Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein kinase C-binding protein 1

Gene

ZMYND8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as a transcriptional corepressor for KDM5D. Required for KDM5D-mediated down-regulation of diverse metastasis-associated genes; the function seems to involve the recognition of the dual histone signature H3K4me1-H3K14ac. Suppresses prostate cancer cell invasion.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri88 – 133PHD-typePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri1028 – 1062MYND-typePROSITE-ProRule annotationAdd BLAST35

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101040-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein kinase C-binding protein 1
Alternative name(s):
Cutaneous T-cell lymphoma-associated antigen se14-3
Short name:
CTCL-associated antigen se14-3
Rack7
Zinc finger MYND domain-containing protein 8
Gene namesi
Name:ZMYND8
Synonyms:KIAA1125, PRKCBP1, RACK7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:9397. ZMYND8.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi76D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi79D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi84D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi88D → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi89F → D: Increases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi104E → A: Decreases interaction with histone H3K4me0. 1 Publication1
Mutagenesisi227 – 228YN → AA: Decreases interaction with histone H3K4me0. 1 Publication2

Organism-specific databases

DisGeNETi23613.
OpenTargetsiENSG00000101040.
PharmGKBiPA162409890.

Chemistry databases

ChEMBLiCHEMBL3627580.

Polymorphism and mutation databases

BioMutaiZMYND8.
DMDMi25453223.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002112091 – 1186Protein kinase C-binding protein 1Add BLAST1186

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphoserineCombined sources1
Modified residuei404PhosphothreonineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei413N6-acetyllysineCombined sources1
Modified residuei417PhosphoserineCombined sources1
Modified residuei425PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei460PhosphoserineCombined sources1
Modified residuei462PhosphoserineCombined sources1
Modified residuei465PhosphoserineCombined sources1
Modified residuei486PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei495PhosphoserineCombined sources1
Modified residuei514PhosphoserineCombined sources1
Modified residuei523PhosphoserineCombined sources1
Modified residuei541PhosphothreonineCombined sources1
Modified residuei547PhosphoserineCombined sources1
Modified residuei563PhosphothreonineCombined sources1
Cross-linki611Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki645Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei652PhosphoserineCombined sources1
Modified residuei655PhosphoserineCombined sources1
Modified residuei668PhosphoserineCombined sources1
Modified residuei682PhosphoserineCombined sources1
Modified residuei707PhosphoserineCombined sources1
Modified residuei709PhosphoserineCombined sources1
Modified residuei737PhosphoserineCombined sources1
Modified residuei746PhosphothreonineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei756PhosphoserineCombined sources1
Modified residuei1119PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1
Isoform 5 (identifier: Q9ULU4-5)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 7 (identifier: Q9ULU4-7)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 8 (identifier: Q9ULU4-8)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 10 (identifier: Q9ULU4-10)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 12 (identifier: Q9ULU4-12)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 13 (identifier: Q9ULU4-13)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 14 (identifier: Q9ULU4-14)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 15 (identifier: Q9ULU4-15)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 16 (identifier: Q9ULU4-16)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 17 (identifier: Q9ULU4-17)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 18 (identifier: Q9ULU4-18)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 22 (identifier: Q9ULU4-22)
Cross-linki12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9ULU4.
PeptideAtlasiQ9ULU4.
PRIDEiQ9ULU4.

PTM databases

iPTMnetiQ9ULU4.
PhosphoSitePlusiQ9ULU4.

Expressioni

Tissue specificityi

Expressed in all tissues examined with highest expression in brain, lung, pancreas, and placenta. Expressed in cutaneous T-cell lymphomas (CTCL).

Gene expression databases

BgeeiENSG00000101040.
CleanExiHS_ZMYND8.
ExpressionAtlasiQ9ULU4. baseline and differential.
GenevisibleiQ9ULU4. HS.

Organism-specific databases

HPAiHPA020949.

Interactioni

Subunit structurei

Interacts in vitro with PRKCB1 (PubMed:11003709). Interacts with KDM5D and KDM1A. Interacts with histone H3 (via N-terminus) that is both methylated at 'Lys-4' (H3K4me1) and acetylated at 'Lys-14' (H3K14ac), and with histone H3 (via N-terminus) unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-14' (H3K14ac).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BCL6P411823EBI-765834,EBI-765407

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117146. 56 interactors.
IntActiQ9ULU4. 45 interactors.
MINTiMINT-1183677.

