Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULL4

- PLXB3_HUMAN

UniProt

Q9ULL4 - PLXB3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Plexin-B3

Gene

PLXNB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.3 Publications

GO - Molecular functioni

  1. protein domain specific binding Source: UniProtKB
  2. semaphorin receptor activity Source: UniProtKB

GO - Biological processi

  1. axon guidance Source: Reactome
  2. cell chemotaxis Source: UniProtKB
  3. negative regulation of cell adhesion Source: UniProtKB
  4. negative regulation of cell migration Source: UniProtKB
  5. negative regulation of GTPase activity Source: UniProtKB
  6. negative regulation of lamellipodium assembly Source: UniProtKB
  7. positive chemotaxis Source: UniProtKB
  8. positive regulation of endothelial cell proliferation Source: UniProtKB
  9. semaphorin-plexin signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_19200. Other semaphorin interactions.
SignaLinkiQ9ULL4.

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-B3
Gene namesi
Name:PLXNB3
Synonyms:KIAA1206, PLXN6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:9105. PLXNB3.

Subcellular locationi

Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications
Note: Colocalizes with RIT2/RIN at the plasma membrane.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini45 – 12551211ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1256 – 127621HelicalSequence AnalysisAdd
BLAST
Topological domaini1277 – 1909633CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: InterPro
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33431.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4444Sequence AnalysisAdd
BLAST
Chaini45 – 19091865Plexin-B3PRO_0000024674Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi51 – 511N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi98 ↔ 107PROSITE-ProRule annotation
Disulfide bondi132 ↔ 140PROSITE-ProRule annotation
Glycosylationi231 – 2311N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi267 ↔ 370PROSITE-ProRule annotation
Disulfide bondi283 ↔ 315PROSITE-ProRule annotation
Disulfide bondi333 ↔ 357PROSITE-ProRule annotation
Disulfide bondi474 ↔ 491PROSITE-ProRule annotation
Disulfide bondi480 ↔ 525PROSITE-ProRule annotation
Disulfide bondi483 ↔ 500PROSITE-ProRule annotation
Disulfide bondi494 ↔ 506PROSITE-ProRule annotation
Disulfide bondi562 ↔ 580PROSITE-ProRule annotation
Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
Glycosylationi802 – 8021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi900 – 9001N-linked (GlcNAc...)Sequence Analysis
Glycosylationi957 – 9571N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1101 – 11011N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1218 – 12181N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ULL4.
PRIDEiQ9ULL4.

PTM databases

PhosphoSiteiQ9ULL4.

Expressioni

Tissue specificityi

Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines.3 Publications

Gene expression databases

BgeeiQ9ULL4.
CleanExiHS_PLXNB3.
GenevestigatoriQ9ULL4.

Organism-specific databases

HPAiHPA000230.

Interactioni

Subunit structurei

Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA (By similarity). Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FSCN1Q166582EBI-311073,EBI-351076
METP085812EBI-311073,EBI-1039152
MST1RQ049122EBI-311073,EBI-2637518

Protein-protein interaction databases

BioGridi111378. 6 interactions.
IntActiQ9ULL4. 11 interactions.
MINTiMINT-2822157.
STRINGi9606.ENSP00000355378.

Structurei

3D structure databases

ProteinModelPortaliQ9ULL4.
SMRiQ9ULL4. Positions 1325-1903.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 471427SemaPROSITE-ProRule annotationAdd
BLAST
Domaini473 – 52654PSI 1Add
BLAST
Domaini620 – 68263PSI 2Add
BLAST
Domaini787 – 83347PSI 3Add
BLAST
Domaini835 – 92591IPT/TIG 1Add
BLAST
Domaini927 – 101286IPT/TIG 2Add
BLAST
Domaini1015 – 1145131IPT/TIG 3Add
BLAST
Domaini1159 – 124486IPT/TIG 4Add
BLAST

Sequence similaritiesi

Belongs to the plexin family.Curated
Contains 4 IPT/TIG domains.Curated
Contains 3 PSI domains.Curated
Contains 1 Sema domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG254546.
GeneTreeiENSGT00760000119048.
HOVERGENiHBG053404.
InParanoidiQ9ULL4.
KOiK06821.
OMAiCGDEHTP.
PhylomeDBiQ9ULL4.
TreeFamiTF312962.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 5 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 3 hits.
[Graphical view]
SMARTiSM00429. IPT. 3 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 5 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ULL4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP
60 70 80 90 100
NTTLNHLALA PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP
110 120 130 140 150
FRDPAECPQA QLTDNANQLL LVSSRAQELV ACGQVRQGVC ETRRLGDVAE
160 170 180 190 200
VLYQAEDPGD GQFVAANTPG VATVGLVVPL PGRDLLLVAR GLAGKLSAGV
210 220 230 240 250
PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD ARSAYFVFRR
260 270 280 290 300
RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL
310 320 330 340 350
GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE
360 370 380 390 400
YGVTSRCVTL PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV
410 420 430 440 450
AALQADGHMI AFLGDTQGQL YKVFLHGSQG QVYHSQQVGP PGSAISPDLL
460 470 480 490 500
LDSSGSHLYV LTAHQVDRIP VAACPQFPDC ASCLQAQDPL CGWCVLQGRC
510 520 530 540 550
TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE QGQVTLSVPR
560 570 580 590 600
LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV
610 620 630 640 650
PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS
660 670 680 690 700
HCVYGEHCPE GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH
710 720 730 740 750
LALRVRNLQH FRGLPASFHC WLELPGELRG LPATLEETAG DSGLIHCQAH
760 770 780 790 800
QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA LYVILYDCAM GHPDCSHCQA
810 820 830 840 850
ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV EPLTGPPEGG
860 870 880 890 900
LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN
910 920 930 940 950
GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ
960 970 980 990 1000
HLQTGGNTSA FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA
1010 1020 1030 1040 1050
QRTLLASPFR YTANPQLVAA EPSASFRGGG RLIRVRGTGL DVVQRPLLSV
1060 1070 1080 1090 1100
WLEADAEVQA SRAQPQDPQP RRSCGAPAAD PQACIQLGGG LLQCSTVCSV
1110 1120 1130 1140 1150
NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ GFLYQPNPRL
1160 1170 1180 1190 1200
APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL
1210 1220 1230 1240 1250
TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF
1260 1270 1280 1290 1300
PVEAQAGVGM GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG
1310 1320 1330 1340 1350
VGDQCRKEFT DLMTEMTDLS SDLEGSGIPF LDYRTYAERA FFPGHGGCPL
1360 1370 1380 1390 1400
QPKPEGPGED GHCATVRQGL TQLSNLLNSK LFLLTLIHTL EEQPSFSQRD
1410 1420 1430 1440 1450
RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK LMLRRTETMV
1460 1470 1480 1490 1500
EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT
1510 1520 1530 1540 1550
LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ
1560 1570 1580 1590 1600
VKEKVLDQVY KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH
1610 1620 1630 1640 1650
WKRLNTLQHY KVPDGATVGL VPQLHRGSTI SQSLAQRCPL GENIPTLEDG
1660 1670 1680 1690 1700
EEGGVCLWHL VKATEEPEGA KVRCSSLRER EPARAKAIPE IYLTRLLSMK
1710 1720 1730 1740 1750
GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG IEDPGTLHIW
1760 1770 1780 1790 1800
KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK
1810 1820 1830 1840 1850
VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG
1860 1870 1880 1890 1900
NYTSAPHCLE ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA

LVENKVTDL
Length:1,909
Mass (Da):206,847
Last modified:August 31, 2004 - v2
Checksum:i11753CD58C7AC226
GO
Isoform 2 (identifier: Q9ULL4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

Show »
Length:1,932
Mass (Da):209,301
Checksum:iBA26AFFF478B979B
GO

Sequence cautioni

The sequence BAA86520.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti149 – 1491A → V in BAH12182. (PubMed:14702039)Curated
Sequence conflicti300 – 3001L → P in BAH12182. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti126 – 1261A → T.
Corresponds to variant rs34360382 [ dbSNP | Ensembl ].
VAR_050601
Natural varianti598 – 5981V → I.1 Publication
Corresponds to variant rs2266879 [ dbSNP | Ensembl ].
VAR_019681
Natural varianti1156 – 11561E → D.1 Publication
Corresponds to variant rs6643791 [ dbSNP | Ensembl ].
VAR_061538
Natural varianti1535 – 15351M → T.1 Publication
Corresponds to variant rs5987155 [ dbSNP | Ensembl ].
VAR_019682
Natural varianti1651 – 16511E → A.
Corresponds to variant rs34762690 [ dbSNP | Ensembl ].
VAR_068807

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1515MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2. 1 PublicationVSP_044467Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149019 mRNA. Translation: AAG01376.1.
AB033032 mRNA. Translation: BAA86520.1. Different initiation.
AK295762 mRNA. Translation: BAH12182.1.
U52111 Genomic DNA. No translation available.
CCDSiCCDS14729.1. [Q9ULL4-1]
CCDS55536.1. [Q9ULL4-2]
RefSeqiNP_001156729.1. NM_001163257.1. [Q9ULL4-2]
NP_005384.2. NM_005393.2. [Q9ULL4-1]
UniGeneiHs.632833.

Genome annotation databases

EnsembliENST00000361971; ENSP00000355378; ENSG00000198753. [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753. [Q9ULL4-2]
GeneIDi5365.
KEGGihsa:5365.
UCSCiuc004fii.2. human. [Q9ULL4-1]
uc010nuk.2. human. [Q9ULL4-2]

Polymorphism databases

DMDMi51701857.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149019 mRNA. Translation: AAG01376.1 .
AB033032 mRNA. Translation: BAA86520.1 . Different initiation.
AK295762 mRNA. Translation: BAH12182.1 .
U52111 Genomic DNA. No translation available.
CCDSi CCDS14729.1. [Q9ULL4-1 ]
CCDS55536.1. [Q9ULL4-2 ]
RefSeqi NP_001156729.1. NM_001163257.1. [Q9ULL4-2 ]
NP_005384.2. NM_005393.2. [Q9ULL4-1 ]
UniGenei Hs.632833.

3D structure databases

ProteinModelPortali Q9ULL4.
SMRi Q9ULL4. Positions 1325-1903.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111378. 6 interactions.
IntActi Q9ULL4. 11 interactions.
MINTi MINT-2822157.
STRINGi 9606.ENSP00000355378.

PTM databases

PhosphoSitei Q9ULL4.

Polymorphism databases

DMDMi 51701857.

Proteomic databases

PaxDbi Q9ULL4.
PRIDEi Q9ULL4.

Protocols and materials databases

DNASUi 5365.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361971 ; ENSP00000355378 ; ENSG00000198753 . [Q9ULL4-1 ]
ENST00000538966 ; ENSP00000442736 ; ENSG00000198753 . [Q9ULL4-2 ]
GeneIDi 5365.
KEGGi hsa:5365.
UCSCi uc004fii.2. human. [Q9ULL4-1 ]
uc010nuk.2. human. [Q9ULL4-2 ]

Organism-specific databases

CTDi 5365.
GeneCardsi GC0XP153029.
H-InvDB HIX0093726.
HGNCi HGNC:9105. PLXNB3.
HPAi HPA000230.
MIMi 300214. gene.
neXtProti NX_Q9ULL4.
PharmGKBi PA33431.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254546.
GeneTreei ENSGT00760000119048.
HOVERGENi HBG053404.
InParanoidi Q9ULL4.
KOi K06821.
OMAi CGDEHTP.
PhylomeDBi Q9ULL4.
TreeFami TF312962.

Enzyme and pathway databases

Reactomei REACT_19200. Other semaphorin interactions.
SignaLinki Q9ULL4.

Miscellaneous databases

ChiTaRSi PLXNB3. human.
GeneWikii PLXNB3.
GenomeRNAii 5365.
NextBioi 20796.
PROi Q9ULL4.
SOURCEi Search...

Gene expression databases

Bgeei Q9ULL4.
CleanExi HS_PLXNB3.
Genevestigatori Q9ULL4.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
2.60.40.10. 5 hits.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
Pfami PF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 3 hits.
[Graphical view ]
SMARTi SM00429. IPT. 3 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view ]
SUPFAMi SSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 5 hits.
PROSITEi PS51004. SEMA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of the new human plexin family member, plexin related protein."
    Veske A., Michelson P., Finckh U., Gal A.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-598; ASP-1156 AND THR-1535.
    Tissue: Hippocampus.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Interplay between scatter factor receptors and B plexins controls invasive growth."
    Conrotto P., Corso S., Gamberini S., Comoglio P.M., Giordano S.
    Oncogene 23:5131-5137(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MET AND MST1R.
  6. Cited for: FUNCTION, SUBCELLULAR LOCATION.
  7. "Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin."
    Hartwig C., Veske A., Krejcova S., Rosenberger G., Finckh U.
    BMC Neurosci. 6:53-53(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. "Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase."
    Li X., Lee A.Y.
    J. Biol. Chem. 285:32436-32445(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  9. "Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton."
    Li X., Law J.W., Lee A.Y.
    Oncogene 31:595-610(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH FSCN1, TISSUE SPECIFICITY.

Entry informationi

Entry nameiPLXB3_HUMAN
AccessioniPrimary (citable) accession number: Q9ULL4
Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: October 29, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3