Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ULL4 (PLXB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Plexin-B3
Gene names
Name:PLXNB3
Synonyms:KIAA1206, PLXN6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1909 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca2+/Mg2+-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1. Ref.6 Ref.8 Ref.9

Subunit structure

Interacts (via cytoplasmic domain) with RAC1 and ARHGDIA By similarity. Binds MET and MST1R. Interacts (via cytoplasmic domain) with FSCN1. Interacts with RIT2/RIN. May form homodimers (via Sema domain). Ref.5 Ref.7 Ref.9

Subcellular location

Cell membrane; Single-pass type I membrane protein. Note: Colocalizes with RIT2/RIN at the plasma membrane. Ref.6 Ref.7

Tissue specificity

Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and placenta, with weak expression detected also in lung and kidney. Expressed in several glioma cell lines. Ref.7 Ref.8 Ref.9

Sequence similarities

Belongs to the plexin family.

Contains 4 IPT/TIG domains.

Contains 3 PSI domains.

Contains 1 Sema domain.

Sequence caution

The sequence BAA86520.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Biological processNeurogenesis
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processaxon guidance

Traceable author statement. Source: Reactome

negative regulation of GTPase activity

Inferred from mutant phenotype Ref.8. Source: UniProtKB

negative regulation of cell adhesion

Inferred from direct assay Ref.6. Source: UniProtKB

negative regulation of cell migration

Inferred from mutant phenotype Ref.8. Source: UniProtKB

negative regulation of lamellipodium assembly

Inferred from sequence or structural similarity. Source: UniProtKB

positive chemotaxis

Inferred from direct assay Ref.6. Source: UniProtKB

positive regulation of endothelial cell proliferation

Inferred from mutant phenotype PubMed 19850054. Source: UniProtKB

signal transduction

Inferred from electronic annotation. Source: InterPro

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

intracellular

Inferred from electronic annotation. Source: InterPro

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionprotein binding

Inferred from physical interaction Ref.5Ref.9. Source: IntAct

protein domain specific binding

Inferred from physical interaction Ref.6. Source: UniProtKB

receptor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ULL4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ULL4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MCHAAQETPLLHHFM → MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 4444 Potential
Chain45 – 19091865Plexin-B3
PRO_0000024674

Regions

Topological domain45 – 12551211Extracellular Potential
Transmembrane1256 – 127621Helical; Potential
Topological domain1277 – 1909633Cytoplasmic Potential
Domain45 – 471427Sema
Domain473 – 52654PSI 1
Domain620 – 68263PSI 2
Domain787 – 83347PSI 3
Domain835 – 92591IPT/TIG 1
Domain927 – 101286IPT/TIG 2
Domain1015 – 1145131IPT/TIG 3
Domain1159 – 124486IPT/TIG 4

Amino acid modifications

Glycosylation511N-linked (GlcNAc...) Potential
Glycosylation2311N-linked (GlcNAc...) Potential
Glycosylation6151N-linked (GlcNAc...) Potential
Glycosylation8021N-linked (GlcNAc...) Potential
Glycosylation9001N-linked (GlcNAc...) Potential
Glycosylation9571N-linked (GlcNAc...) Potential
Glycosylation11011N-linked (GlcNAc...) Potential
Glycosylation12181N-linked (GlcNAc...) Potential
Disulfide bond98 ↔ 107 By similarity
Disulfide bond132 ↔ 140 By similarity
Disulfide bond267 ↔ 370 By similarity
Disulfide bond283 ↔ 315 By similarity
Disulfide bond333 ↔ 357 By similarity
Disulfide bond474 ↔ 491 By similarity
Disulfide bond480 ↔ 525 By similarity
Disulfide bond483 ↔ 500 By similarity
Disulfide bond494 ↔ 506 By similarity
Disulfide bond562 ↔ 580 By similarity

Natural variations

Alternative sequence1 – 1515MCHAA…LHHFM → MELTPASSLTCSLLSPRLPG SFPQLRRVPPCSRPWLPK in isoform 2.
VSP_044467
Natural variant1261A → T.
Corresponds to variant rs34360382 [ dbSNP | Ensembl ].
VAR_050601
Natural variant5981V → I. Ref.3
Corresponds to variant rs2266879 [ dbSNP | Ensembl ].
VAR_019681
Natural variant11561E → D. Ref.3
Corresponds to variant rs6643791 [ dbSNP | Ensembl ].
VAR_061538
Natural variant15351M → T. Ref.3
Corresponds to variant rs5987155 [ dbSNP | Ensembl ].
VAR_019682
Natural variant16511E → A.
Corresponds to variant rs34762690 [ dbSNP | Ensembl ].
VAR_068807

Experimental info

Sequence conflict1491A → V in BAH12182. Ref.3
Sequence conflict3001L → P in BAH12182. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 31, 2004. Version 2.
Checksum: 11753CD58C7AC226

FASTA1,909206,847
        10         20         30         40         50         60 
MCHAAQETPL LHHFMAPVMA RWPPFGLCLL LLLLSPPPLP LTGAHRFSAP NTTLNHLALA 

        70         80         90        100        110        120 
PGRGTLYVGA VNRLFQLSPE LQLEAVAVTG PVIDSPDCVP FRDPAECPQA QLTDNANQLL 

       130        140        150        160        170        180 
LVSSRAQELV ACGQVRQGVC ETRRLGDVAE VLYQAEDPGD GQFVAANTPG VATVGLVVPL 

       190        200        210        220        230        240 
PGRDLLLVAR GLAGKLSAGV PPLAIRQLAG SQPFSSEGLG RLVVGDFSDY NNSYVGAFAD 

       250        260        270        280        290        300 
ARSAYFVFRR RGARAQAEYR SYVARVCLGD TNLYSYVEVP LACQGQGLIQ AAFLAPGTLL 

       310        320        330        340        350        360 
GVFAAGPRGT QAALCAFPMV ELGASMEQAR RLCYTAGGRG PSGAEEATVE YGVTSRCVTL 

       370        380        390        400        410        420 
PLDSPESYPC GDEHTPSPIA GRQPLEVQPL LKLGQPVSAV AALQADGHMI AFLGDTQGQL 

       430        440        450        460        470        480 
YKVFLHGSQG QVYHSQQVGP PGSAISPDLL LDSSGSHLYV LTAHQVDRIP VAACPQFPDC 

       490        500        510        520        530        540 
ASCLQAQDPL CGWCVLQGRC TRKGQCGRAG QLNQWLWSYE EDSHCLHIQS LLPGHHPRQE 

       550        560        570        580        590        600 
QGQVTLSVPR LPILDADEYF HCAFGDYDSL AHVEGPHVAC VTPPQDQVPL NPPGTDHVTV 

       610        620        630        640        650        660 
PLALMFEDVT VAATNFSFYD CSAVQALEAA APCRACVGSI WRCHWCPQSS HCVYGEHCPE 

       670        680        690        700        710        720 
GERTIYSAQE VDIQVRGPGA CPQVEGLAGP HLVPVGWESH LALRVRNLQH FRGLPASFHC 

       730        740        750        760        770        780 
WLELPGELRG LPATLEETAG DSGLIHCQAH QFYPSMSQRE LPVPIYVTQG EAQRLDNTHA 

       790        800        810        820        830        840 
LYVILYDCAM GHPDCSHCQA ANRSLGCLWC ADGQPACRYG PLCPPGAVEL LCPAPSIDAV 

       850        860        870        880        890        900 
EPLTGPPEGG LALTILGSNL GRAFADVQYA VSVASRPCNP EPSLYRTSAR IVCVTSPAPN 

       910        920        930        940        950        960 
GTTGPVRVAI KSQPPGISSQ HFTYQDPVLL SLSPRWGPQA GGTQLTIRGQ HLQTGGNTSA 

       970        980        990       1000       1010       1020 
FVGGQPCPIL EPVCPEAIVC RTRPQAAPGE AAVLVVFGHA QRTLLASPFR YTANPQLVAA 

      1030       1040       1050       1060       1070       1080 
EPSASFRGGG RLIRVRGTGL DVVQRPLLSV WLEADAEVQA SRAQPQDPQP RRSCGAPAAD 

      1090       1100       1110       1120       1130       1140 
PQACIQLGGG LLQCSTVCSV NSSSLLLCRS PAVPDRAHPQ RVFFTLDNVQ VDFASASGGQ 

      1150       1160       1170       1180       1190       1200 
GFLYQPNPRL APLSREGPAR PYRLKPGHVL DVEGEGLNLG ISKEEVRVHI GRGECLVKTL 

      1210       1220       1230       1240       1250       1260 
TRTHLYCEPP AHAPQPANGS GLPQFVVQMG NVQLALGPVQ YEAEPPLSAF PVEAQAGVGM 

      1270       1280       1290       1300       1310       1320 
GAAVLIAAVL LLTLMYRHKS KQALRDYQKV LVQLESLETG VGDQCRKEFT DLMTEMTDLS 

      1330       1340       1350       1360       1370       1380 
SDLEGSGIPF LDYRTYAERA FFPGHGGCPL QPKPEGPGED GHCATVRQGL TQLSNLLNSK 

      1390       1400       1410       1420       1430       1440 
LFLLTLIHTL EEQPSFSQRD RCHVASLLSL ALHGKLEYLT DIMRTLLGDL AAHYVHRNPK 

      1450       1460       1470       1480       1490       1500 
LMLRRTETMV EKLLTNWLSI CLYAFLREVA GEPLYMLFRA IQYQVDKGPV DAVTGKAKRT 

      1510       1520       1530       1540       1550       1560 
LNDSRLLRED VEFQPLTLMV LVGPGAGGAA GSSEMQRVPA RVLDTDTITQ VKEKVLDQVY 

      1570       1580       1590       1600       1610       1620 
KGTPFSQRPS VHALDLEWRS GLAGHLTLSD EDLTSVTQNH WKRLNTLQHY KVPDGATVGL 