Structurei

Secondary structure

11186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi89 – 91Combined sources3
Turni92 – 94Combined sources3
Beta strandi104 – 107Combined sources4
Helixi112 – 115Combined sources4
Helixi128 – 137Combined sources10
Helixi139 – 141Combined sources3
Helixi144 – 147Combined sources4
Helixi151 – 165Combined sources15
Helixi171 – 173Combined sources3
Turni179 – 181Combined sources3
Helixi185 – 188Combined sources4
Helixi195 – 203Combined sources9
Helixi210 – 228Combined sources19
Helixi233 – 254Combined sources22
Helixi256 – 264Combined sources9
Helixi269 – 271Combined sources3
Beta strandi280 – 283Combined sources4
Beta strandi291 – 299Combined sources9
Beta strandi302 – 307Combined sources6
Turni308 – 310Combined sources3
Beta strandi313 – 317Combined sources5
Helixi318 – 320Combined sources3
Beta strandi321 – 323Combined sources3
Helixi336 – 357Combined sources22
Helixi375 – 377Combined sources3
Helixi384 – 386Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4COSX-ray1.67A83-406[»]
ProteinModelPortaliQ9ULU4.
SMRiQ9ULU4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini165 – 235BromoPROSITE-ProRule annotationAdd BLAST71
Domaini277 – 327PWWPPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni75 – 406Interaction with histone H3K14ac1 PublicationAdd BLAST332
Regioni75 – 268Interaction with histone H3K4me01 PublicationAdd BLAST194
Regioni1147 – 1186Interaction with PRKCB1Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi43 – 47Poly-Lys5
Compositional biasi838 – 854Poly-GlnAdd BLAST17
Compositional biasi1089 – 1092Poly-Ser4

Sequence similaritiesi

Contains 1 bromo domain.PROSITE-ProRule annotation
Contains 1 MYND-type zinc finger.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation
Contains 1 PWWP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri88 – 133PHD-typePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri1028 – 1062MYND-typePROSITE-ProRule annotationAdd BLAST35

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00530000063428.
HOGENOMiHOG000230951.
HOVERGENiHBG031823.
InParanoidiQ9ULU4.
OMAiMDFLEKS.
OrthoDBiEOG091G0B2W.
PhylomeDBiQ9ULU4.
TreeFamiTF317221.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR021931. DUF3544.
IPR000313. PWWP_dom.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR002893. Znf_MYND.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF12064. DUF3544. 1 hit.
PF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00293. PWWP. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50812. PWWP. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (23)i

Sequence statusi: Complete.

This entry describes 23 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDISTRSKDP GSAERTAQKR KFPSPPHSSN GHSPQDTSTS PIKKKKKPGL
60 70 80 90 100
LNSNNKEQSE LRHGPFYYMK QPLTTDPVDV VPQDGRNDFY CWVCHREGQV
110 120 130 140 150
LCCELCPRVY HAKCLRLTSE PEGDWFCPEC EKITVAECIE TQSKAMTMLT
160 170 180 190 200
IEQLSYLLKF AIQKMKQPGT DAFQKPVPLE QHPDYAEYIF HPMDLCTLEK
210 220 230 240 250
NAKKKMYGCT EAFLADAKWI LHNCIIYNGG NHKLTQIAKV VIKICEHEMN
260 270 280 290 300
EIEVCPECYL AACQKRDNWF CEPCSNPHPL VWAKLKGFPF WPAKALRDKD
310 320 330 340 350
GQVDARFFGQ HDRAWVPINN CYLMSKEIPF SVKKTKSIFN SAMQEMEVYV
360 370 380 390 400
ENIRRKFGVF NYSPFRTPYT PNSQYQMLLD PTNPSAGTAK IDKQEKVKLN
410 420 430 440 450
FDMTASPKIL MSKPVLSGGT GRRISLSDMP RSPMSTNSSV HTGSDVEQDA
460 470 480 490 500
EKKATSSHFS ASEESMDFLD KSTASPASTK TGQAGSLSGS PKPFSPQLSA
510 520 530 540 550
PITTKTDKTS TTGSILNLNL DRSKAEMDLK ELSESVQQQS TPVPLISPKR
560 570 580 590 600
QIRSRFQLNL DKTIESCKAQ LGINEISEDV YTAVEHSDSE DSEKSDSSDS
610 620 630 640 650
EYISDDEQKS KNEPEDTEDK EGCQMDKEPS AVKKKPKPTN PVEIKEELKS
660 670 680 690 700
TSPASEKADP GAVKDKASPE PEKDFSEKAK PSPHPIKDKL KGKDETDSPT
710 720 730 740 750
VHLGLDSDSE SELVIDLGED HSGREGRKNK KEPKEPSPKQ DVVGKTPPST
760 770 780 790 800
TVGSHSPPET PVLTRSSAQT SAAGATATTS TSSTVTVTAP APAATGSPVK
810 820 830 840 850
KQRPLLPKET APAVQRVVWN SSSKFQTSSQ KWHMQKMQRQ QQQQQQQNQQ
860 870 880 890 900
QQPQSSQGTR YQTRQAVKAV QQKEITQSPS TSTITLVTST QSSPLVTSSG
910 920 930 940 950
SMSTLVSSVN ADLPIATASA DVAADIAKYT SKMMDAIKGT MTEIYNDLSK
960 970 980 990 1000
NTTGSTIAEI RRLRIEIEKL QWLHQQELSE MKHNLELTMA EMRQSLEQER
1010 1020 1030 1040 1050
DRLIAEVKKQ LELEKQQAVD ETKKKQWCAN CKKEAIFYCC WNTSYCDYPC
1060 1070 1080 1090 1100
QQAHWPEHMK SCTQSATAPQ QEADAEVNTE TLNKSSQGSS SSTQSAPSET
1110 1120 1130 1140 1150
ASASKEKETS AEKSKESGST LDLSGSRETP SSILLGSNQG SDHSRSNKSS
1160 1170 1180
WSSSDEKRGS TRSDHNTSTS TKSLLPKESR LDTFWD
Note: No experimental confirmation available.
Length:1,186
Mass (Da):131,692
Last modified:November 25, 2002 - v2
Checksum:iBAE8CDEF240E647A
GO
Isoform 2 (identifier: Q9ULU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-526: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:614
Mass (Da):66,961
Checksum:i8E6EF67059803EF7
GO
Isoform 3 (identifier: Q9ULU4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:995
Mass (Da):109,683
Checksum:i9FE7BB1FB8105F83
GO
Isoform 4 (identifier: Q9ULU4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-376: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:764
Mass (Da):82,691
Checksum:iC403C40DE69E8BB3
GO
Isoform 5 (identifier: Q9ULU4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.

Show »
Length:1,181
Mass (Da):131,058
Checksum:i03A6396E9A94AD94
GO
Isoform 6 (identifier: Q9ULU4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-145: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,023
Mass (Da):112,892
Checksum:i37EB9CAA51A856E3
GO
Isoform 7 (identifier: Q9ULU4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,234
Mass (Da):137,168
Checksum:i10471430CE043C09
GO
Isoform 8 (identifier: Q9ULU4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     742-868: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,107
Mass (Da):123,518
Checksum:i3EF5E50B6BAA5800
GO
Isoform 9 (identifier: Q9ULU4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,168
Mass (Da):129,315
Checksum:i871DE79731D3654E
GO
Isoform 10 (identifier: Q9ULU4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM

Show »
Length:1,206
Mass (Da):133,958
Checksum:i3CB6DF728E65DE2E
GO
Isoform 11 (identifier: Q9ULU4-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,214
Mass (Da):134,902
Checksum:i6BCD191178126950
GO
Isoform 12 (identifier: Q9ULU4-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,160
Mass (Da):128,371
Checksum:i9780CF6CACFCCC9A
GO
Isoform 13 (identifier: Q9ULU4-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,188
Mass (Da):131,580
Checksum:iC10B9CA76DB23389
GO
Isoform 14 (identifier: Q9ULU4-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,135
Mass (Da):125,471
Checksum:i0CAAD0AFD252C3A2
GO
Isoform 15 (identifier: Q9ULU4-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Show »
Length:1,088
Mass (Da):120,828
Checksum:i89769DB84068AE00
GO
Isoform 16 (identifier: Q9ULU4-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Show »
Length:1,163
Mass (Da):128,680
Checksum:i1BBBE722ED85361C
GO
Isoform 17 (identifier: Q9ULU4-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     742-868: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,054
Mass (Da):117,408
Checksum:iC01B7C094F9C970C
GO
Isoform 18 (identifier: Q9ULU4-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     58-82: Missing.
     474-520: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,134
Mass (Da):126,415
Checksum:i64F9746E9458BB1B
GO
Isoform 19 (identifier: Q9ULU4-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFLEEFEARSCLAEEEIKTEQEVVEGM
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,241
Mass (Da):138,030
Checksum:i20A285CF0B00832B
GO
Isoform 20 (identifier: Q9ULU4-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFSSLQKSFNLAEEEIKTEQEVVEGM
     58-82: Missing.

Note: No experimental confirmation available.
Show »
Length:1,186
Mass (Da):131,647
Checksum:iD94974DC1C82F30B
GO
Isoform 21 (identifier: Q9ULU4-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T

Note: No experimental confirmation available.
Show »
Length:1,115
Mass (Da):123,205
Checksum:i521DADD47EDA30FA
GO
Isoform 22 (identifier: Q9ULU4-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPQSLAEEEIKTEQEVVEGM
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     933-959: Missing.
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: Gene prediction based on EST data.Combined sources
Show »
Length:1,161
Mass (Da):128,662
Checksum:iDF2932354478AD04
GO
Isoform 23 (identifier: Q9ULU4-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-82: Missing.
     132-169: Missing.
     823-869: SKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRYQTRQAVKA → T
     1142-1142: D → VSKRCDKQPAYAPTTTDHQPHPNYPAQKY

Note: No experimental confirmation available.
Show »
Length:1,105
Mass (Da):122,116
Checksum:i1FC56CEF2DEDD752
GO

Sequence cautioni

The sequence AAC72244 differs from that shown. Reason: Frameshift at position 816.Curated
The sequence BAA86439 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti119S → P in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti202A → T in BAH12176 (PubMed:14702039).Curated1
Sequence conflicti325S → F in BAH12176 (PubMed:14702039).Curated1
Sequence conflicti391I → V in AAL50790 (PubMed:11149944).Curated1
Sequence conflicti399L → P in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti470D → G in BAH11794 (PubMed:14702039).Curated1
Sequence conflicti874E → G in BAG53824 (PubMed:14702039).Curated1
Sequence conflicti894P → A in AAG34905 (PubMed:11149944).Curated1
Sequence conflicti894P → A in AAL50790 (PubMed:11149944).Curated1
Sequence conflicti967I → T in CAE46008 (PubMed:17974005).Curated1
Isoform 2 (identifier: Q9ULU4-2)
Sequence conflicti297T → S in AAF71262 (PubMed:11003709).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055559752V → A.1 PublicationCorresponds to variant rs2275801dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0005661 – 526Missing in isoform 2. 1 PublicationAdd BLAST526
Alternative sequenceiVSP_0005651 – 376Missing in isoform 4. 1 PublicationAdd BLAST376
Alternative sequenceiVSP_0005641 – 145Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST145
Alternative sequenceiVSP_0548101M → MVFLEEFEARSCLAEEEIKT EQEVVEGM in isoform 19. 1 Publication1
Alternative sequenceiVSP_0548111M → MFSSLQKSFNLAEEEIKTEQ EVVEGM in isoform 20. 1 Publication1
Alternative sequenceiVSP_0005631M → MHPQSLAEEEIKTEQEVVEG M in isoform 5, isoform 7, isoform 8, isoform 10, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18 and isoform 22. 3 Publications1
Alternative sequenceiVSP_00056758 – 82Missing in isoform 5, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21 and isoform 23. 3 PublicationsAdd BLAST25
Alternative sequenceiVSP_054812132 – 169Missing in isoform 23. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_053400474 – 520Missing in isoform 15 and isoform 18. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_017096742 – 868Missing in isoform 8 and isoform 17. 2 PublicationsAdd BLAST127
Alternative sequenceiVSP_000568823 – 869SKFQT…QAVKA → T in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 12, isoform 13, isoform 14, isoform 15, isoform 16, isoform 21, isoform 22 and isoform 23. 6 PublicationsAdd BLAST47
Alternative sequenceiVSP_054814933 – 959Missing in isoform 22. CuratedAdd BLAST27
Alternative sequenceiVSP_0005701142D → VSKRCDKQPAYAPTTTDHQP HPNYPAQKY in isoform 6, isoform 7, isoform 8, isoform 9, isoform 11, isoform 13, isoform 16, isoform 19, isoform 22 and isoform 23. 5 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233453 mRNA. Translation: AAF71262.1.
U48251 mRNA. Translation: AAC72244.1. Frameshift.
AF454056 mRNA. Translation: AAL50790.1.
AF273045 mRNA. Translation: AAG34905.1.
DQ082998 mRNA. Translation: AAY85630.1.
DQ082999 mRNA. Translation: AAY85631.1.
DQ368669 mRNA. Translation: ABC86680.1.
DQ368670 mRNA. Translation: ABC86681.1.
DQ368671 mRNA. Translation: ABC86682.1.
DQ368672 mRNA. Translation: ABC86683.1.
DQ368673 mRNA. Translation: ABC86684.1.
DQ368674 mRNA. Translation: ABC86685.1.
DQ368677 mRNA. Translation: ABC86688.1.
DQ368678 mRNA. Translation: ABC86689.1.
DQ368679 mRNA. Translation: ABC86690.1.
DQ368680 mRNA. Translation: ABC86691.1.
AB032951 mRNA. Translation: BAA86439.1. Different initiation.
AK122966 mRNA. Translation: BAG53824.1.
AK294511 mRNA. Translation: BAH11794.1.
AK295747 mRNA. Translation: BAH12176.1.
AK299899 mRNA. Translation: BAH13166.1.
BX641005 mRNA. Translation: CAE46008.1.
AL031666, AL049540, AL022342 Genomic DNA. Translation: CAI21842.1.
AL049540, AL031666, AL022342 Genomic DNA. Translation: CAI23169.1.
AL049540, AL031666, AL390212 Genomic DNA. Translation: CAI23168.1.
CH471077 Genomic DNA. Translation: EAW75703.1.
CH471077 Genomic DNA. Translation: EAW75706.1.
CH471077 Genomic DNA. Translation: EAW75709.1.
CH471077 Genomic DNA. Translation: EAW75711.1.
CH471077 Genomic DNA. Translation: EAW75712.1.
CH471077 Genomic DNA. Translation: EAW75715.1.
BC030721 mRNA. Translation: AAH30721.2.
BC136608 mRNA. Translation: AAI36609.1.
BC144289 mRNA. Translation: AAI44290.1.
CCDSiCCDS13404.1. [Q9ULU4-12]
CCDS13405.1. [Q9ULU4-13]
CCDS46613.1. [Q9ULU4-14]
CCDS63300.1. [Q9ULU4-11]
CCDS63301.1. [Q9ULU4-9]
CCDS63303.1. [Q9ULU4-18]
CCDS63304.1. [Q9ULU4-17]
CCDS63306.1. [Q9ULU4-7]
CCDS74738.1. [Q9ULU4-20]
RefSeqiNP_001268700.1. NM_001281771.2. [Q9ULU4-17]
NP_001268701.1. NM_001281772.2. [Q9ULU4-20]
NP_001268702.1. NM_001281773.2. [Q9ULU4-11]
NP_001268703.1. NM_001281774.2. [Q9ULU4-9]
NP_001268704.1. NM_001281775.2. [Q9ULU4-7]
NP_001268705.1. NM_001281776.2. [Q9ULU4-8]
NP_001268706.1. NM_001281777.2. [Q9ULU4-16]
NP_001268707.1. NM_001281778.2. [Q9ULU4-5]
NP_001268710.1. NM_001281781.2. [Q9ULU4-15]
NP_001268711.1. NM_001281782.2.
NP_001268712.1. NM_001281783.2. [Q9ULU4-10]
NP_001268713.1. NM_001281784.2. [Q9ULU4-18]
NP_036540.3. NM_012408.5. [Q9ULU4-12]
NP_898868.1. NM_183047.3. [Q9ULU4-13]
NP_898869.1. NM_183048.3. [Q9ULU4-14]
XP_005260413.1. XM_005260356.4. [Q9ULU4-19]
XP_005260417.1. XM_005260360.4. [Q9ULU4-11]
XP_005260423.1. XM_005260366.2. [Q9ULU4-1]
XP_006723825.1. XM_006723762.3. [Q9ULU4-11]
XP_011527053.1. XM_011528751.1. [Q9ULU4-11]
XP_016883250.1. XM_017027761.1. [Q9ULU4-11]
XP_016883256.1. XM_017027767.1. [Q9ULU4-1]
XP_016883257.1. XM_017027768.1. [Q9ULU4-1]
UniGeneiHs.446240.
Hs.658553.
Hs.668465.

Genome annotation databases

EnsembliENST00000262975; ENSP00000262975; ENSG00000101040. [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040. [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040. [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040. [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040. [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040. [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040. [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040. [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040. [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040. [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040. [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040. [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040. [Q9ULU4-18]
GeneIDi23613.
KEGGihsa:23613.
UCSCiuc002xss.3. human. [Q9ULU4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233453 mRNA. Translation: AAF71262.1.
U48251 mRNA. Translation: AAC72244.1. Frameshift.
AF454056 mRNA. Translation: AAL50790.1.
AF273045 mRNA. Translation: AAG34905.1.
DQ082998 mRNA. Translation: AAY85630.1.
DQ082999 mRNA. Translation: AAY85631.1.
DQ368669 mRNA. Translation: ABC86680.1.
DQ368670 mRNA. Translation: ABC86681.1.
DQ368671 mRNA. Translation: ABC86682.1.
DQ368672 mRNA. Translation: ABC86683.1.
DQ368673 mRNA. Translation: ABC86684.1.
DQ368674 mRNA. Translation: ABC86685.1.
DQ368677 mRNA. Translation: ABC86688.1.
DQ368678 mRNA. Translation: ABC86689.1.
DQ368679 mRNA. Translation: ABC86690.1.
DQ368680 mRNA. Translation: ABC86691.1.
AB032951 mRNA. Translation: BAA86439.1. Different initiation.
AK122966 mRNA. Translation: BAG53824.1.
AK294511 mRNA. Translation: BAH11794.1.
AK295747 mRNA. Translation: BAH12176.1.
AK299899 mRNA. Translation: BAH13166.1.
BX641005 mRNA. Translation: CAE46008.1.
AL031666, AL049540, AL022342 Genomic DNA. Translation: CAI21842.1.
AL049540, AL031666, AL022342 Genomic DNA. Translation: CAI23169.1.
AL049540, AL031666, AL390212 Genomic DNA. Translation: CAI23168.1.
CH471077 Genomic DNA. Translation: EAW75703.1.
CH471077 Genomic DNA. Translation: EAW75706.1.
CH471077 Genomic DNA. Translation: EAW75709.1.
CH471077 Genomic DNA. Translation: EAW75711.1.
CH471077 Genomic DNA. Translation: EAW75712.1.
CH471077 Genomic DNA. Translation: EAW75715.1.
BC030721 mRNA. Translation: AAH30721.2.
BC136608 mRNA. Translation: AAI36609.1.
BC144289 mRNA. Translation: AAI44290.1.
CCDSiCCDS13404.1. [Q9ULU4-12]
CCDS13405.1. [Q9ULU4-13]
CCDS46613.1. [Q9ULU4-14]
CCDS63300.1. [Q9ULU4-11]
CCDS63301.1. [Q9ULU4-9]
CCDS63303.1. [Q9ULU4-18]
CCDS63304.1. [Q9ULU4-17]
CCDS63306.1. [Q9ULU4-7]
CCDS74738.1. [Q9ULU4-20]
RefSeqiNP_001268700.1. NM_001281771.2. [Q9ULU4-17]
NP_001268701.1. NM_001281772.2. [Q9ULU4-20]
NP_001268702.1. NM_001281773.2. [Q9ULU4-11]
NP_001268703.1. NM_001281774.2. [Q9ULU4-9]
NP_001268704.1. NM_001281775.2. [Q9ULU4-7]
NP_001268705.1. NM_001281776.2. [Q9ULU4-8]
NP_001268706.1. NM_001281777.2. [Q9ULU4-16]
NP_001268707.1. NM_001281778.2. [Q9ULU4-5]
NP_001268710.1. NM_001281781.2. [Q9ULU4-15]
NP_001268711.1. NM_001281782.2.
NP_001268712.1. NM_001281783.2. [Q9ULU4-10]
NP_001268713.1. NM_001281784.2. [Q9ULU4-18]
NP_036540.3. NM_012408.5. [Q9ULU4-12]
NP_898868.1. NM_183047.3. [Q9ULU4-13]
NP_898869.1. NM_183048.3. [Q9ULU4-14]
XP_005260413.1. XM_005260356.4. [Q9ULU4-19]
XP_005260417.1. XM_005260360.4. [Q9ULU4-11]
XP_005260423.1. XM_005260366.2. [Q9ULU4-1]
XP_006723825.1. XM_006723762.3. [Q9ULU4-11]
XP_011527053.1. XM_011528751.1. [Q9ULU4-11]
XP_016883250.1. XM_017027761.1. [Q9ULU4-11]
XP_016883256.1. XM_017027767.1. [Q9ULU4-1]
XP_016883257.1. XM_017027768.1. [Q9ULU4-1]
UniGeneiHs.446240.
Hs.658553.
Hs.668465.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4COSX-ray1.67A83-406[»]
ProteinModelPortaliQ9ULU4.
SMRiQ9ULU4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117146. 56 interactors.
IntActiQ9ULU4. 45 interactors.
MINTiMINT-1183677.

Chemistry databases

ChEMBLiCHEMBL3627580.

PTM databases

iPTMnetiQ9ULU4.
PhosphoSitePlusiQ9ULU4.

Polymorphism and mutation databases

BioMutaiZMYND8.
DMDMi25453223.

Proteomic databases

EPDiQ9ULU4.
PeptideAtlasiQ9ULU4.
PRIDEiQ9ULU4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262975; ENSP00000262975; ENSG00000101040. [Q9ULU4-9]
ENST00000311275; ENSP00000312237; ENSG00000101040. [Q9ULU4-1]
ENST00000352431; ENSP00000335537; ENSG00000101040. [Q9ULU4-12]
ENST00000355972; ENSP00000348246; ENSG00000101040. [Q9ULU4-11]
ENST00000360911; ENSP00000354166; ENSG00000101040. [Q9ULU4-14]
ENST00000372023; ENSP00000361093; ENSG00000101040. [Q9ULU4-23]
ENST00000396281; ENSP00000379577; ENSG00000101040. [Q9ULU4-20]
ENST00000446994; ENSP00000396725; ENSG00000101040. [Q9ULU4-11]
ENST00000458360; ENSP00000392964; ENSG00000101040. [Q9ULU4-17]
ENST00000461685; ENSP00000418210; ENSG00000101040. [Q9ULU4-13]
ENST00000471951; ENSP00000420095; ENSG00000101040. [Q9ULU4-7]
ENST00000536340; ENSP00000439800; ENSG00000101040. [Q9ULU4-19]
ENST00000540497; ENSP00000443086; ENSG00000101040. [Q9ULU4-18]
GeneIDi23613.
KEGGihsa:23613.
UCSCiuc002xss.3. human. [Q9ULU4-1]

Organism-specific databases

CTDi23613.
DisGeNETi23613.
GeneCardsiZMYND8.
H-InvDBHIX0015888.
HGNCiHGNC:9397. ZMYND8.
HPAiHPA020949.
neXtProtiNX_Q9ULU4.
OpenTargetsiENSG00000101040.
PharmGKBiPA162409890.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063428.
HOGENOMiHOG000230951.
HOVERGENiHBG031823.
InParanoidiQ9ULU4.
OMAiMDFLEKS.
OrthoDBiEOG091G0B2W.
PhylomeDBiQ9ULU4.
TreeFamiTF317221.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101040-MONOMER.

Miscellaneous databases

ChiTaRSiZMYND8. human.
GeneWikiiZMYND8.
GenomeRNAii23613.
PROiQ9ULU4.

Gene expression databases

BgeeiENSG00000101040.
CleanExiHS_ZMYND8.
ExpressionAtlasiQ9ULU4. baseline and differential.
GenevisibleiQ9ULU4. HS.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR021931. DUF3544.
IPR000313. PWWP_dom.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR002893. Znf_MYND.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF12064. DUF3544. 1 hit.
PF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00293. PWWP. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS50812. PWWP. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPKCB1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULU4
Secondary accession number(s): B3KVL2
, B7Z2A8, B7Z3E0, B7Z680, B7ZM62, E1P5U5, F5H0X3, H7C0U2, J3KPU3, Q13517, Q2HXV1, Q2HXV2, Q2HXV3, Q2HXV4, Q2HXV7, Q2HXV8, Q2HXV9, Q2HXW0, Q2HXW1, Q2HXW2, Q4JJ94, Q4JJ95, Q5TH09, Q5TH11, Q6MZM1, Q8WXC5, Q9H1F3, Q9H1F4, Q9H1F5, Q9H1L8, Q9H1L9, Q9H2G5, Q9NYN3, Q9UIX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: November 30, 2016
This is version 162 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.