Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULL4

- PLXB3_HUMAN

UniProt

Q9ULL4 - PLXB3_HUMAN

Protein

Plexin-B3

Gene

PLXNB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 2 (31 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.3 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein domain specific binding Source: UniProtKB
    3. semaphorin receptor activity Source: UniProtKB

    GO - Biological processi

    1. axon guidance Source: Reactome
    2. cell chemotaxis Source: UniProtKB
    3. negative regulation of cell adhesion Source: UniProtKB
    4. negative regulation of cell migration Source: UniProtKB
    5. negative regulation of GTPase activity Source: UniProtKB
    6. negative regulation of lamellipodium assembly Source: UniProtKB
    7. positive chemotaxis Source: UniProtKB
    8. positive regulation of endothelial cell proliferation Source: UniProtKB
    9. semaphorin-plexin signaling pathway Source: UniProtKB

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_19200. Other semaphorin interactions.
    SignaLinkiQ9ULL4.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Plexin-B3
    Gene namesi
    Name:PLXNB3
    Synonyms:KIAA1206, PLXN6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:9105. PLXNB3.

    Subcellular locationi

    Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications
    Note: Colocalizes with RIT2/RIN at the plasma membrane.

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. intracellular Source: InterPro
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33431.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4444Sequence AnalysisAdd
    BLAST
    Chaini45 – 19091865Plexin-B3PRO_0000024674Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi51 – 511N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi98 ↔ 107PROSITE-ProRule annotation
    Disulfide bondi132 ↔ 140PROSITE-ProRule annotation
    Glycosylationi231 – 2311N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi267 ↔ 370PROSITE-ProRule annotation
    Disulfide bondi283 ↔ 315PROSITE-ProRule annotation
    Disulfide bondi333 ↔ 357PROSITE-ProRule annotation
    Disulfide bondi474 ↔ 491PROSITE-ProRule annotation
    Disulfide bondi480 ↔ 525PROSITE-ProRule annotation
    Disulfide bondi483 ↔ 500PROSITE-ProRule annotation
    Disulfide bondi494 ↔ 506PROSITE-ProRule annotation
    Disulfide bondi562 ↔ 580PROSITE-ProRule annotation
    Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi802 – 8021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi900 – 9001N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi957 – 9571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1101 – 11011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1218 – 12181N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9ULL4.
    PRIDEiQ9ULL4.

    PTM databases

    PhosphoSiteiQ9ULL4.

    Expressioni

    Tissue specificityi

    Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines.3 Publications

    Gene expression databases

    ArrayExpressiQ9ULL4.
    BgeeiQ9ULL4.
    CleanExiHS_PLXNB3.
    GenevestigatoriQ9ULL4.

    Organism-specific databases

    HPAiHPA000230.

    Interactioni

    Subunit structurei

    Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA By similarity. Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain).By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    FSCN1Q166582EBI-311073,EBI-351076
    METP085812EBI-311073,EBI-1039152
    MST1RQ049122EBI-311073,EBI-2637518

    Protein-protein interaction databases

    BioGridi111378. 6 interactions.
    IntActiQ9ULL4. 11 interactions.
    MINTiMINT-2822157.
    STRINGi9606.ENSP00000355378.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULL4.
    SMRiQ9ULL4. Positions 1325-1903.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini45 – 12551211ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1277 – 1909633CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1256 – 127621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini45 – 471427SemaPROSITE-ProRule annotationAdd
    BLAST
    Domaini473 – 52654PSI 1Add
    BLAST
    Domaini620 – 68263PSI 2Add
    BLAST
    Domaini787 – 83347PSI 3Add
    BLAST
    Domaini835 – 92591IPT/TIG 1Add
    BLAST
    Domaini927 – 101286IPT/TIG 2Add
    BLAST
    Domaini1015 – 1145131IPT/TIG 3Add
    BLAST
    Domaini1159 – 124486IPT/TIG 4Add
    BLAST

    Sequence similaritiesi

    Belongs to the plexin family.Curated
    Contains 4 IPT/TIG domains.Curated
    Contains 3 PSI domains.Curated
    Contains 1 Sema domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG254546.
    HOVERGENiHBG053404.
    InParanoidiQ9ULL4.
    KOiK06821.
    OMAiCGDEHTP.
    PhylomeDBiQ9ULL4.
    TreeFamiTF312962.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    2.60.40.10. 5 hits.
    InterProiIPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR016201. Plexin-like_fold.
    IPR013548. Plexin_cytoplasmic_RasGAP_dom.
    IPR002165. Plexin_repeat.
    IPR008936. Rho_GTPase_activation_prot.
    IPR001627. Semap_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view]
    PfamiPF08337. Plexin_cytopl. 1 hit.
    PF01437. PSI. 1 hit.
    PF01403. Sema. 1 hit.
    PF01833. TIG. 3 hits.
    [Graphical view]
    SMARTiSM00429. IPT. 3 hits.
    SM00423. PSI. 3 hits.
    SM00630. Sema. 1 hit.
    [Graphical view]
    SUPFAMiSSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 1 hit.
    SSF48350. SSF48350. 2 hits.
    SSF81296. SSF81296. 5 hits.
    PROSITEiPS51004. SEMA. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ULL4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP     50
    NTTLNHLALA PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP 100
    FRDPAECPQA QLTDNANQLL LVSSRAQELV ACGQVRQGVC ETRRLGDVAE 150
    VLYQAEDPGD GQFVAANTPG VATVGLVVPL PGRDLLLVAR GLAGKLSAGV 200
    PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD ARSAYFVFRR 250
    RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL 300
    GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE 350
    YGVTSRCVTL PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV 400
    AALQADGHMI AFLGDTQGQL YKVFLHGSQG QVYHSQQVGP PGSAISPDLL 450
    LDSSGSHLYV LTAHQVDRIP VAACPQFPDC ASCLQAQDPL CGWCVLQGRC 500
    TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE QGQVTLSVPR 550
    LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV 600
    PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS 650
    HCVYGEHCPE GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH 700
    LALRVRNLQH FRGLPASFHC WLELPGELRG LPATLEETAG DSGLIHCQAH 750
    QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA LYVILYDCAM GHPDCSHCQA 800
    ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV EPLTGPPEGG 850
    LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN 900
    GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ 950
    HLQTGGNTSA FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA 1000
    QRTLLASPFR YTANPQLVAA EPSASFRGGG RLIRVRGTGL DVVQRPLLSV 1050
    WLEADAEVQA SRAQPQDPQP RRSCGAPAAD PQACIQLGGG LLQCSTVCSV 1100
    NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ GFLYQPNPRL 1150
    APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL 1200
    TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF 1250
    PVEAQAGVGM GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG 1300
    VGDQCRKEFT DLMTEMTDLS SDLEGSGIPF LDYRTYAERA FFPGHGGCPL 1350
    QPKPEGPGED GHCATVRQGL TQLSNLLNSK LFLLTLIHTL EEQPSFSQRD 1400
    RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK LMLRRTETMV 1450
    EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT 1500
    LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ 1550
    VKEKVLDQVY KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH 1600
    WKRLNTLQHY KVPDGATVGL VPQLHRGSTI SQSLAQRCPL GENIPTLEDG 1650
    EEGGVCLWHL VKATEEPEGA KVRCSSLRER EPARAKAIPE IYLTRLLSMK 1700
    GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG IEDPGTLHIW 1750
    KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK 1800
    VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG 1850
    NYTSAPHCLE ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA 1900
    LVENKVTDL 1909
    Length:1,909
    Mass (Da):206,847
    Last modified:August 31, 2004 - v2
    Checksum:i11753CD58C7AC226
    GO
    Isoform 2 (identifier: Q9ULL4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

    Show »
    Length:1,932
    Mass (Da):209,301
    Checksum:iBA26AFFF478B979B
    GO

    Sequence cautioni

    The sequence BAA86520.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti149 – 1491A → V in BAH12182. (PubMed:14702039)Curated
    Sequence conflicti300 – 3001L → P in BAH12182. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti126 – 1261A → T.
    Corresponds to variant rs34360382 [ dbSNP | Ensembl ].
    VAR_050601
    Natural varianti598 – 5981V → I.1 Publication
    Corresponds to variant rs2266879 [ dbSNP | Ensembl ].
    VAR_019681
    Natural varianti1156 – 11561E → D.1 Publication
    Corresponds to variant rs6643791 [ dbSNP | Ensembl ].
    VAR_061538
    Natural varianti1535 – 15351M → T.1 Publication
    Corresponds to variant rs5987155 [ dbSNP | Ensembl ].
    VAR_019682
    Natural varianti1651 – 16511E → A.
    Corresponds to variant rs34762690 [ dbSNP | Ensembl ].
    VAR_068807

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1515MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2. 1 PublicationVSP_044467Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149019 mRNA. Translation: AAG01376.1.
    AB033032 mRNA. Translation: BAA86520.1. Different initiation.
    AK295762 mRNA. Translation: BAH12182.1.
    U52111 Genomic DNA. No translation available.
    CCDSiCCDS14729.1. [Q9ULL4-1]
    CCDS55536.1. [Q9ULL4-2]
    RefSeqiNP_001156729.1. NM_001163257.1. [Q9ULL4-2]
    NP_005384.2. NM_005393.2. [Q9ULL4-1]
    UniGeneiHs.632833.

    Genome annotation databases

    EnsembliENST00000361971; ENSP00000355378; ENSG00000198753. [Q9ULL4-1]
    ENST00000538966; ENSP00000442736; ENSG00000198753. [Q9ULL4-2]
    GeneIDi5365.
    KEGGihsa:5365.
    UCSCiuc004fii.2. human. [Q9ULL4-1]
    uc010nuk.2. human. [Q9ULL4-2]

    Polymorphism databases

    DMDMi51701857.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149019 mRNA. Translation: AAG01376.1 .
    AB033032 mRNA. Translation: BAA86520.1 . Different initiation.
    AK295762 mRNA. Translation: BAH12182.1 .
    U52111 Genomic DNA. No translation available.
    CCDSi CCDS14729.1. [Q9ULL4-1 ]
    CCDS55536.1. [Q9ULL4-2 ]
    RefSeqi NP_001156729.1. NM_001163257.1. [Q9ULL4-2 ]
    NP_005384.2. NM_005393.2. [Q9ULL4-1 ]
    UniGenei Hs.632833.

    3D structure databases

    ProteinModelPortali Q9ULL4.
    SMRi Q9ULL4. Positions 1325-1903.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111378. 6 interactions.
    IntActi Q9ULL4. 11 interactions.
    MINTi MINT-2822157.
    STRINGi 9606.ENSP00000355378.

    PTM databases

    PhosphoSitei Q9ULL4.

    Polymorphism databases

    DMDMi 51701857.

    Proteomic databases

    PaxDbi Q9ULL4.
    PRIDEi Q9ULL4.

    Protocols and materials databases

    DNASUi 5365.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361971 ; ENSP00000355378 ; ENSG00000198753 . [Q9ULL4-1 ]
    ENST00000538966 ; ENSP00000442736 ; ENSG00000198753 . [Q9ULL4-2 ]
    GeneIDi 5365.
    KEGGi hsa:5365.
    UCSCi uc004fii.2. human. [Q9ULL4-1 ]
    uc010nuk.2. human. [Q9ULL4-2 ]

    Organism-specific databases

    CTDi 5365.
    GeneCardsi GC0XP153029.
    H-InvDB HIX0093726.
    HGNCi HGNC:9105. PLXNB3.
    HPAi HPA000230.
    MIMi 300214. gene.
    neXtProti NX_Q9ULL4.
    PharmGKBi PA33431.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG254546.
    HOVERGENi HBG053404.
    InParanoidi Q9ULL4.
    KOi K06821.
    OMAi CGDEHTP.
    PhylomeDBi Q9ULL4.
    TreeFami TF312962.

    Enzyme and pathway databases

    Reactomei REACT_19200. Other semaphorin interactions.
    SignaLinki Q9ULL4.

    Miscellaneous databases

    ChiTaRSi PLXNB3. human.
    GeneWikii PLXNB3.
    GenomeRNAii 5365.
    NextBioi 20796.
    PROi Q9ULL4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULL4.
    Bgeei Q9ULL4.
    CleanExi HS_PLXNB3.
    Genevestigatori Q9ULL4.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    2.60.40.10. 5 hits.
    InterProi IPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR016201. Plexin-like_fold.
    IPR013548. Plexin_cytoplasmic_RasGAP_dom.
    IPR002165. Plexin_repeat.
    IPR008936. Rho_GTPase_activation_prot.
    IPR001627. Semap_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view ]
    Pfami PF08337. Plexin_cytopl. 1 hit.
    PF01437. PSI. 1 hit.
    PF01403. Sema. 1 hit.
    PF01833. TIG. 3 hits.
    [Graphical view ]
    SMARTi SM00429. IPT. 3 hits.
    SM00423. PSI. 3 hits.
    SM00630. Sema. 1 hit.
    [Graphical view ]
    SUPFAMi SSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 1 hit.
    SSF48350. SSF48350. 2 hits.
    SSF81296. SSF81296. 5 hits.
    PROSITEi PS51004. SEMA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the new human plexin family member, plexin related protein."
      Veske A., Michelson P., Finckh U., Gal A.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-598; ASP-1156 AND THR-1535.
      Tissue: Hippocampus.
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Interplay between scatter factor receptors and B plexins controls invasive growth."
      Conrotto P., Corso S., Gamberini S., Comoglio P.M., Giordano S.
      Oncogene 23:5131-5137(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MET AND MST1R.
    6. Cited for: FUNCTION, SUBCELLULAR LOCATION.
    7. "Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin."
      Hartwig C., Veske A., Krejcova S., Rosenberger G., Finckh U.
      BMC Neurosci. 6:53-53(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    8. "Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase."
      Li X., Lee A.Y.
      J. Biol. Chem. 285:32436-32445(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    9. "Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton."
      Li X., Law J.W., Lee A.Y.
      Oncogene 31:595-610(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH FSCN1, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiPLXB3_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULL4
    Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 31, 2004
    Last sequence update: August 31, 2004
    Last modified: October 1, 2014
    This is version 115 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3