Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ULP0 (NDRG4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein NDRG4
Alternative name(s):
Brain development-related molecule 1
N-myc downstream-regulated gene 4 protein
Vascular smooth muscle cell-associated protein 8
Short name=SMAP-8
Gene names
Name:NDRG4
Synonyms:BDM1, KIAA1180
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length352 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress By similarity. May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner. Ref.3

Subcellular location

Cytoplasmcytosol Ref.3 Ref.10.

Tissue specificity

Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells. Ref.1 Ref.3 Ref.10

Developmental stage

Expressed in a cell cycle-specific manner in glioblastoma multiple cells. Low levels in G2/M cells increase with progression through G1 phase and entry and progression through S phase. Ref.10

Post-translational modification

Phosphorylated in an aortic smooth muscle cell line, following PDGF treatment. Ref.3

Sequence similarities

Belongs to the NDRG family.

Sequence caution

The sequence BAA86494.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell differentiation

Non-traceable author statement Ref.1PubMed 11978393. Source: UniProtKB

cell growth

Non-traceable author statement Ref.1. Source: UniProtKB

response to stress

Non-traceable author statement Ref.1. Source: UniProtKB

   Cellular_componentcytoplasm

Non-traceable author statement Ref.1. Source: UniProtKB

cytosol

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ULP0-1)

Also known as: NDRG4-BVar;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ULP0-2)

Also known as: NDRG4-B;

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAYLKDRRLSGGAV → M
Isoform 3 (identifier: Q9ULP0-3)

Also known as: NDRG4-H;

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M
Isoform 4 (identifier: Q9ULP0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     291-303: Missing.
Isoform 5 (identifier: Q9ULP0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: H → RKCSPASVSPPLPPISQSD
     289-302: IAYLKDRRLSGGAV → M
Isoform 6 (identifier: Q9ULP0-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLELLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWK
     289-302: IAYLKDRRLSGGAV → M
Isoform 7 (identifier: Q9ULP0-7)

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GVGEGNAGAVKLAGLGDPRWSPGHLLSPGHQ
     289-302: IAYLKDRRLSGGAV → M
Note: No experimental confirmation available.
Isoform 8 (identifier: Q9ULP0-8)

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GRSQERRLPRVSSTVSPLQ
     289-302: IAYLKDRRLSGGAV → M
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 352352Protein NDRG4
PRO_0000159579

Regions

Compositional bias253 – 2564Poly-Thr

Natural variations

Alternative sequence1 – 77MPECWDG → MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 3.
VSP_003421
Alternative sequence1 – 77MPECWDG → MKVLGHRLELLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATELESSDAFLLAADTDWK in isoform 6.
VSP_022956
Alternative sequence71G → GVGEGNAGAVKLAGLGDPRW SPGHLLSPGHQ in isoform 7.
VSP_045830
Alternative sequence71G → GRSQERRLPRVSSTVSPLQ in isoform 8.
VSP_046326
Alternative sequence431H → RKCSPASVSPPLPPISQSD in isoform 5.
VSP_022957
Alternative sequence289 – 30214IAYLK…SGGAV → M in isoform 2, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8.
VSP_003422
Alternative sequence291 – 30313Missing in isoform 4.
VSP_003423

Experimental info

Sequence conflict101D → N in BAG61777. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (NDRG4-BVar) [UniParc].

Last modified January 23, 2002. Version 2.
Checksum: 4CFAFC7C820013B6

FASTA35238,459
        10         20         30         40         50         60 
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF FNFEDMQEIT 

        70         80         90        100        110        120 
KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV QHFGFKYVIG IGVGAGAYVL 

       130        140        150        160        170        180 
AKFALIFPDL VEGLVLVNID PNGKGWIDWA ATKLSGLTST LPDTVLSHLF SQEELVNNTE 

       190        200        210        220        230        240 
LVQSYRQQIG NVVNQANLQL FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE 

       250        260        270        280        290        300 
DGVVECNSKL DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA YLKDRRLSGG 

       310        320        330        340        350 
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ ACTHSESSEG LGQVNHTMEV SC 

« Hide

Isoform 2 (NDRG4-B) [UniParc].

Checksum: E5721D653F9CF056
Show »

FASTA33937,089
Isoform 3 (NDRG4-H) [UniParc].

Checksum: F7E4FA067E0DD752
Show »

FASTA37140,645
Isoform 4 [UniParc].

Checksum: E56FB113F95D3056
Show »

FASTA33937,045
Isoform 5 [UniParc].

Checksum: 80425B23A100DEEB
Show »

FASTA35738,900
Isoform 6 [UniParc].

Checksum: 2072323C9172C2E3
Show »

FASTA39142,886
Isoform 7 [UniParc].

Checksum: 7DD24F9D2E46FDAE
Show »

FASTA36940,049
Isoform 8 [UniParc].

Checksum: 2CA4F68CC3298268
Show »

FASTA35739,168

References

« Hide 'large scale' references
[1]"Characterization of the human NDRG gene family: a newly identified member, NDRG4, is specifically expressed in brain and heart."
Zhou R.-H., Kokame K., Tsukamoto Y., Yutani C., Kato H., Miyata T.
Genomics 73:86-97(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[2]"Characterization and expression of three novel differentiation-related genes belong to the human NDRG gene family."
Qu X., Zhai Y., Wei H., Zhang C., Xing G., Yu Y., He F.
Mol. Cell. Biochem. 229:35-44(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Spleen.
[3]"A novel homocysteine-responsive gene, smap8, modulates mitogenesis in rat vascular smooth muscle cells."
Nishimoto S., Tawara J., Toyoda H., Kitamura K., Komurasaki T.
Eur. J. Biochem. 270:2521-2531(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
Tissue: Heart.
[4]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Amygdala.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7 AND 8).
Tissue: Brain, Cerebellum, Hippocampus and Thalamus.
[6]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Muscle.
[8]"Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-352 (ISOFORM 1).
Tissue: Brain.
[9]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[10]"NDRG4 is required for cell cycle progression and survival in glioblastoma cells."
Schilling S.H., Hjelmeland A.B., Radiloff D.R., Liu I.M., Wakeman T.P., Fielhauer J.R., Foster E.H., Lathia J.D., Rich J.N., Wang X.F., Datto M.B.
J. Biol. Chem. 284:25160-25169(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB044947 Genomic DNA. Translation: BAB20071.1.
AB044947 Genomic DNA. Translation: BAB20072.1.
AB044947 Genomic DNA. Translation: BAB20073.1.
AB044944 mRNA. Translation: BAB20068.1.
AB044945 mRNA. Translation: BAB20069.1.
AB044946 mRNA. Translation: BAB20070.1.
AF308608 mRNA. Translation: AAL08806.1.
AB021172 mRNA. Translation: BAB20288.1.
AL136584 mRNA. Translation: CAB66519.1.
AK055038 mRNA. Translation: BAG51454.1.
AK126574 mRNA. Translation: BAC86600.1.
AK131248 mRNA. Translation: BAD18428.1.
AK296415 mRNA. Translation: BAG59078.1.
AK299949 mRNA. Translation: BAG61777.1.
AC009118 Genomic DNA. No translation available.
BC011795 mRNA. Translation: AAH11795.1.
AB033006 mRNA. Translation: BAA86494.2. Different initiation.
CCDSCCDS10797.1. [Q9ULP0-3]
CCDS45500.1. [Q9ULP0-6]
CCDS55999.1. [Q9ULP0-7]
CCDS58465.1. [Q9ULP0-8]
CCDS58466.1. [Q9ULP0-1]
CCDS58467.1. [Q9ULP0-2]
RefSeqNP_001123959.1. NM_001130487.1. [Q9ULP0-6]
NP_001229762.1. NM_001242833.1. [Q9ULP0-7]
NP_001229763.1. NM_001242834.1. [Q9ULP0-8]
NP_001229764.1. NM_001242835.1. [Q9ULP0-1]
NP_001229765.1. NM_001242836.1. [Q9ULP0-2]
NP_065198.1. NM_020465.3. [Q9ULP0-3]
NP_075061.1. NM_022910.3. [Q9ULP0-3]
UniGeneHs.322430.

3D structure databases

ProteinModelPortalQ9ULP0.
SMRQ9ULP0. Positions 9-290.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-4723709.
STRING9606.ENSP00000377823.

Protein family/group databases

MEROPSS33.986.

PTM databases

PhosphoSiteQ9ULP0.

Polymorphism databases

DMDM20141614.

Proteomic databases

PaxDbQ9ULP0.
PRIDEQ9ULP0.

Protocols and materials databases

DNASU65009.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000258187; ENSP00000258187; ENSG00000103034. [Q9ULP0-3]
ENST00000356752; ENSP00000349193; ENSG00000103034. [Q9ULP0-7]
ENST00000394279; ENSP00000377820; ENSG00000103034. [Q9ULP0-3]
ENST00000394282; ENSP00000377823; ENSG00000103034. [Q9ULP0-6]
ENST00000563799; ENSP00000458113; ENSG00000103034. [Q9ULP0-5]
ENST00000566192; ENSP00000454410; ENSG00000103034. [Q9ULP0-2]
ENST00000568640; ENSP00000456338; ENSG00000103034. [Q9ULP0-8]
ENST00000570248; ENSP00000457659; ENSG00000103034. [Q9ULP0-1]
GeneID65009.
KEGGhsa:65009.
UCSCuc002enk.3. human. [Q9ULP0-3]
uc002enm.3. human. [Q9ULP0-6]
uc002eno.3. human. [Q9ULP0-1]
uc002enp.3. human. [Q9ULP0-2]
uc010cdk.3. human. [Q9ULP0-5]
uc010vii.2. human.

Organism-specific databases

CTD65009.
GeneCardsGC16P058497.
HGNCHGNC:14466. NDRG4.
HPAHPA015313.
HPA017587.
MIM614463. gene.
neXtProtNX_Q9ULP0.
PharmGKBPA31485.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG294160.
HOVERGENHBG052591.
OMANPIANVI.
PhylomeDBQ9ULP0.
TreeFamTF313168.

Gene expression databases

ArrayExpressQ9ULP0.
BgeeQ9ULP0.
CleanExHS_NDRG4.
GenevestigatorQ9ULP0.

Family and domain databases

Gene3D3.40.50.1820. 1 hit.
InterProIPR029058. AB_hydrolase.
IPR004142. NDRG.
[Graphical view]
PANTHERPTHR11034. PTHR11034. 1 hit.
PfamPF03096. Ndr. 1 hit.
[Graphical view]
SUPFAMSSF53474. SSF53474. 1 hit.
ProtoNetSearch...

Other

GeneWikiNDRG4.
GenomeRNAi65009.
NextBio67196.
PROQ9ULP0.
SOURCESearch...

Entry information

Entry nameNDRG4_HUMAN
AccessionPrimary (citable) accession number: Q9ULP0
Secondary accession number(s): B3KNU2 expand/collapse secondary AC list , B4DK66, B4DSW5, H7C600, Q6ZNE7, Q6ZTI7, Q96PL9, Q9GZM1, Q9GZN3, Q9GZX0
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2002
Last modified: July 9, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM