SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULL4

- PLXB3_HUMAN

UniProt

Q9ULL4 - PLXB3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Plexin-B3
Gene
PLXNB3, KIAA1206, PLXN6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.3 Publications

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. protein domain specific binding Source: UniProtKB
  3. receptor activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. axon guidance Source: Reactome
  2. negative regulation of GTPase activity Source: UniProtKB
  3. negative regulation of cell adhesion Source: UniProtKB
  4. negative regulation of cell migration Source: UniProtKB
  5. negative regulation of lamellipodium assembly Source: UniProtKB
  6. positive chemotaxis Source: UniProtKB
  7. positive regulation of endothelial cell proliferation Source: UniProtKB
  8. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_19200. Other semaphorin interactions.
SignaLinkiQ9ULL4.

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-B3
Gene namesi
Name:PLXNB3
Synonyms:KIAA1206, PLXN6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:9105. PLXNB3.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein
Note: Colocalizes with RIT2/RIN at the plasma membrane.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini45 – 12551211Extracellular Reviewed prediction
Add
BLAST
Transmembranei1256 – 127621Helical; Reviewed prediction
Add
BLAST
Topological domaini1277 – 1909633Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: InterPro
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33431.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4444 Reviewed prediction
Add
BLAST
Chaini45 – 19091865Plexin-B3
PRO_0000024674Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi51 – 511N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi98 ↔ 107 By similarity
Disulfide bondi132 ↔ 140 By similarity
Glycosylationi231 – 2311N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi267 ↔ 370 By similarity
Disulfide bondi283 ↔ 315 By similarity
Disulfide bondi333 ↔ 357 By similarity
Disulfide bondi474 ↔ 491 By similarity
Disulfide bondi480 ↔ 525 By similarity
Disulfide bondi483 ↔ 500 By similarity
Disulfide bondi494 ↔ 506 By similarity
Disulfide bondi562 ↔ 580 By similarity
Glycosylationi615 – 6151N-linked (GlcNAc...) Reviewed prediction
Glycosylationi802 – 8021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi900 – 9001N-linked (GlcNAc...) Reviewed prediction
Glycosylationi957 – 9571N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1101 – 11011N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1218 – 12181N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ULL4.
PRIDEiQ9ULL4.

PTM databases

PhosphoSiteiQ9ULL4.

Expressioni

Tissue specificityi

Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines.3 Publications

Gene expression databases

ArrayExpressiQ9ULL4.
BgeeiQ9ULL4.
CleanExiHS_PLXNB3.
GenevestigatoriQ9ULL4.

Organism-specific databases

HPAiHPA000230.

Interactioni

Subunit structurei

Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA By similarity. Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FSCN1Q166582EBI-311073,EBI-351076
METP085812EBI-311073,EBI-1039152
MST1RQ049122EBI-311073,EBI-2637518

Protein-protein interaction databases

BioGridi111378. 6 interactions.
IntActiQ9ULL4. 11 interactions.
MINTiMINT-2822157.
STRINGi9606.ENSP00000355378.

Structurei

3D structure databases

ProteinModelPortaliQ9ULL4.
SMRiQ9ULL4. Positions 1325-1903.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 471427Sema
Add
BLAST
Domaini473 – 52654PSI 1
Add
BLAST
Domaini620 – 68263PSI 2
Add
BLAST
Domaini787 – 83347PSI 3
Add
BLAST
Domaini835 – 92591IPT/TIG 1
Add
BLAST
Domaini927 – 101286IPT/TIG 2
Add
BLAST
Domaini1015 – 1145131IPT/TIG 3
Add
BLAST
Domaini1159 – 124486IPT/TIG 4
Add
BLAST

Sequence similaritiesi

Belongs to the plexin family.
Contains 4 IPT/TIG domains.
Contains 3 PSI domains.
Contains 1 Sema domain.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG254546.
HOVERGENiHBG053404.
InParanoidiQ9ULL4.
KOiK06821.
OMAiCGDEHTP.
PhylomeDBiQ9ULL4.
TreeFamiTF312962.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 5 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 3 hits.
[Graphical view]
SMARTiSM00429. IPT. 3 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 5 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ULL4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP     50
NTTLNHLALA PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP 100
FRDPAECPQA QLTDNANQLL LVSSRAQELV ACGQVRQGVC ETRRLGDVAE 150
VLYQAEDPGD GQFVAANTPG VATVGLVVPL PGRDLLLVAR GLAGKLSAGV 200
PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD ARSAYFVFRR 250
RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL 300
GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE 350
YGVTSRCVTL PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV 400
AALQADGHMI AFLGDTQGQL YKVFLHGSQG QVYHSQQVGP PGSAISPDLL 450
LDSSGSHLYV LTAHQVDRIP VAACPQFPDC ASCLQAQDPL CGWCVLQGRC 500
TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE QGQVTLSVPR 550
LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV 600
PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS 650
HCVYGEHCPE GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH 700
LALRVRNLQH FRGLPASFHC WLELPGELRG LPATLEETAG DSGLIHCQAH 750
QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA LYVILYDCAM GHPDCSHCQA 800
ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV EPLTGPPEGG 850
LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN 900
GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ 950
HLQTGGNTSA FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA 1000
QRTLLASPFR YTANPQLVAA EPSASFRGGG RLIRVRGTGL DVVQRPLLSV 1050
WLEADAEVQA SRAQPQDPQP RRSCGAPAAD PQACIQLGGG LLQCSTVCSV 1100
NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ GFLYQPNPRL 1150
APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL 1200
TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF 1250
PVEAQAGVGM GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG 1300
VGDQCRKEFT DLMTEMTDLS SDLEGSGIPF LDYRTYAERA FFPGHGGCPL 1350
QPKPEGPGED GHCATVRQGL TQLSNLLNSK LFLLTLIHTL EEQPSFSQRD 1400
RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK LMLRRTETMV 1450
EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT 1500
LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ 1550
VKEKVLDQVY KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH 1600
WKRLNTLQHY KVPDGATVGL VPQLHRGSTI SQSLAQRCPL GENIPTLEDG 1650
EEGGVCLWHL VKATEEPEGA KVRCSSLRER EPARAKAIPE IYLTRLLSMK 1700
GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG IEDPGTLHIW 1750
KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK 1800
VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG 1850
NYTSAPHCLE ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA 1900
LVENKVTDL 1909
Length:1,909
Mass (Da):206,847
Last modified:August 31, 2004 - v2
Checksum:i11753CD58C7AC226
GO
Isoform 2 (identifier: Q9ULL4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

Show »
Length:1,932
Mass (Da):209,301
Checksum:iBA26AFFF478B979B
GO

Sequence cautioni

The sequence BAA86520.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti126 – 1261A → T.
Corresponds to variant rs34360382 [ dbSNP | Ensembl ].
VAR_050601
Natural varianti598 – 5981V → I.1 Publication
Corresponds to variant rs2266879 [ dbSNP | Ensembl ].
VAR_019681
Natural varianti1156 – 11561E → D.1 Publication
Corresponds to variant rs6643791 [ dbSNP | Ensembl ].
VAR_061538
Natural varianti1535 – 15351M → T.1 Publication
Corresponds to variant rs5987155 [ dbSNP | Ensembl ].
VAR_019682
Natural varianti1651 – 16511E → A.
Corresponds to variant rs34762690 [ dbSNP | Ensembl ].
VAR_068807

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1515MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2.
VSP_044467Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti149 – 1491A → V in BAH12182. 1 Publication
Sequence conflicti300 – 3001L → P in BAH12182. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149019 mRNA. Translation: AAG01376.1.
AB033032 mRNA. Translation: BAA86520.1. Different initiation.
AK295762 mRNA. Translation: BAH12182.1.
U52111 Genomic DNA. No translation available.
CCDSiCCDS14729.1. [Q9ULL4-1]
CCDS55536.1. [Q9ULL4-2]
RefSeqiNP_001156729.1. NM_001163257.1. [Q9ULL4-2]
NP_005384.2. NM_005393.2. [Q9ULL4-1]
UniGeneiHs.632833.

Genome annotation databases

EnsembliENST00000361971; ENSP00000355378; ENSG00000198753. [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753. [Q9ULL4-2]
ENST00000593339; ENSP00000472730; ENSG00000268591. [Q9ULL4-1]
ENST00000596875; ENSP00000472712; ENSG00000268591. [Q9ULL4-2]
GeneIDi5365.
KEGGihsa:5365.
UCSCiuc004fii.2. human. [Q9ULL4-1]
uc010nuk.2. human. [Q9ULL4-2]

Polymorphism databases

DMDMi51701857.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149019 mRNA. Translation: AAG01376.1 .
AB033032 mRNA. Translation: BAA86520.1 . Different initiation.
AK295762 mRNA. Translation: BAH12182.1 .
U52111 Genomic DNA. No translation available.
CCDSi CCDS14729.1. [Q9ULL4-1 ]
CCDS55536.1. [Q9ULL4-2 ]
RefSeqi NP_001156729.1. NM_001163257.1. [Q9ULL4-2 ]
NP_005384.2. NM_005393.2. [Q9ULL4-1 ]
UniGenei Hs.632833.

3D structure databases

ProteinModelPortali Q9ULL4.
SMRi Q9ULL4. Positions 1325-1903.
ModBasei Search...

Protein-protein interaction databases

BioGridi 111378. 6 interactions.
IntActi Q9ULL4. 11 interactions.
MINTi MINT-2822157.
STRINGi 9606.ENSP00000355378.

PTM databases

PhosphoSitei Q9ULL4.

Polymorphism databases

DMDMi 51701857.

Proteomic databases

PaxDbi Q9ULL4.
PRIDEi Q9ULL4.

Protocols and materials databases

DNASUi 5365.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361971 ; ENSP00000355378 ; ENSG00000198753 . [Q9ULL4-1 ]
ENST00000538966 ; ENSP00000442736 ; ENSG00000198753 . [Q9ULL4-2 ]
ENST00000593339 ; ENSP00000472730 ; ENSG00000268591 . [Q9ULL4-1 ]
ENST00000596875 ; ENSP00000472712 ; ENSG00000268591 . [Q9ULL4-2 ]
GeneIDi 5365.
KEGGi hsa:5365.
UCSCi uc004fii.2. human. [Q9ULL4-1 ]
uc010nuk.2. human. [Q9ULL4-2 ]

Organism-specific databases

CTDi 5365.
GeneCardsi GC0XP153029.
H-InvDB HIX0093726.
HGNCi HGNC:9105. PLXNB3.
HPAi HPA000230.
MIMi 300214. gene.
neXtProti NX_Q9ULL4.
PharmGKBi PA33431.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254546.
HOVERGENi HBG053404.
InParanoidi Q9ULL4.
KOi K06821.
OMAi CGDEHTP.
PhylomeDBi Q9ULL4.
TreeFami TF312962.

Enzyme and pathway databases

Reactomei REACT_19200. Other semaphorin interactions.
SignaLinki Q9ULL4.

Miscellaneous databases

ChiTaRSi PLXNB3. human.
GeneWikii PLXNB3.
GenomeRNAii 5365.
NextBioi 20796.
PROi Q9ULL4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9ULL4.
Bgeei Q9ULL4.
CleanExi HS_PLXNB3.
Genevestigatori Q9ULL4.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
2.60.40.10. 5 hits.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
Pfami PF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 3 hits.
[Graphical view ]
SMARTi SM00429. IPT. 3 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view ]
SUPFAMi SSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 5 hits.
PROSITEi PS51004. SEMA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of the new human plexin family member, plexin related protein."
    Veske A., Michelson P., Finckh U., Gal A.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-598; ASP-1156 AND THR-1535.
    Tissue: Hippocampus.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Interplay between scatter factor receptors and B plexins controls invasive growth."
    Conrotto P., Corso S., Gamberini S., Comoglio P.M., Giordano S.
    Oncogene 23:5131-5137(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MET AND MST1R.
  6. Cited for: FUNCTION, SUBCELLULAR LOCATION.
  7. "Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin."
    Hartwig C., Veske A., Krejcova S., Rosenberger G., Finckh U.
    BMC Neurosci. 6:53-53(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. "Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase."
    Li X., Lee A.Y.
    J. Biol. Chem. 285:32436-32445(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  9. "Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton."
    Li X., Law J.W., Lee A.Y.
    Oncogene 31:595-610(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH FSCN1, TISSUE SPECIFICITY.

Entry informationi

Entry nameiPLXB3_HUMAN
AccessioniPrimary (citable) accession number: Q9ULL4
Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: September 3, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi