Q9ULL4 (PLXB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Plexin-B3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1909 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1. Ref.6 Ref.8 Ref.9 |
| Subunit structure | Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA By similarity. Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain). Ref.5 Ref.7 Ref.9 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Note: Colocalizes with RIT2/RIN at the plasma membrane. Ref.6 Ref.7 |
| Tissue specificity | Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines. Ref.7 Ref.8 Ref.9 |
| Sequence similarities | Belongs to the plexin family. Contains 4 IPT/TIG domains. Contains 3 PSI domains. Contains 1 Sema domain. |
| Sequence caution | The sequence BAA86520.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Neurogenesis |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | axon guidance Traceable author statement. Source: Reactome signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW intracellularInferred from electronic annotation. Source: InterPro plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FSCN1 | Q16658 | 2 | EBI-311073,EBI-351076 | |
| MET | P08581 | 2 | EBI-311073,EBI-1039152 | |
| MST1R | Q04912 | 2 | EBI-311073,EBI-2637518 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ULL4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ULL4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 44 | 44 | Potential | ||||||||
| Chain | 45 – 1909 | 1865 | Plexin-B3 | PRO_0000024674 | |||||||
Regions | |||||||||||
| Topological domain | 45 – 1255 | 1211 | Extracellular Potential | ||||||||
| Transmembrane | 1256 – 1276 | 21 | Helical; Potential | ||||||||
| Topological domain | 1277 – 1909 | 633 | Cytoplasmic Potential | ||||||||
| Domain | 45 – 471 | 427 | Sema | ||||||||
| Domain | 473 – 526 | 54 | PSI 1 | ||||||||
| Domain | 620 – 682 | 63 | PSI 2 | ||||||||
| Domain | 787 – 833 | 47 | PSI 3 | ||||||||
| Domain | 835 – 925 | 91 | IPT/TIG 1 | ||||||||
| Domain | 927 – 1012 | 86 | IPT/TIG 2 | ||||||||
| Domain | 1015 – 1145 | 131 | IPT/TIG 3 | ||||||||
| Domain | 1159 – 1244 | 86 | IPT/TIG 4 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 51 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 231 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 615 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 802 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 900 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 957 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1101 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1218 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 98 ↔ 107 | By similarity | |||||||||
| Disulfide bond | 132 ↔ 140 | By similarity | |||||||||
| Disulfide bond | 267 ↔ 370 | By similarity | |||||||||
| Disulfide bond | 283 ↔ 315 | By similarity | |||||||||
| Disulfide bond | 333 ↔ 357 | By similarity | |||||||||
| Disulfide bond | 474 ↔ 491 | By similarity | |||||||||
| Disulfide bond | 480 ↔ 525 | By similarity | |||||||||
| Disulfide bond | 483 ↔ 500 | By similarity | |||||||||
| Disulfide bond | 494 ↔ 506 | By similarity | |||||||||
| Disulfide bond | 562 ↔ 580 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 15 | 15 | MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2. | VSP_044467 | |||||||
| Natural variant | 126 | 1 | A → T. Corresponds to variant rs34360382 [ dbSNP | Ensembl ]. | VAR_050601 | |||||||
| Natural variant | 598 | 1 | V → I. Ref.3 Corresponds to variant rs2266879 [ dbSNP | Ensembl ]. | VAR_019681 | |||||||
| Natural variant | 1156 | 1 | E → D. Ref.3 Corresponds to variant rs6643791 [ dbSNP | Ensembl ]. | VAR_061538 | |||||||
| Natural variant | 1535 | 1 | M → T. Ref.3 Corresponds to variant rs5987155 [ dbSNP | Ensembl ]. | VAR_019682 | |||||||
| Natural variant | 1651 | 1 | E → A. Corresponds to variant rs34762690 [ dbSNP | Ensembl ]. | VAR_068807 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 149 | 1 | A → V in BAH12182. Ref.3 | ||||||||
| Sequence conflict | 300 | 1 | L → P in BAH12182. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the new human plexin family member, plexin related protein." Veske A., Michelson P., Finckh U., Gal A. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-598; ASP-1156 AND THR-1535. Tissue: Hippocampus. |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Interplay between scatter factor receptors and B plexins controls invasive growth." Conrotto P., Corso S., Gamberini S., Comoglio P.M., Giordano S. Oncogene 23:5131-5137(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MET AND MST1R. |
| [6] | "Plexin-B3 is a functional receptor for semaphorin 5A." Artigiani S., Conrotto P., Fazzari P., Gilestro G.F., Barberis D., Giordano S., Comoglio P.M., Tamagnone L. EMBO Rep. 5:710-714(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [7] | "Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin." Hartwig C., Veske A., Krejcova S., Rosenberger G., Finckh U. BMC Neurosci. 6:53-53(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase." Li X., Lee A.Y. J. Biol. Chem. 285:32436-32445(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [9] | "Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton." Li X., Law J.W., Lee A.Y. Oncogene 31:595-610(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH FSCN1, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF149019 mRNA. Translation: AAG01376.1. AB033032 mRNA. Translation: BAA86520.1. Different initiation. AK295762 mRNA. Translation: BAH12182.1. U52111 Genomic DNA. No translation available. |
| IPI | IPI00155729. IPI00943863. |
| RefSeq | NP_001156729.1. NM_001163257.1. NP_005384.2. NM_005393.2. |
| UniGene | Hs.632833. |
3D structure databases | |
| ProteinModelPortal | Q9ULL4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9ULL4. 10 interactions. |
| MINT | MINT-2822157. |
| STRING | 9606.ENSP00000355378. |
PTM databases | |
| PhosphoSite | Q9ULL4. |
Polymorphism databases | |
| DMDM | 51701857. |
Proteomic databases | |
| PaxDb | Q9ULL4. |
| PRIDE | Q9ULL4. |
Protocols and materials databases | |
| DNASU | 5365. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361971; ENSP00000355378; ENSG00000198753. ENST00000538966; ENSP00000442736; ENSG00000198753. ENST00000593339; ENSP00000472730; ENSG00000268591. ENST00000596875; ENSP00000472712; ENSG00000268591. |
| GeneID | 5365. |
| KEGG | hsa:5365. |
| UCSC | uc004fii.2. human. |
Organism-specific databases | |
| CTD | 5365. |
| GeneCards | GC0XP153029. |
| H-InvDB | HIX0093726. |
| HGNC | HGNC:9105. PLXNB3. |
| HPA | HPA000230. |
| MIM | 300214. gene. |
| neXtProt | NX_Q9ULL4. |
| PharmGKB | PA33431. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG254546. |
| HOVERGEN | HBG053404. |
| InParanoid | Q9ULL4. |
| KO | K06821. |
| OMA | WRCHWCP. |
| OrthoDB | EOG49GKFP. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q9ULL4. |
| Bgee | Q9ULL4. |
| CleanEx | HS_PLXNB3. |
| Genevestigator | Q9ULL4. |
| GermOnline | ENSG00000198753. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. 2.60.40.10. 5 hits. |
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR003659. Plexin-like. IPR016201. Plexin-like_fold. IPR013548. Plexin_cytoplasmic_RasGAP_dom. IPR002165. Plexin_repeat. IPR008936. Rho_GTPase_activation_prot. IPR001627. Semaphorin/CD100_Ag. IPR015943. WD40/YVTN_repeat-like_dom. [Graphical view] |
| Pfam | PF08337. Plexin_cytopl. 1 hit. PF01437. PSI. 1 hit. PF01403. Sema. 1 hit. PF01833. TIG. 3 hits. [Graphical view] |
| SMART | SM00429. IPT. 3 hits. SM00423. PSI. 3 hits. SM00630. Sema. 1 hit. [Graphical view] |
| SUPFAM | SSF81296. Ig_E-set. 4 hits. SSF103575. Plexin-like_fold. 1 hit. SSF48350. Rho_GAP. 1 hit. SSF101912. Sema. 1 hit. |
| PROSITE | PS51004. SEMA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PLXNB3. human. |
| GenomeRNAi | 5365. |
| NextBio | 20796. |
| SOURCE | Search... |
Entry information
| Entry name | PLXB3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULL4 Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
