Q9ULP0 (NDRG4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein NDRG4 Alternative name(s): Brain development-related molecule 1 N-myc downstream-regulated gene 4 protein Vascular smooth muscle cell-associated protein 8 Short name=SMAP-8 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 352 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress By similarity. May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner. Ref.3 |
| Subcellular location | |
| Tissue specificity | Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells. Ref.1 Ref.3 Ref.10 |
| Developmental stage | Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase. Ref.10 |
| Post-translational modification | Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment. Ref.3 |
| Sequence similarities | Belongs to the NDRG family. |
| Sequence caution | The sequence BAA86494.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell differentiation Non-traceable author statement Ref.1PubMed 11978393. Source: UniProtKB cell growthNon-traceable author statement Ref.1. Source: UniProtKB response to stressNon-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | cytoplasm Non-traceable author statement Ref.1. Source: UniProtKB cytosolInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ULP0-1) Also known as: NDRG4-BVar; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ULP0-2) Also known as: NDRG4-B; The sequence of this isoform differs from the canonical sequence as follows: 289-302: IAYLKDRRLSGGAV → M | ||||||
| Isoform 3 (identifier: Q9ULP0-3) Also known as: NDRG4-H; The sequence of this isoform differs from the canonical sequence as follows: 1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK 289-302: IAYLKDRRLSGGAV → M | ||||||
| Isoform 4 (identifier: Q9ULP0-4) The sequence of this isoform differs from the canonical sequence as follows: 291-303: Missing. | ||||||
| Isoform 5 (identifier: Q9ULP0-5) The sequence of this isoform differs from the canonical sequence as follows: 43-43: H → RKCSPASVSPPLPPISQSD 289-302: IAYLKDRRLSGGAV → M | ||||||
| Isoform 6 (identifier: Q9ULP0-6) The sequence of this isoform differs from the canonical sequence as follows: 1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK 289-302: IAYLKDRRLSGGAV → M | ||||||
| Isoform 7 (identifier: Q9ULP0-7) The sequence of this isoform differs from the canonical sequence as follows: 7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ 289-302: IAYLKDRRLSGGAV → M | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: Q9ULP0-8) The sequence of this isoform differs from the canonical sequence as follows: 7-7: G → GRSQERRLPRVSSTVSPLQ 289-302: IAYLKDRRLSGGAV → M | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 352 | 352 | Protein NDRG4 | PRO_0000159579 | |||||
Regions | |||||||||
| Compositional bias | 253 – 256 | 4 | Poly-Thr | ||||||
Amino acid modifications | |||||||||
| Modified residue | 298 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 7 | 7 | MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3. | VSP_003421 | |||||
| Alternative sequence | 1 – 7 | 7 | MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6. | VSP_022956 | |||||
| Alternative sequence | 7 | 1 | G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7. | VSP_045830 | |||||
| Alternative sequence | 7 | 1 | G → GRSQERRLPRVSSTVSPLQ in isoform 8. | VSP_046326 | |||||
| Alternative sequence | 43 | 1 | H → RKCSPASVSPPLPPISQSD in isoform 5. | VSP_022957 | |||||
| Alternative sequence | 289 – 302 | 14 | IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8. | VSP_003422 | |||||
| Alternative sequence | 291 – 303 | 13 | Missing in isoform 4. | VSP_003423 | |||||
Experimental info | |||||||||
| Sequence conflict | 10 | 1 | D → N in BAG61777. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart." Zhou R.-H., Kokame K., Tsukamoto Y., Yutani C., Kato H., Miyata T. Genomics 73:86-97(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [2] | "Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family." Qu X., Zhai Y., Wei H., Zhang C., Xing G., Yu Y., He F. Mol. Cell. Biochem. 229:35-44(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Spleen. |
| [3] | "A novel homocysteine-responsive gene, smap8, modulates mitogenesis in rat vascular smooth muscle cells." Nishimoto S., Tawara J., Toyoda H., Kitamura K., Komurasaki T. Eur. J. Biochem. 270:2521-2531(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, TISSUE SPECIFICITY. Tissue: Heart. |
| [4] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Amygdala. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7 AND 8). Tissue: Brain, Cerebellum, Hippocampus and Thalamus. |
| [6] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Muscle. |
| [8] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-352 (ISOFORM 1). Tissue: Brain. |
| [9] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [10] | "NDRG4 is required for cell cycle progression and survival in glioblastoma cells." Schilling S.H., Hjelmeland A.B., Radiloff D.R., Liu I.M., Wakeman T.P., Fielhauer J.R., Foster E.H., Lathia J.D., Rich J.N., Wang X.F., Datto M.B. J. Biol. Chem. 284:25160-25169(2009) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB044947 Genomic DNA. Translation: BAB20071.1. AB044947 Genomic DNA. Translation: BAB20072.1. AB044947 Genomic DNA. Translation: BAB20073.1. AB044944 mRNA. Translation: BAB20068.1. AB044945 mRNA. Translation: BAB20069.1. AB044946 mRNA. Translation: BAB20070.1. AF308608 mRNA. Translation: AAL08806.1. AB021172 mRNA. Translation: BAB20288.1. AL136584 mRNA. Translation: CAB66519.1. AK055038 mRNA. Translation: BAG51454.1. AK126574 mRNA. Translation: BAC86600.1. AK131248 mRNA. Translation: BAD18428.1. AK296415 mRNA. Translation: BAG59078.1. AK299949 mRNA. Translation: BAG61777.1. AC009118 Genomic DNA. No translation available. BC011795 mRNA. Translation: AAH11795.1. AB033006 mRNA. Translation: BAA86494.2. Different initiation. |
| IPI | IPI00008269. IPI00217784. IPI00418960. IPI00644702. IPI00745722. IPI00910928. |
| RefSeq | NP_001123959.1. NM_001130487.1. NP_001229762.1. NM_001242833.1. NP_001229763.1. NM_001242834.1. NP_001229764.1. NM_001242835.1. NP_001229765.1. NM_001242836.1. NP_065198.1. NM_020465.3. NP_075061.1. NM_022910.3. |
| UniGene | Hs.322430. |
3D structure databases | |
| ProteinModelPortal | Q9ULP0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000377823. |
Protein family/group databases | |
| MEROPS | S33.986. |
PTM databases | |
| PhosphoSite | Q9ULP0. |
Polymorphism databases | |
| DMDM | 20141614. |
Proteomic databases | |
| PaxDb | Q9ULP0. |
| PRIDE | Q9ULP0. |
Protocols and materials databases | |
| DNASU | 65009. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000258187; ENSP00000258187; ENSG00000103034. ENST00000356752; ENSP00000349193; ENSG00000103034. ENST00000394279; ENSP00000377820; ENSG00000103034. ENST00000394282; ENSP00000377823; ENSG00000103034. ENST00000563799; ENSP00000458113; ENSG00000103034. ENST00000566192; ENSP00000454410; ENSG00000103034. ENST00000568640; ENSP00000456338; ENSG00000103034. ENST00000570248; ENSP00000457659; ENSG00000103034. |
| GeneID | 65009. |
| KEGG | hsa:65009. |
| UCSC | uc002enk.3. human. uc002enm.3. human. uc002eno.3. human. uc002enp.3. human. uc010cdk.3. human. |
Organism-specific databases | |
| CTD | 65009. |
| GeneCards | GC16P058497. |
| HGNC | HGNC:14466. NDRG4. |
| HPA | HPA015313. HPA017587. |
| MIM | 614463. gene. |
| neXtProt | NX_Q9ULP0. |
| PharmGKB | PA31485. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG294160. |
| HOVERGEN | HBG052591. |
Gene expression databases | |
| ArrayExpress | Q9ULP0. |
| Bgee | Q9ULP0. |
| CleanEx | HS_NDRG4. |
| Genevestigator | Q9ULP0. |
| GermOnline | ENSG00000103034. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004142. Ndr. [Graphical view] |
| PANTHER | PTHR11034. PTHR11034. 1 hit. |
| Pfam | PF03096. Ndr. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 65009. |
| NextBio | 67196. |
| SOURCE | Search... |
Entry information
| Entry name | NDRG4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULP0 Secondary accession number(s): B3KNU2 Q9GZX0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
