Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Outer dense fiber protein 2-like

Gene

ODF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Outer dense fiber protein 2-like
Gene namesi
Name:ODF2L
Synonyms:KIAA1229
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29225. ODF2L.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671232.

Polymorphism and mutation databases

BioMutaiODF2L.
DMDMi160013283.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 636636Outer dense fiber protein 2-likePRO_0000308909Add
BLAST

Proteomic databases

EPDiQ9ULJ1.
MaxQBiQ9ULJ1.
PaxDbiQ9ULJ1.
PRIDEiQ9ULJ1.

PTM databases

iPTMnetiQ9ULJ1.
PhosphoSiteiQ9ULJ1.

Expressioni

Gene expression databases

BgeeiQ9ULJ1.
CleanExiHS_ODF2L.
ExpressionAtlasiQ9ULJ1. baseline and differential.
GenevisibleiQ9ULJ1. HS.

Organism-specific databases

HPAiHPA028020.
HPA028095.
HPA028333.

Interactioni

Protein-protein interaction databases

BioGridi121557. 16 interactions.
IntActiQ9ULJ1. 28 interactions.
STRINGi9606.ENSP00000359600.

Structurei

3D structure databases

ProteinModelPortaliQ9ULJ1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili36 – 9762Sequence analysisAdd
BLAST
Coiled coili141 – 22080Sequence analysisAdd
BLAST
Coiled coili249 – 32577Sequence analysisAdd
BLAST
Coiled coili377 – 484108Sequence analysisAdd
BLAST
Coiled coili519 – 631113Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the ODF2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJHH. Eukaryota.
ENOG410YEYY. LUCA.
GeneTreeiENSGT00530000063497.
HOVERGENiHBG054948.
InParanoidiQ9ULJ1.
OMAiFLKTSYV.
OrthoDBiEOG780RKV.
PhylomeDBiQ9ULJ1.
TreeFamiTF328605.

Family and domain databases

InterProiIPR026102. Odf2-like.
IPR026099. Odf2-rel.
[Graphical view]
PANTHERiPTHR23162. PTHR23162. 2 hits.
PTHR23162:SF7. PTHR23162:SF7. 2 hits.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULJ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKAVNDGSH SEELFCHLKT ISEKEDLPRC TSESHLSCLK QDILNEKTEL
60 70 80 90 100
EATLKEAELV THSVELLLPL FKDTIEKINF ENANLSALNL KISEQKEILI
110 120 130 140 150
KELDTFKSVK LALEHLLRKR DYKQTGDNLS SMLLENLTDN ESENTNLKKK
160 170 180 190 200
VFEKEAHIQE LSCLFQSEKA NTLKANRFSQ SVKVVHERLQ IQIHKREAEN
210 220 230 240 250
DKLKEYVKSL ETKIAKWNLQ SRMNKNEAIV MKEASRQKTV ALKKASKVYK
260 270 280 290 300
QRLDHFTGAI EKLTSQIRDQ EAKLSETISA SNAWKSHYEK IVIEKTELEV
310 320 330 340 350
QIETMKKQII NLLEDLKKME DHGKNSCEEI LRKVHSIEYE NETLNLENTK
360 370 380 390 400
LKLRFPCRIT ESKNMNILIV LDMLCYISSE KTTLAALKDE VVSVENELSE
410 420 430 440 450
LQEVEKKQKT LIEMYKTQVQ KLQEAAEIVK SRCENLLHKN NQITKTKNKN
460 470 480 490 500
VEKMRGQMES HLKELERVCD SLTAAERRLH ECQESLQCCK GKCADQEHTI
510 520 530 540 550
RELQGQVDGN HNLLTKLSLE EENCLIQLKC ENLQQKLEQM DAENKELEKK
560 570 580 590 600
LANQEECLKH SNLKFKEKSA EYTALARQLE AALEEGRQKV AEEIEKMSSR
610 620 630
ESALQIKILD LETELRKKNE EQNQLVCKMN SDPETP
Length:636
Mass (Da):73,728
Last modified:October 23, 2007 - v2
Checksum:iD74FAB4F22F21581
GO
Isoform 2 (identifier: Q9ULJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:620
Mass (Da):72,053
Checksum:i08EEED881F4457B5
GO
Isoform 3 (identifier: Q9ULJ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     506-506: Q → QILKQWEEYSVLAW

Show »
Length:620
Mass (Da):71,962
Checksum:i10437F28D20EAB06
GO
Isoform 4 (identifier: Q9ULJ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:644
Mass (Da):74,765
Checksum:iC7F94FF7790D8FF1
GO
Isoform 5 (identifier: Q9ULJ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.
     353-381: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Show »
Length:513
Mass (Da):59,803
Checksum:i056290F9824311AD
GO
Isoform 6 (identifier: Q9ULJ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-381: Missing.
     454-506: Missing.
     632-636: DPETP → KAQHQEVCLKEVQNSLEKSENQNESIKNYLQFLKTSYVTMFE

Note: No experimental confirmation available.
Show »
Length:591
Mass (Da):68,639
Checksum:iCEB4025EB317F8FD
GO

Sequence cautioni

The sequence AAH29420.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH47368.1 differs from that shown. Reason: Erroneous termination at position 397. Translated as Glu.Curated
The sequence AK308351 differs from that shown. Reason: Frameshift at position 296. Curated
The sequence BAA86543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti135 – 1351E → G in AAH47368 (PubMed:15489334).Curated
Sequence conflicti203 – 2031L → S in AAH29420 (PubMed:15489334).Curated
Sequence conflicti339 – 3391Y → H in BAA86543 (PubMed:10574462).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti177 – 1771R → H.
Corresponds to variant rs12032435 [ dbSNP | Ensembl ].
VAR_036882
Natural varianti350 – 3501K → R.1 Publication
Corresponds to variant rs17854440 [ dbSNP | Ensembl ].
VAR_036883

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 131131Missing in isoform 5. 1 PublicationVSP_040930Add
BLAST
Alternative sequencei353 – 38129Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_029057Add
BLAST
Alternative sequencei454 – 50653Missing in isoform 2 and isoform 6. 2 PublicationsVSP_029058Add
BLAST
Alternative sequencei506 – 5061Q → QILKQWEEYSVLAW in isoform 3. 1 PublicationVSP_029059
Alternative sequencei632 – 6365DPETP → KAQHQEVCLKEVQNSLEKSE NQNESIKNYLQFLKTSYVTM FE in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_029060

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033055 mRNA. Translation: BAA86543.1. Different initiation.
AK303209 mRNA. Translation: BAG64299.1.
AK308351 mRNA. No translation available.
CR591511 mRNA. No translation available.
AL136382, AC119749 Genomic DNA. Translation: CAI23513.1.
AL136382, AC119749 Genomic DNA. Translation: CAI23514.1.
CH471097 Genomic DNA. Translation: EAW73190.1.
CH471097 Genomic DNA. Translation: EAW73192.1.
BC029420 mRNA. Translation: AAH29420.1. Sequence problems.
BC047368 mRNA. Translation: AAH47368.1. Sequence problems.
BC091490 mRNA. Translation: AAH91490.1.
CCDSiCCDS30763.2. [Q9ULJ1-3]
CCDS41354.2. [Q9ULJ1-1]
CCDS53339.1. [Q9ULJ1-6]
RefSeqiNP_001007023.2. NM_001007022.2. [Q9ULJ1-1]
NP_001171694.1. NM_001184765.1. [Q9ULJ1-2]
NP_001171695.1. NM_001184766.1. [Q9ULJ1-6]
NP_065780.2. NM_020729.2. [Q9ULJ1-3]
XP_005271111.1. XM_005271054.2. [Q9ULJ1-4]
XP_011540121.1. XM_011541819.1. [Q9ULJ1-1]
UniGeneiHs.149360.

Genome annotation databases

EnsembliENST00000294678; ENSP00000294678; ENSG00000122417. [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417. [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417. [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417. [Q9ULJ1-6]
GeneIDi57489.
KEGGihsa:57489.
UCSCiuc001dll.3. human. [Q9ULJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033055 mRNA. Translation: BAA86543.1. Different initiation.
AK303209 mRNA. Translation: BAG64299.1.
AK308351 mRNA. No translation available.
CR591511 mRNA. No translation available.
AL136382, AC119749 Genomic DNA. Translation: CAI23513.1.
AL136382, AC119749 Genomic DNA. Translation: CAI23514.1.
CH471097 Genomic DNA. Translation: EAW73190.1.
CH471097 Genomic DNA. Translation: EAW73192.1.
BC029420 mRNA. Translation: AAH29420.1. Sequence problems.
BC047368 mRNA. Translation: AAH47368.1. Sequence problems.
BC091490 mRNA. Translation: AAH91490.1.
CCDSiCCDS30763.2. [Q9ULJ1-3]
CCDS41354.2. [Q9ULJ1-1]
CCDS53339.1. [Q9ULJ1-6]
RefSeqiNP_001007023.2. NM_001007022.2. [Q9ULJ1-1]
NP_001171694.1. NM_001184765.1. [Q9ULJ1-2]
NP_001171695.1. NM_001184766.1. [Q9ULJ1-6]
NP_065780.2. NM_020729.2. [Q9ULJ1-3]
XP_005271111.1. XM_005271054.2. [Q9ULJ1-4]
XP_011540121.1. XM_011541819.1. [Q9ULJ1-1]
UniGeneiHs.149360.

3D structure databases

ProteinModelPortaliQ9ULJ1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121557. 16 interactions.
IntActiQ9ULJ1. 28 interactions.
STRINGi9606.ENSP00000359600.

PTM databases

iPTMnetiQ9ULJ1.
PhosphoSiteiQ9ULJ1.

Polymorphism and mutation databases

BioMutaiODF2L.
DMDMi160013283.

Proteomic databases

EPDiQ9ULJ1.
MaxQBiQ9ULJ1.
PaxDbiQ9ULJ1.
PRIDEiQ9ULJ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294678; ENSP00000294678; ENSG00000122417. [Q9ULJ1-3]
ENST00000317336; ENSP00000320165; ENSG00000122417. [Q9ULJ1-1]
ENST00000359242; ENSP00000359600; ENSG00000122417. [Q9ULJ1-1]
ENST00000370566; ENSP00000359597; ENSG00000122417. [Q9ULJ1-6]
GeneIDi57489.
KEGGihsa:57489.
UCSCiuc001dll.3. human. [Q9ULJ1-1]

Organism-specific databases

CTDi57489.
GeneCardsiODF2L.
HGNCiHGNC:29225. ODF2L.
HPAiHPA028020.
HPA028095.
HPA028333.
neXtProtiNX_Q9ULJ1.
PharmGKBiPA142671232.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJHH. Eukaryota.
ENOG410YEYY. LUCA.
GeneTreeiENSGT00530000063497.
HOVERGENiHBG054948.
InParanoidiQ9ULJ1.
OMAiFLKTSYV.
OrthoDBiEOG780RKV.
PhylomeDBiQ9ULJ1.
TreeFamiTF328605.

Miscellaneous databases

GenomeRNAii57489.
NextBioi63772.
PROiQ9ULJ1.

Gene expression databases

BgeeiQ9ULJ1.
CleanExiHS_ODF2L.
ExpressionAtlasiQ9ULJ1. baseline and differential.
GenevisibleiQ9ULJ1. HS.

Family and domain databases

InterProiIPR026102. Odf2-like.
IPR026099. Odf2-rel.
[Graphical view]
PANTHERiPTHR23162. PTHR23162. 2 hits.
PTHR23162:SF7. PTHR23162:SF7. 2 hits.
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-402 (ISOFORM 5).
    Tissue: Thymus.
  3. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Placenta.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-350.
    Tissue: Brain, Pituitary and Prostate.

Entry informationi

Entry nameiODF2L_HUMAN
AccessioniPrimary (citable) accession number: Q9ULJ1
Secondary accession number(s): A8MU56
, B4E037, Q05C40, Q5BJG5, Q5TBX3, Q5TBX4, Q86X31
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: April 13, 2016
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.