-9]
CCDS63304.1. [Q9ULU4-17]
CCDS63306.1. [Q9ULU4-7]
CCDS74738.1. [Q9ULU4-20]
RefSeqiNP_001268700.1. NM_001281771.2. [Q9ULU4-17]
NP_001268701.1. NM_001281772.2. [Q9ULU4-20]
NP_001268702.1. NM_001281773.2. [Q9ULU4-11]
NP_001268703.1. NM_001281774.2. [Q9ULU4-9]
NP_001268704.1. NM_001281775.2. [Q9ULU4-7]
NP_001268705.1. NM_001281776.2. [Q9ULU4-8]
NP_001268706.1. NM_001281777.2. [Q9ULU4-16]
NP_001268707.1. NM_001281778.2. [Q9ULU4-5]
NP_001268710.1. NM_001281781.2. [Q9ULU4-15]
NP_001268711.1. NM_001281782.2.
NP_001268712.1. NM_001281783.2. [Q9ULU4-10]
NP_001268713.1. NM_001281784.2. [Q9ULU4-18]
NP_036540.3. NM_012408.5. [Q9ULU4-12]
NP_898868.1. NM_183047.3. [Q9ULU4-13]
NP_898869.1. NM_183048.3. [Q9ULU4-14]
XP_005260413.1. XM_005260356.3. [Q9ULU4-19]
XP_005260417.1. XM_005260360.3. [Q9ULU4-11]
XP_005260423.1. XM_005260366.2. [Q9ULU4-1]
XP_006723825.1. XM_006723762.2. [Q9ULU4-11]
XP_011527053.1. XM_011528751.1. [Q9ULU4-11]
UniGeneiHs.446240.
Hs.658553.
Hs.668465.

Genome annotation databases

EnsembliENST00000262975; ENSP00000262975; ENSG00000101040. [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040. [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040. [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040. [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040. [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040. [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040. [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040. [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040. [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040. [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040. [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040. [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040. [Q9ULU4-18]
GeneIDi23613.
KEGGihsa:23613.
UCSCiuc002xss.3. human. [Q9ULU4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233453 mRNA. Translation: AAF71262.1.
U48251 mRNA. Translation: AAC72244.1. Frameshift.
AF454056 mRNA. Translation: AAL50790.1.
AF273045 mRNA. Translation: AAG34905.1.
DQ082998 mRNA. Translation: AAY85630.1.
DQ082999 mRNA. Translation: AAY85631.1.
DQ368669 mRNA. Translation: ABC86680.1.
DQ368670 mRNA. Translation: ABC86681.1.
DQ368671 mRNA. Translation: ABC86682.1.
DQ368672 mRNA. Translation: ABC86683.1.
DQ368673 mRNA. Translation: ABC86684.1.
DQ368674 mRNA. Translation: ABC86685.1.
DQ368677 mRNA. Translation: ABC86688.1.
DQ368678 mRNA. Translation: ABC86689.1.
DQ368679 mRNA. Translation: ABC86690.1.
DQ368680 mRNA. Translation: ABC86691.1.
AB032951 mRNA. Translation: BAA86439.1. Different initiation.
AK122966 mRNA. Translation: BAG53824.1.
AK294511 mRNA. Translation: BAH11794.1.
AK295747 mRNA. Translation: BAH12176.1.
AK299899 mRNA. Translation: BAH13166.1.
BX641005 mRNA. Translation: CAE46008.1.
AL031666, AL049540, AL022342 Genomic DNA. Translation: CAI21842.1.
AL049540, AL031666, AL022342 Genomic DNA. Translation: CAI23169.1.
AL049540, AL031666, AL390212 Genomic DNA. Translation: CAI23168.1.
CH471077 Genomic DNA. Translation: EAW75703.1.
CH471077 Genomic DNA. Translation: EAW75706.1.
CH471077 Genomic DNA. Translation: EAW75709.1.
CH471077 Genomic DNA. Translation: EAW75711.1.
CH471077 Genomic DNA. Translation: EAW75712.1.
CH471077 Genomic DNA. Translation: EAW75715.1.
BC030721 mRNA. Translation: AAH30721.2.
BC136608 mRNA. Translation: AAI36609.1.
BC144289 mRNA. Translation: AAI44290.1.
CCDSiCCDS13404.1. [Q9ULU4-12]
CCDS13405.1. [Q9ULU4-13]
CCDS46613.1. [Q9ULU4-14]
CCDS63300.1. [Q9ULU4-11]
CCDS63301.1. [Q9ULU4-9]
CCDS63304.1. [Q9ULU4-17]
CCDS63306.1. [Q9ULU4-7]
CCDS74738.1. [Q9ULU4-20]
RefSeqiNP_001268700.1. NM_001281771.2. [Q9ULU4-17]
NP_001268701.1. NM_001281772.2. [Q9ULU4-20]
NP_001268702.1. NM_001281773.2. [Q9ULU4-11]
NP_001268703.1. NM_001281774.2. [Q9ULU4-9]
NP_001268704.1. NM_001281775.2. [Q9ULU4-7]
NP_001268705.1. NM_001281776.2. [Q9ULU4-8]
NP_001268706.1. NM_001281777.2. [Q9ULU4-16]
NP_001268707.1. NM_001281778.2. [Q9ULU4-5]
NP_001268710.1. NM_001281781.2. [Q9ULU4-15]
NP_001268711.1. NM_001281782.2.
NP_001268712.1. NM_001281783.2. [Q9ULU4-10]
NP_001268713.1. NM_001281784.2. [Q9ULU4-18]
NP_036540.3. NM_012408.5. [Q9ULU4-12]
NP_898868.1. NM_183047.3. [Q9ULU4-13]
NP_898869.1. NM_183048.3. [Q9ULU4-14]
XP_005260413.1. XM_005260356.3. [Q9ULU4-19]
XP_005260417.1. XM_005260360.3. [Q9ULU4-11]
XP_005260423.1. XM_005260366.2. [Q9ULU4-1]
XP_006723825.1. XM_006723762.2. [Q9ULU4-11]
XP_011527053.1. XM_011528751.1. [Q9ULU4-11]
UniGeneiHs.446240.
Hs.658553.
Hs.668465.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4COSX-ray1.67A83-406[»]
ProteinModelPortaliQ9ULU4.
SMRiQ9ULU4. Positions 86-399.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117146. 56 interactions.
IntActiQ9ULU4. 44 interactions.
MINTiMINT-1183677.

PTM databases

iPTMnetiQ9ULU4.
PhosphoSiteiQ9ULU4.

Polymorphism and mutation databases

BioMutaiZMYND8.
DMDMi25453223.

Proteomic databases

EPDiQ9ULU4.
MaxQBiQ9ULU4.
PeptideAtlasiQ9ULU4.
PRIDEiQ9ULU4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262975; ENSP00000262975; ENSG00000101040. [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040. [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040. [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040. [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040. [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040. [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040. [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040. [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040. [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040. [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040. [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040. [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040. [Q9ULU4-18]
GeneIDi23613.
KEGGihsa:23613.
UCSCiuc002xss.3. human. [Q9ULU4-1]

Organism-specific databases

CTDi23613.
GeneCardsiZMYND8.
H-InvDBHIX0015888.
HGNCiHGNC:9397. ZMYND8.
HPAiHPA020949.
neXtProtiNX_Q9ULU4.
PharmGKBiPA162409890.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063428.
HOGENOMiHOG000230951.
HOVERGENiHBG031823.
InParanoidiQ9ULU4.
OMAiMDFLEKS.
OrthoDBiEOG700875.
PhylomeDBiQ9ULU4.
TreeFamiTF317221.

Miscellaneous databases

ChiTaRSiZMYND8. human.
GeneWikiiZMYND8.
GenomeRNAii23613.
PROiQ9ULU4.

Gene expression databases

BgeeiQ9ULU4.
CleanExiHS_ZMYND8.
ExpressionAtlasiQ9ULU4. baseline and differential.
GenevisibleiQ9ULU4. HS.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR021931. DUF3544.
IPR000313. PWWP_dom.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR002893. Znf_MYND.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF12064. DUF3544. 1 hit.
PF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00293. PWWP. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50812. PWWP. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of PRKCBP1, a candidate RACK-like protein."
    Fossey S.C., Kuroda S., Price J.A., Pendleton J.K., Freedman B.I., Bowden D.W.
    Mamm. Genome 11:919-925(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Hippocampus.
  2. "Serological detection of cutaneous T-cell lymphoma-associated antigens."
    Eichmueller S., Usener D., Dummer R., Stein A., Thiel D., Schadendorf D.
    Proc. Natl. Acad. Sci. U.S.A. 98:629-634(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4).
    Tissue: Testis.
  3. "Characterization of a novel BS69-related transcriptional repressor, BSR."
    Mikhailik A., Keller J., Yang J., Hearing P., Bar-Sagi D.
    Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 7 AND 8), VARIANT ALA-752.
    Tissue: Mammary tumor.
  4. "Characterization of RACK7, a novel heterochromatin and mitotic chromosome associated protein."
    Grkovic S., Velasco G., Ansieau S.
    Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 7; 10; 12; 13; 14; 15; 16 AND 18).
  5. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 11; 19; 20 AND 23).
    Tissue: Amygdala, Brain, Hippocampus and Trachea.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
    Tissue: Salivary gland.
  8. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 17).
    Tissue: Brain, Eye and Testis.
  11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406; SER-462; SER-465; SER-486; SER-490; SER-495; THR-541; SER-547 AND SER-756, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406; SER-486; SER-490 AND SER-495, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  16. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-413, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-404; SER-406; SER-486; SER-495 AND SER-668, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-425; SER-432; SER-444; SER-490; SER-547; SER-682; THR-746; SER-754 AND SER-756, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24; SER-406; SER-417; SER-425; SER-444; SER-460; SER-465; SER-495; SER-514; SER-523; SER-547; THR-563; SER-652; SER-655; SER-668; SER-737; SER-756; SER-1119 AND SER-1141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma and Erythroleukemia.
  21. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406; SER-490; SER-547; SER-668; SER-707 AND SER-709, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  22. "Uncovering global SUMOylation signaling networks in a site-specific manner."
    Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.
    Nat. Struct. Mol. Biol. 21:927-936(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-611 AND LYS-645, SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-12 (ISOFORMS 10; 12; 13; 14; 15; 16; 17; 18; 22; 5; 7 AND 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  23. "SUMO-2 orchestrates chromatin modifiers in response to DNA damage."
    Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C.
    Cell Rep. 10:1778-1791(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-611, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  24. "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability."
    Xiao Z., Chang J.G., Hendriks I.A., Sigurdsson J.O., Olsen J.V., Vertegaal A.C.
    Mol. Cell. Proteomics 14:1419-1434(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-611 AND LYS-645, SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-12 (ISOFORMS 10; 12; 13; 14; 15; 16; 17; 18; 22; 5; 7 AND 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPKCB1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULU4
Secondary accession number(s): B3KVL2
, B7Z2A8, B7Z3E0, B7Z680, B7ZM62, E1P5U5, F5H0X3, H7C0U2, J3KPU3, Q13517, Q2HXV1, Q2HXV2, Q2HXV3, Q2HXV4, Q2HXV7, Q2HXV8, Q2HXV9, Q2HXW0, Q2HXW1, Q2HXW2, Q4JJ94, Q4JJ95, Q5TH09, Q5TH11, Q6MZM1, Q8WXC5, Q9H1F3, Q9H1F4, Q9H1F5, Q9H1L8, Q9H1L9, Q9H2G5, Q9NYN3, Q9UIX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: July 6, 2016
This is version 158 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.