Q9ULJ1 (ODF2L_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Outer dense fiber protein 2-like | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 636 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the ODF2 family. |
| Sequence caution | The sequence AAH29420.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence AAH47368.1 differs from that shown. Reason: Erroneous termination at position 397. Translated as Glu. The sequence AK308351 differs from that shown. Reason: Frameshift at position 296. The sequence BAA86543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | centrosome Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ULJ1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ULJ1-2) The sequence of this isoform differs from the canonical sequence as follows: 454-506: Missing. 632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE | ||||||
| Isoform 3 (identifier: Q9ULJ1-3) The sequence of this isoform differs from the canonical sequence as follows: 353-381: Missing. 506-506: Q → QILKQWEEYSVLAW | ||||||
| Isoform 4 (identifier: Q9ULJ1-4) The sequence of this isoform differs from the canonical sequence as follows: 353-381: Missing. 632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE | ||||||
| Isoform 5 (identifier: Q9ULJ1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-131: Missing. 353-381: Missing. 632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 636 | 636 | Outer dense fiber protein 2-like | PRO_0000308909 | |||||
Regions | |||||||||
| Coiled coil | 36 – 97 | 62 | Potential | ||||||
| Coiled coil | 141 – 220 | 80 | Potential | ||||||
| Coiled coil | 249 – 325 | 77 | Potential | ||||||
| Coiled coil | 377 – 484 | 108 | Potential | ||||||
| Coiled coil | 519 – 631 | 113 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 131 | 131 | Missing in isoform 5. | VSP_040930 | |||||
| Alternative sequence | 353 – 381 | 29 | Missing in isoform 3, isoform 4 and isoform 5. | VSP_029057 | |||||
| Alternative sequence | 454 – 506 | 53 | Missing in isoform 2. | VSP_029058 | |||||
| Alternative sequence | 506 | 1 | Q → QILKQWEEYSVLAW in isoform 3. | VSP_029059 | |||||
| Alternative sequence | 632 – 636 | 5 | DPETP → KAQHQEVCLKEVQNSLEKSE NQNESIKNYLQFLKTSYVTM FE in isoform 2, isoform 4 and isoform 5. | VSP_029060 | |||||
| Natural variant | 177 | 1 | R → H. Corresponds to variant rs12032435 [ dbSNP | Ensembl ]. | VAR_036882 | |||||
| Natural variant | 350 | 1 | K → R. Ref.5 Corresponds to variant rs17854440 [ dbSNP | Ensembl ]. | VAR_036883 | |||||
Experimental info | |||||||||
| Sequence conflict | 135 | 1 | E → G in AAH47368. Ref.5 | ||||||
| Sequence conflict | 203 | 1 | L → S in AAH29420. Ref.5 | ||||||
| Sequence conflict | 339 | 1 | Y → H in BAA86543. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed: 10574462] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-350. Tissue: Brain, Pituitary and Prostate. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-402 (ISOFORM 5). Tissue: Thymus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB033055 mRNA. Translation: BAA86543.1. Different initiation. CR591511 mRNA. No translation available. AL136382, AC119749 Genomic DNA. Translation: CAI23513.1. AL136382, AC119749 Genomic DNA. Translation: CAI23514.1. CH471097 Genomic DNA. Translation: EAW73190.1. CH471097 Genomic DNA. Translation: EAW73192.1. BC029420 mRNA. Translation: AAH29420.1. Sequence problems. BC047368 mRNA. Translation: AAH47368.1. Sequence problems. BC091490 mRNA. Translation: AAH91490.1. AK308351 mRNA. No translation available. |
| IPI | IPI00008135. IPI00478622. IPI00556188. IPI00737794. IPI00984018. |
| RefSeq | NP_001007023.2. NM_001007022.2. NP_001171694.1. NM_001184765.1. NP_001171695.1. NM_001184766.1. NP_065780.2. NM_020729.2. |
| UniGene | Hs.149360. |
3D structure databases | |
| ProteinModelPortal | Q9ULJ1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9ULJ1. 25 interactions. |
PTM databases | |
| PhosphoSite | Q9ULJ1. |
Polymorphism databases | |
| DMDM | 160013283. |
Proteomic databases | |
| PRIDE | Q9ULJ1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359242; ENSP00000359600; ENSG00000122417. ENST00000449149; ENSP00000394525; ENSG00000122417. |
| GeneID | 57489. |
| KEGG | hsa:57489. |
| NMPDR | fig|9606.3.peg.1443. |
| UCSC | uc001dll.1. human. uc001dlm.1. human. uc001dlp.1. human. |
Organism-specific databases | |
| CTD | 57489. |
| GeneCards | GC01M086808. |
| HGNC | HGNC:29225. ODF2L. |
| HPA | HPA028020. HPA028095. HPA028333. |
| neXtProt | NX_Q9ULJ1. |
| PharmGKB | PA142671232. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00530000063497. |
| HOVERGEN | HBG054948. |
| OMA | QIRDQEA. |
| OrthoDB | EOG4F4S9Q. |
Gene expression databases | |
| ArrayExpress | Q9ULJ1. |
| Bgee | Q9ULJ1. |
| CleanEx | HS_ODF2L. |
| Genevestigator | Q9ULJ1. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 63772. |
Entry information
| Entry name | ODF2L_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULJ1 Secondary accession number(s): A8MU56 Q86X31 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with