      1630       1640       1650       1660       1670       1680 
VPQLHRGSTI SQSLAQRCPL GENIPTLEDG EEGGVCLWHL VKATEEPEGA KVRCSSLRER 

      1690       1700       1710       1720       1730       1740 
EPARAKAIPE IYLTRLLSMK GTLQKFVDDT FQAILSVNRP IPIAVKYLFD LLDELAEKHG 

      1750       1760       1770       1780       1790       1800 
IEDPGTLHIW KTNSLLLRFW VNALKNPQLI FDVRVSDNVD AILAVIAQTF IDSCTTSEHK 

      1810       1820       1830       1840       1850       1860 
VGRDSPVNKL LYAREIPRYK QMVERYYADI RQSSPASYQE MNSALAELSG NYTSAPHCLE 

      1870       1880       1890       1900 
ALQELYNHIH RYYDQIISAL EEDPVGQKLQ LACRLQQVAA LVENKVTDL 

« Hide

Isoform 2 [UniParc].

Checksum: BA26AFFF478B979B
Show »

FASTA1,932209,301

References

« Hide 'large scale' references
[1]"Cloning and characterization of the new human plexin family member, plexin related protein."
Veske A., Michelson P., Finckh U., Gal A.
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-598; ASP-1156 AND THR-1535.
Tissue: Hippocampus.
[4]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Interplay between scatter factor receptors and B plexins controls invasive growth."
Conrotto P., Corso S., Gamberini S., Comoglio P.M., Giordano S.
Oncogene 23:5131-5137(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MET AND MST1R.
[6]"Plexin-B3 is a functional receptor for semaphorin 5A."
Artigiani S., Conrotto P., Fazzari P., Gilestro G.F., Barberis D., Giordano S., Comoglio P.M., Tamagnone L.
EMBO Rep. 5:710-714(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[7]"Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin."
Hartwig C., Veske A., Krejcova S., Rosenberger G., Finckh U.
BMC Neurosci. 6:53-53(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[8]"Semaphorin 5A and plexin-B3 inhibit human glioma cell motility through RhoGDIalpha-mediated inactivation of Rac1 GTPase."
Li X., Lee A.Y.
J. Biol. Chem. 285:32436-32445(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[9]"Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton."
Li X., Law J.W., Lee A.Y.
Oncogene 31:595-610(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH FSCN1, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF149019 mRNA. Translation: AAG01376.1.
AB033032 mRNA. Translation: BAA86520.1. Different initiation.
AK295762 mRNA. Translation: BAH12182.1.
U52111 Genomic DNA. No translation available.
CCDSCCDS14729.1. [Q9ULL4-1]
CCDS55536.1. [Q9ULL4-2]
RefSeqNP_001156729.1. NM_001163257.1. [Q9ULL4-2]
NP_005384.2. NM_005393.2. [Q9ULL4-1]
UniGeneHs.632833.

3D structure databases

ProteinModelPortalQ9ULL4.
SMRQ9ULL4. Positions 1325-1903.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111378. 6 interactions.
IntActQ9ULL4. 11 interactions.
MINTMINT-2822157.
STRING9606.ENSP00000355378.

PTM databases

PhosphoSiteQ9ULL4.

Polymorphism databases

DMDM51701857.

Proteomic databases

PaxDbQ9ULL4.
PRIDEQ9ULL4.

Protocols and materials databases

DNASU5365.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000361971; ENSP00000355378; ENSG00000198753. [Q9ULL4-1]
ENST00000538966; ENSP00000442736; ENSG00000198753. [Q9ULL4-2]
ENST00000593339; ENSP00000472730; ENSG00000268591. [Q9ULL4-1]
ENST00000596875; ENSP00000472712; ENSG00000268591. [Q9ULL4-2]
GeneID5365.
KEGGhsa:5365.
UCSCuc004fii.2. human. [Q9ULL4-1]
uc010nuk.2. human. [Q9ULL4-2]

Organism-specific databases

CTD5365.
GeneCardsGC0XP153029.
H-InvDBHIX0093726.
HGNCHGNC:9105. PLXNB3.
HPAHPA000230.
MIM300214. gene.
neXtProtNX_Q9ULL4.
PharmGKBPA33431.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG254546.
HOVERGENHBG053404.
InParanoidQ9ULL4.
KOK06821.
OMACGDEHTP.
PhylomeDBQ9ULL4.
TreeFamTF312962.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
SignaLinkQ9ULL4.

Gene expression databases

ArrayExpressQ9ULL4.
BgeeQ9ULL4.
CleanExHS_PLXNB3.
GenevestigatorQ9ULL4.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
2.60.40.10. 5 hits.
InterProIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 3 hits.
[Graphical view]
SMARTSM00429. IPT. 3 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 5 hits.
PROSITEPS51004. SEMA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPLXNB3. human.
GeneWikiPLXNB3.
GenomeRNAi5365.
NextBio20796.
PROQ9ULL4.
SOURCESearch...

Entry information

Entry namePLXB3_HUMAN
AccessionPrimary (citable) accession number: Q9ULL4
Secondary accession number(s): B7Z3E6, F5H773, Q9HDA4
Entry history
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: July 9, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM