Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULP0

- NDRG4_HUMAN

UniProt

Q9ULP0 - NDRG4_HUMAN

Protein

Protein NDRG4

Gene

NDRG4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 2 (23 Jan 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress By similarity. May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.By similarity1 Publication

    GO - Biological processi

    1. cell differentiation Source: UniProtKB
    2. cell growth Source: UniProtKB
    3. response to stress Source: UniProtKB

    Protein family/group databases

    MEROPSiS33.986.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein NDRG4
    Alternative name(s):
    Brain development-related molecule 1
    N-myc downstream-regulated gene 4 protein
    Vascular smooth muscle cell-associated protein 8
    Short name:
    SMAP-8
    Gene namesi
    Name:NDRG4
    Synonyms:BDM1, KIAA1180
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:14466. NDRG4.

    Subcellular locationi

    Cytoplasmcytosol 2 Publications

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytosol Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31485.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 352352Protein NDRG4PRO_0000159579Add
    BLAST

    Post-translational modificationi

    Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ9ULP0.
    PRIDEiQ9ULP0.

    PTM databases

    PhosphoSiteiQ9ULP0.

    Expressioni

    Tissue specificityi

    Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells.3 Publications

    Developmental stagei

    Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase.1 Publication

    Gene expression databases

    ArrayExpressiQ9ULP0.
    BgeeiQ9ULP0.
    CleanExiHS_NDRG4.
    GenevestigatoriQ9ULP0.

    Organism-specific databases

    HPAiHPA015313.
    HPA017587.

    Interactioni

    Protein-protein interaction databases

    MINTiMINT-4723709.
    STRINGi9606.ENSP00000377823.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULP0.
    SMRiQ9ULP0. Positions 9-290.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi253 – 2564Poly-Thr

    Sequence similaritiesi

    Belongs to the NDRG family.Curated

    Phylogenomic databases

    eggNOGiNOG294160.
    HOVERGENiHBG052591.
    OMAiNPIANVI.
    PhylomeDBiQ9ULP0.
    TreeFamiTF313168.

    Family and domain databases

    Gene3Di3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR004142. NDRG.
    [Graphical view]
    PANTHERiPTHR11034. PTHR11034. 1 hit.
    PfamiPF03096. Ndr. 1 hit.
    [Graphical view]
    SUPFAMiSSF53474. SSF53474. 1 hit.

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ULP0-1) [UniParc]FASTAAdd to Basket

    Also known as: NDRG4-BVar

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF    50
    FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV 100
    QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLVNID PNGKGWIDWA 150
    ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIG NVVNQANLQL 200
    FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE DGVVECNSKL 250
    DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG 300
    AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV 350
    SC 352
    Length:352
    Mass (Da):38,459
    Last modified:January 23, 2002 - v2
    Checksum:i4CFAFC7C820013B6
    GO
    Isoform 2 (identifier: Q9ULP0-2) [UniParc]FASTAAdd to Basket

    Also known as: NDRG4-B

    The sequence of this isoform differs from the canonical sequence as follows:
         289-302: IAYLKDRRLSGGAV → M

    Show »
    Length:339
    Mass (Da):37,089
    Checksum:iE5721D653F9CF056
    GO
    Isoform 3 (identifier: Q9ULP0-3) [UniParc]FASTAAdd to Basket

    Also known as: NDRG4-H

    The sequence of this isoform differs from the canonical sequence as follows:
         1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
         289-302: IAYLKDRRLSGGAV → M

    Show »
    Length:371
    Mass (Da):40,645
    Checksum:iF7E4FA067E0DD752
    GO
    Isoform 4 (identifier: Q9ULP0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         291-303: Missing.

    Show »
    Length:339
    Mass (Da):37,045
    Checksum:iE56FB113F95D3056
    GO
    Isoform 5 (identifier: Q9ULP0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         43-43: H → RKCSPASVSPPLPPISQSD
         289-302: IAYLKDRRLSGGAV → M

    Show »
    Length:357
    Mass (Da):38,900
    Checksum:i80425B23A100DEEB
    GO
    Isoform 6 (identifier: Q9ULP0-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
         289-302: IAYLKDRRLSGGAV → M

    Show »
    Length:391
    Mass (Da):42,886
    Checksum:i2072323C9172C2E3
    GO
    Isoform 7 (identifier: Q9ULP0-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
         289-302: IAYLKDRRLSGGAV → M

    Note: No experimental confirmation available.

    Show »
    Length:369
    Mass (Da):40,049
    Checksum:i7DD24F9D2E46FDAE
    GO
    Isoform 8 (identifier: Q9ULP0-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         7-7: G → GRSQERRLPRVSSTVSPLQ
         289-302: IAYLKDRRLSGGAV → M

    Note: No experimental confirmation available.

    Show »
    Length:357
    Mass (Da):39,168
    Checksum:i2CA4F68CC3298268
    GO

    Sequence cautioni

    The sequence BAA86494.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti10 – 101D → N in BAG61777. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 77MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. 1 PublicationVSP_003421
    Alternative sequencei1 – 77MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. 1 PublicationVSP_022956
    Alternative sequencei7 – 71G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. 1 PublicationVSP_045830
    Alternative sequencei7 – 71G → GRSQERRLPRVSSTVSPLQ in isoform 8. 1 PublicationVSP_046326
    Alternative sequencei43 – 431H → RKCSPASVSPPLPPISQSD in isoform 5. 1 PublicationVSP_022957
    Alternative sequencei289 – 30214IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. 4 PublicationsVSP_003422Add
    BLAST
    Alternative sequencei291 – 30313Missing in isoform 4. 1 PublicationVSP_003423Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB044947 Genomic DNA. Translation: BAB20071.1.
    AB044947 Genomic DNA. Translation: BAB20072.1.
    AB044947 Genomic DNA. Translation: BAB20073.1.
    AB044944 mRNA. Translation: BAB20068.1.
    AB044945 mRNA. Translation: BAB20069.1.
    AB044946 mRNA. Translation: BAB20070.1.
    AF308608 mRNA. Translation: AAL08806.1.
    AB021172 mRNA. Translation: BAB20288.1.
    AL136584 mRNA. Translation: CAB66519.1.
    AK055038 mRNA. Translation: BAG51454.1.
    AK126574 mRNA. Translation: BAC86600.1.
    AK131248 mRNA. Translation: BAD18428.1.
    AK296415 mRNA. Translation: BAG59078.1.
    AK299949 mRNA. Translation: BAG61777.1.
    AC009118 Genomic DNA. No translation available.
    BC011795 mRNA. Translation: AAH11795.1.
    AB033006 mRNA. Translation: BAA86494.2. Different initiation.
    CCDSiCCDS10797.1. [Q9ULP0-3]
    CCDS45500.1. [Q9ULP0-6]
    CCDS55999.1. [Q9ULP0-7]
    CCDS58465.1. [Q9ULP0-8]
    CCDS58466.1. [Q9ULP0-1]
    CCDS58467.1. [Q9ULP0-2]
    RefSeqiNP_001123959.1. NM_001130487.1. [Q9ULP0-6]
    NP_001229762.1. NM_001242833.1. [Q9ULP0-7]
    NP_001229763.1. NM_001242834.1. [Q9ULP0-8]
    NP_001229764.1. NM_001242835.1. [Q9ULP0-1]
    NP_001229765.1. NM_001242836.1. [Q9ULP0-2]
    NP_065198.1. NM_020465.3. [Q9ULP0-3]
    NP_075061.1. NM_022910.3. [Q9ULP0-3]
    UniGeneiHs.322430.

    Genome annotation databases

    EnsembliENST00000258187; ENSP00000258187; ENSG00000103034. [Q9ULP0-3]
    ENST00000356752; ENSP00000349193; ENSG00000103034. [Q9ULP0-7]
    ENST00000394279; ENSP00000377820; ENSG00000103034. [Q9ULP0-3]
    ENST00000394282; ENSP00000377823; ENSG00000103034. [Q9ULP0-6]
    ENST00000563799; ENSP00000458113; ENSG00000103034. [Q9ULP0-5]
    ENST00000566192; ENSP00000454410; ENSG00000103034. [Q9ULP0-2]
    ENST00000568640; ENSP00000456338; ENSG00000103034. [Q9ULP0-8]
    ENST00000570248; ENSP00000457659; ENSG00000103034. [Q9ULP0-1]
    GeneIDi65009.
    KEGGihsa:65009.
    UCSCiuc002enk.3. human. [Q9ULP0-3]
    uc002enm.3. human. [Q9ULP0-6]
    uc002eno.3. human. [Q9ULP0-1]
    uc002enp.3. human. [Q9ULP0-2]
    uc010cdk.3. human. [Q9ULP0-5]
    uc010vii.2. human.

    Polymorphism databases

    DMDMi20141614.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB044947 Genomic DNA. Translation: BAB20071.1 .
    AB044947 Genomic DNA. Translation: BAB20072.1 .
    AB044947 Genomic DNA. Translation: BAB20073.1 .
    AB044944 mRNA. Translation: BAB20068.1 .
    AB044945 mRNA. Translation: BAB20069.1 .
    AB044946 mRNA. Translation: BAB20070.1 .
    AF308608 mRNA. Translation: AAL08806.1 .
    AB021172 mRNA. Translation: BAB20288.1 .
    AL136584 mRNA. Translation: CAB66519.1 .
    AK055038 mRNA. Translation: BAG51454.1 .
    AK126574 mRNA. Translation: BAC86600.1 .
    AK131248 mRNA. Translation: BAD18428.1 .
    AK296415 mRNA. Translation: BAG59078.1 .
    AK299949 mRNA. Translation: BAG61777.1 .
    AC009118 Genomic DNA. No translation available.
    BC011795 mRNA. Translation: AAH11795.1 .
    AB033006 mRNA. Translation: BAA86494.2 . Different initiation.
    CCDSi CCDS10797.1. [Q9ULP0-3 ]
    CCDS45500.1. [Q9ULP0-6 ]
    CCDS55999.1. [Q9ULP0-7 ]
    CCDS58465.1. [Q9ULP0-8 ]
    CCDS58466.1. [Q9ULP0-1 ]
    CCDS58467.1. [Q9ULP0-2 ]
    RefSeqi NP_001123959.1. NM_001130487.1. [Q9ULP0-6 ]
    NP_001229762.1. NM_001242833.1. [Q9ULP0-7 ]
    NP_001229763.1. NM_001242834.1. [Q9ULP0-8 ]
    NP_001229764.1. NM_001242835.1. [Q9ULP0-1 ]
    NP_001229765.1. NM_001242836.1. [Q9ULP0-2 ]
    NP_065198.1. NM_020465.3. [Q9ULP0-3 ]
    NP_075061.1. NM_022910.3. [Q9ULP0-3 ]
    UniGenei Hs.322430.

    3D structure databases

    ProteinModelPortali Q9ULP0.
    SMRi Q9ULP0. Positions 9-290.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-4723709.
    STRINGi 9606.ENSP00000377823.

    Protein family/group databases

    MEROPSi S33.986.

    PTM databases

    PhosphoSitei Q9ULP0.

    Polymorphism databases

    DMDMi 20141614.

    Proteomic databases

    PaxDbi Q9ULP0.
    PRIDEi Q9ULP0.

    Protocols and materials databases

    DNASUi 65009.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000258187 ; ENSP00000258187 ; ENSG00000103034 . [Q9ULP0-3 ]
    ENST00000356752 ; ENSP00000349193 ; ENSG00000103034 . [Q9ULP0-7 ]
    ENST00000394279 ; ENSP00000377820 ; ENSG00000103034 . [Q9ULP0-3 ]
    ENST00000394282 ; ENSP00000377823 ; ENSG00000103034 . [Q9ULP0-6 ]
    ENST00000563799 ; ENSP00000458113 ; ENSG00000103034 . [Q9ULP0-5 ]
    ENST00000566192 ; ENSP00000454410 ; ENSG00000103034 . [Q9ULP0-2 ]
    ENST00000568640 ; ENSP00000456338 ; ENSG00000103034 . [Q9ULP0-8 ]
    ENST00000570248 ; ENSP00000457659 ; ENSG00000103034 . [Q9ULP0-1 ]
    GeneIDi 65009.
    KEGGi hsa:65009.
    UCSCi uc002enk.3. human. [Q9ULP0-3 ]
    uc002enm.3. human. [Q9ULP0-6 ]
    uc002eno.3. human. [Q9ULP0-1 ]
    uc002enp.3. human. [Q9ULP0-2 ]
    uc010cdk.3. human. [Q9ULP0-5 ]
    uc010vii.2. human.

    Organism-specific databases

    CTDi 65009.
    GeneCardsi GC16P058497.
    HGNCi HGNC:14466. NDRG4.
    HPAi HPA015313.
    HPA017587.
    MIMi 614463. gene.
    neXtProti NX_Q9ULP0.
    PharmGKBi PA31485.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG294160.
    HOVERGENi HBG052591.
    OMAi NPIANVI.
    PhylomeDBi Q9ULP0.
    TreeFami TF313168.

    Miscellaneous databases

    GeneWikii NDRG4.
    GenomeRNAii 65009.
    NextBioi 67196.
    PROi Q9ULP0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULP0.
    Bgeei Q9ULP0.
    CleanExi HS_NDRG4.
    Genevestigatori Q9ULP0.

    Family and domain databases

    Gene3Di 3.40.50.1820. 1 hit.
    InterProi IPR029058. AB_hydrolase.
    IPR004142. NDRG.
    [Graphical view ]
    PANTHERi PTHR11034. PTHR11034. 1 hit.
    Pfami PF03096. Ndr. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53474. SSF53474. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart."
      Zhou R.-H., Kokame K., Tsukamoto Y., Yutani C., Kato H., Miyata T.
      Genomics 73:86-97(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    2. "Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family."
      Qu X., Zhai Y., Wei H., Zhang C., Xing G., Yu Y., He F.
      Mol. Cell. Biochem. 229:35-44(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Spleen.
    3. "A novel homocysteine-responsive gene, smap8, modulates mitogenesis in rat vascular smooth muscle cells."
      Nishimoto S., Tawara J., Toyoda H., Kitamura K., Komurasaki T.
      Eur. J. Biochem. 270:2521-2531(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
      Tissue: Heart.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Amygdala.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7 AND 8).
      Tissue: Brain, Cerebellum, Hippocampus and Thalamus.
    6. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Muscle.
    8. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
      Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
      DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-352 (ISOFORM 1).
      Tissue: Brain.
    9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    10. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiNDRG4_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULP0
    Secondary accession number(s): B3KNU2
    , B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: January 23, 2002
    Last modified: October 1, 2014
    This is version 115 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3