Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NDRG4

Gene

NDRG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity). May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.By similarity1 Publication

GO - Biological processi

  1. cardiac muscle cell proliferation Source: BHF-UCL
  2. cell differentiation Source: UniProtKB
  3. cell growth Source: UniProtKB
  4. embryonic heart tube development Source: BHF-UCL
  5. heart looping Source: BHF-UCL
  6. negative regulation of platelet-derived growth factor receptor signaling pathway Source: BHF-UCL
  7. negative regulation of smooth muscle cell migration Source: BHF-UCL
  8. negative regulation of smooth muscle cell proliferation Source: BHF-UCL
  9. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  10. positive regulation of neuron projection development Source: BHF-UCL
  11. response to stress Source: UniProtKB
Complete GO annotation...

Protein family/group databases

MEROPSiS33.986.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
Brain development-related molecule 1
N-myc downstream-regulated gene 4 protein
Vascular smooth muscle cell-associated protein 8
Short name:
SMAP-8
Gene namesi
Name:NDRG4
Synonyms:BDM1, KIAA1180
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:14466. NDRG4.

Subcellular locationi

  1. Cytoplasmcytosol 2 Publications

GO - Cellular componenti

  1. basolateral plasma membrane Source: BHF-UCL
  2. cytoplasm Source: UniProtKB
  3. cytosol Source: UniProtKB-SubCell
  4. endoplasmic reticulum membrane Source: BHF-UCL
  5. mitochondrion Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31485.

Polymorphism and mutation databases

BioMutaiNDRG4.
DMDMi20141614.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 352352Protein NDRG4PRO_0000159579Add
BLAST

Post-translational modificationi

Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ULP0.
PRIDEiQ9ULP0.

PTM databases

PhosphoSiteiQ9ULP0.

Expressioni

Tissue specificityi

Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells.3 Publications

Developmental stagei

Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase.1 Publication

Gene expression databases

BgeeiQ9ULP0.
CleanExiHS_NDRG4.
ExpressionAtlasiQ9ULP0. baseline and differential.
GenevestigatoriQ9ULP0.

Organism-specific databases

HPAiHPA015313.
HPA017587.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW133EBI-10323810,EBI-741181
ARL6IP1Q150413EBI-10323810,EBI-714543
CMTM5Q96DZ93EBI-10323810,EBI-2548702
RABAC1Q9UI143EBI-10323810,EBI-712367

Protein-protein interaction databases

BioGridi122372. 7 interactions.
IntActiQ9ULP0. 4 interactions.
MINTiMINT-4723709.
STRINGi9606.ENSP00000377823.

Structurei

3D structure databases

ProteinModelPortaliQ9ULP0.
SMRiQ9ULP0. Positions 9-290.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi253 – 2564Poly-Thr

Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

eggNOGiNOG294160.
GeneTreeiENSGT00390000001874.
HOGENOMiHOG000230891.
HOVERGENiHBG052591.
InParanoidiQ9ULP0.
OMAiNTFFNYE.
PhylomeDBiQ9ULP0.
TreeFamiTF313168.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR004142. NDRG.
IPR030695. NDRG4.
[Graphical view]
PANTHERiPTHR11034. PTHR11034. 1 hit.
PTHR11034:SF21. PTHR11034:SF21. 1 hit.
PfamiPF03096. Ndr. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULP0-1) [UniParc]FASTAAdd to basket

Also known as: NDRG4-BVar

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF
60 70 80 90 100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV
110 120 130 140 150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLVNID PNGKGWIDWA
160 170 180 190 200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIG NVVNQANLQL
210 220 230 240 250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE DGVVECNSKL
260 270 280 290 300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG
310 320 330 340 350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV

SC
Length:352
Mass (Da):38,459
Last modified:January 23, 2002 - v2
Checksum:i4CFAFC7C820013B6
GO
Isoform 2 (identifier: Q9ULP0-2) [UniParc]FASTAAdd to basket

Also known as: NDRG4-B

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,089
Checksum:iE5721D653F9CF056
GO
Isoform 3 (identifier: Q9ULP0-3) [UniParc]FASTAAdd to basket

Also known as: NDRG4-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:371
Mass (Da):40,645
Checksum:iF7E4FA067E0DD752
GO
Isoform 4 (identifier: Q9ULP0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-303: Missing.

Show »
Length:339
Mass (Da):37,045
Checksum:iE56FB113F95D3056
GO
Isoform 5 (identifier: Q9ULP0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: H → RKCSPASVSPPLPPISQSD
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:357
Mass (Da):38,900
Checksum:i80425B23A100DEEB
GO
Isoform 6 (identifier: Q9ULP0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M

Show »
Length:391
Mass (Da):42,886
Checksum:i2072323C9172C2E3
GO
Isoform 7 (identifier: Q9ULP0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.

Show »
Length:369
Mass (Da):40,049
Checksum:i7DD24F9D2E46FDAE
GO
Isoform 8 (identifier: Q9ULP0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GRSQERRLPRVSSTVSPLQ
     289-302: IAYLKDRRLSGGAV → M

Note: No experimental confirmation available.

Show »
Length:357
Mass (Da):39,168
Checksum:i2CA4F68CC3298268
GO

Sequence cautioni

The sequence BAA86494.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101D → N in BAG61777 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 77MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. 1 PublicationVSP_003421
Alternative sequencei1 – 77MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. 1 PublicationVSP_022956
Alternative sequencei7 – 71G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. 1 PublicationVSP_045830
Alternative sequencei7 – 71G → GRSQERRLPRVSSTVSPLQ in isoform 8. 1 PublicationVSP_046326
Alternative sequencei43 – 431H → RKCSPASVSPPLPPISQSD in isoform 5. 1 PublicationVSP_022957
Alternative sequencei289 – 30214IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. 4 PublicationsVSP_003422Add
BLAST
Alternative sequencei291 – 30313Missing in isoform 4. 1 PublicationVSP_003423Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044947 Genomic DNA. Translation: BAB20071.1.
AB044947 Genomic DNA. Translation: BAB20072.1.
AB044947 Genomic DNA. Translation: BAB20073.1.
AB044944 mRNA. Translation: BAB20068.1.
AB044945 mRNA. Translation: BAB20069.1.
AB044946 mRNA. Translation: BAB20070.1.
AF308608 mRNA. Translation: AAL08806.1.
AB021172 mRNA. Translation: BAB20288.1.
AL136584 mRNA. Translation: CAB66519.1.
AK055038 mRNA. Translation: BAG51454.1.
AK126574 mRNA. Translation: BAC86600.1.
AK131248 mRNA. Translation: BAD18428.1.
AK296415 mRNA. Translation: BAG59078.1.
AK299949 mRNA. Translation: BAG61777.1.
AC009118 Genomic DNA. No translation available.
BC011795 mRNA. Translation: AAH11795.1.
AB033006 mRNA. Translation: BAA86494.2. Different initiation.
CCDSiCCDS10797.1. [Q9ULP0-3]
CCDS45500.1. [Q9ULP0-6]
CCDS55999.1. [Q9ULP0-7]
CCDS58465.1. [Q9ULP0-8]
CCDS58466.1. [Q9ULP0-1]
CCDS58467.1. [Q9ULP0-2]
RefSeqiNP_001123959.1. NM_001130487.1. [Q9ULP0-6]
NP_001229762.1. NM_001242833.1. [Q9ULP0-7]
NP_001229763.1. NM_001242834.1. [Q9ULP0-8]
NP_001229764.1. NM_001242835.1. [Q9ULP0-1]
NP_001229765.1. NM_001242836.1. [Q9ULP0-2]
NP_065198.1. NM_020465.3. [Q9ULP0-3]
NP_075061.1. NM_022910.3. [Q9ULP0-3]
UniGeneiHs.322430.

Genome annotation databases

EnsembliENST00000258187; ENSP00000258187; ENSG00000103034. [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034. [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034. [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034. [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034. [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034. [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034. [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034. [Q9ULP0-1]
GeneIDi65009.
KEGGihsa:65009.
UCSCiuc002enk.3. human. [Q9ULP0-3]
uc002enm.3. human. [Q9ULP0-6]
uc002eno.3. human. [Q9ULP0-1]
uc002enp.3. human. [Q9ULP0-2]
uc010cdk.3. human. [Q9ULP0-5]
uc010vii.2. human.

Polymorphism and mutation databases

BioMutaiNDRG4.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044947 Genomic DNA. Translation: BAB20071.1.
AB044947 Genomic DNA. Translation: BAB20072.1.
AB044947 Genomic DNA. Translation: BAB20073.1.
AB044944 mRNA. Translation: BAB20068.1.
AB044945 mRNA. Translation: BAB20069.1.
AB044946 mRNA. Translation: BAB20070.1.
AF308608 mRNA. Translation: AAL08806.1.
AB021172 mRNA. Translation: BAB20288.1.
AL136584 mRNA. Translation: CAB66519.1.
AK055038 mRNA. Translation: BAG51454.1.
AK126574 mRNA. Translation: BAC86600.1.
AK131248 mRNA. Translation: BAD18428.1.
AK296415 mRNA. Translation: BAG59078.1.
AK299949 mRNA. Translation: BAG61777.1.
AC009118 Genomic DNA. No translation available.
BC011795 mRNA. Translation: AAH11795.1.
AB033006 mRNA. Translation: BAA86494.2. Different initiation.
CCDSiCCDS10797.1. [Q9ULP0-3]
CCDS45500.1. [Q9ULP0-6]
CCDS55999.1. [Q9ULP0-7]
CCDS58465.1. [Q9ULP0-8]
CCDS58466.1. [Q9ULP0-1]
CCDS58467.1. [Q9ULP0-2]
RefSeqiNP_001123959.1. NM_001130487.1. [Q9ULP0-6]
NP_001229762.1. NM_001242833.1. [Q9ULP0-7]
NP_001229763.1. NM_001242834.1. [Q9ULP0-8]
NP_001229764.1. NM_001242835.1. [Q9ULP0-1]
NP_001229765.1. NM_001242836.1. [Q9ULP0-2]
NP_065198.1. NM_020465.3. [Q9ULP0-3]
NP_075061.1. NM_022910.3. [Q9ULP0-3]
UniGeneiHs.322430.

3D structure databases

ProteinModelPortaliQ9ULP0.
SMRiQ9ULP0. Positions 9-290.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122372. 7 interactions.
IntActiQ9ULP0. 4 interactions.
MINTiMINT-4723709.
STRINGi9606.ENSP00000377823.

Protein family/group databases

MEROPSiS33.986.

PTM databases

PhosphoSiteiQ9ULP0.

Polymorphism and mutation databases

BioMutaiNDRG4.
DMDMi20141614.

Proteomic databases

PaxDbiQ9ULP0.
PRIDEiQ9ULP0.

Protocols and materials databases

DNASUi65009.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258187; ENSP00000258187; ENSG00000103034. [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034. [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034. [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034. [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034. [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034. [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034. [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034. [Q9ULP0-1]
GeneIDi65009.
KEGGihsa:65009.
UCSCiuc002enk.3. human. [Q9ULP0-3]
uc002enm.3. human. [Q9ULP0-6]
uc002eno.3. human. [Q9ULP0-1]
uc002enp.3. human. [Q9ULP0-2]
uc010cdk.3. human. [Q9ULP0-5]
uc010vii.2. human.

Organism-specific databases

CTDi65009.
GeneCardsiGC16P058497.
HGNCiHGNC:14466. NDRG4.
HPAiHPA015313.
HPA017587.
MIMi614463. gene.
neXtProtiNX_Q9ULP0.
PharmGKBiPA31485.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG294160.
GeneTreeiENSGT00390000001874.
HOGENOMiHOG000230891.
HOVERGENiHBG052591.
InParanoidiQ9ULP0.
OMAiNTFFNYE.
PhylomeDBiQ9ULP0.
TreeFamiTF313168.

Miscellaneous databases

ChiTaRSiNDRG4. human.
GeneWikiiNDRG4.
GenomeRNAii65009.
NextBioi67196.
PROiQ9ULP0.
SOURCEiSearch...

Gene expression databases

BgeeiQ9ULP0.
CleanExiHS_NDRG4.
ExpressionAtlasiQ9ULP0. baseline and differential.
GenevestigatoriQ9ULP0.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR004142. NDRG.
IPR030695. NDRG4.
[Graphical view]
PANTHERiPTHR11034. PTHR11034. 1 hit.
PTHR11034:SF21. PTHR11034:SF21. 1 hit.
PfamiPF03096. Ndr. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart."
    Zhou R.-H., Kokame K., Tsukamoto Y., Yutani C., Kato H., Miyata T.
    Genomics 73:86-97(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  2. "Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family."
    Qu X., Zhai Y., Wei H., Zhang C., Xing G., Yu Y., He F.
    Mol. Cell. Biochem. 229:35-44(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Spleen.
  3. "A novel homocysteine-responsive gene, smap8, modulates mitogenesis in rat vascular smooth muscle cells."
    Nishimoto S., Tawara J., Toyoda H., Kitamura K., Komurasaki T.
    Eur. J. Biochem. 270:2521-2531(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
    Tissue: Heart.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7 AND 8).
    Tissue: Brain, Cerebellum, Hippocampus and Thalamus.
  6. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Muscle.
  8. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-352 (ISOFORM 1).
    Tissue: Brain.
  9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  10. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiNDRG4_HUMAN
AccessioniPrimary (citable) accession number: Q9ULP0
Secondary accession number(s): B3KNU2
, B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2002
Last modified: April 29, 2015
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.