SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULH7

- MKL2_HUMAN

UniProt

Q9ULH7 - MKL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
MKL/myocardin-like protein 2
Gene
MKL2, KIAA1243, MRTFB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei394 – 3941Breakpoint for translocation to form C11orf95-MLK2 fusion protein

GO - Molecular functioni

  1. nucleic acid binding Source: InterPro
  2. protein binding Source: UniProtKB
  3. sequence-specific DNA binding transcription factor activity Source: Ensembl
  4. transcription coactivator activity Source: UniProtKB

GO - Biological processi

  1. blood vessel morphogenesis Source: Ensembl
  2. cardiac muscle tissue development Source: Ensembl
  3. embryonic organ development Source: Ensembl
  4. heart morphogenesis Source: Ensembl
  5. in utero embryonic development Source: Ensembl
  6. liver development Source: Ensembl
  7. muscle organ development Source: UniProtKB-KW
  8. positive regulation of striated muscle tissue development Source: UniProtKB
  9. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  10. smooth muscle cell differentiation Source: Ensembl
  11. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein

Keywords - Biological processi

Differentiation, Myogenesis, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
MKL/myocardin-like protein 2
Alternative name(s):
Megakaryoblastic leukemia 2
Myocardin-related transcription factor B
Short name:
MRTF-B
Gene namesi
Name:MKL2
Synonyms:KIAA1243, MRTFB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:29819. MKL2.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving C11orf95 is found in 3 chondroid lipomas. Translocation t(11;16)(q13;p13) with C11orf95 produces a C11orf95-MKL2 fusion protein (1 Publication).

Organism-specific databases

PharmGKBiPA134981329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10881088MKL/myocardin-like protein 2
PRO_0000126628Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei66 – 661Phosphoserine1 Publication
Modified residuei367 – 3671Phosphothreonine1 Publication
Modified residuei370 – 3701Phosphothreonine1 Publication
Modified residuei541 – 5411Phosphoserine1 Publication
Modified residuei921 – 9211Phosphoserine1 Publication

Post-translational modificationi

O-glycosylated By similarity.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9ULH7.
PaxDbiQ9ULH7.
PRIDEiQ9ULH7.

PTM databases

PhosphoSiteiQ9ULH7.

Miscellaneous databases

PMAP-CutDBQ9ULH7.

Expressioni

Gene expression databases

ArrayExpressiQ9ULH7.
BgeeiQ9ULH7.
CleanExiHS_MKL2.
GenevestigatoriQ9ULH7.

Organism-specific databases

HPAiHPA011286.

Interactioni

Subunit structurei

Interacts with MKL1 and SRF.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SRFP118313EBI-493007,EBI-493034

Protein-protein interaction databases

BioGridi121563. 10 interactions.
IntActiQ9ULH7. 5 interactions.
MINTiMINT-1190534.
STRINGi9606.ENSP00000339086.

Structurei

3D structure databases

ProteinModelPortaliQ9ULH7.
SMRiQ9ULH7. Positions 39-151, 376-424.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati40 – 6526RPEL 1
Add
BLAST
Repeati84 – 10926RPEL 2
Add
BLAST
Repeati128 – 15326RPEL 3
Add
BLAST
Domaini389 – 42335SAP
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni563 – 59129Required for interaction with itself and with MKL1
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili545 – 60157 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi671 – 787117Gln-rich
Add
BLAST

Domaini

The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity By similarity.

Sequence similaritiesi

Contains 3 RPEL repeats.
Contains 1 SAP domain.

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiNOG82832.
HOVERGENiHBG036493.
InParanoidiQ9ULH7.
PhylomeDBiQ9ULH7.
TreeFamiTF326024.

Family and domain databases

Gene3Di1.10.720.30. 1 hit.
InterProiIPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view]
PfamiPF02755. RPEL. 3 hits.
PF02037. SAP. 1 hit.
[Graphical view]
SMARTiSM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view]
PROSITEiPS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ULH7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIDSSKKQQQ GFPEILTAGD FEPLKEKECL EGSNQKSLKE VLQLRLQQRR     50
TREQLVDQGI MPPLKSPAAF HEQIKSLERA RTENFLKHKI RSRPDRSELV 100
RMHILEETFA EPSLQATQMK LKRARLADDL NEKIAQRPGP MELVEKNILP 150
VDSSVKEAII GVGKEDYPHT QGDFSFDEDS SDALSPDQPA SQESQGSAAS 200
PSEPKVSESP SPVTTNTPAQ FASVSPTVPE FLKTPPTADQ PPPRPAAPVL 250
PTNTVSSAKP GPALVKQSHP KNPNDKHRSK KCKDPKPRVK KLKYHQYIPP 300
DQKGEKNEPQ MDSNYARLLQ QQQLFLQLQI LSQQKQHYNY QTILPAPFKP 350
LNDKNSNSGN SALNNATPNT PRQNTSTPVR KPGPLPSSLD DLKVSELKTE 400
LKLRGLPVSG TKPDLIERLK PYQEVNSSGL AAGGIVAVSS SAIVTSNPEV 450
TVALPVTTLH NTVTSSVSTL KAELPPTGTS NATRVENVHS PLPISPSPSE 500
QSSLSTDDTN MADTFTEIMT MMSPSQFLSS SPLRMTNNED SLSPTSSTLS 550
NLELDAAEKD RKLQEKEKQI EELKRKLEQE QKLVEVLKMQ LEVEKRGQQQ 600
RPLEAQPSAP GHSVKSDQKH GSLGSSIKDE ASLPDCSSSR QPIPVASHAV 650
GQPVSTGGQT LVAKKAVVIK QEVPVGQAEQ QSVVSQFYVS SQGQPPPAVV 700
AQPQALLTTQ TAQLLLPVSI QGSSVTSVQL PVGSLKLQTS PQAGMQTQPQ 750
IATAAQIPTA ALASGLAPTV PQTQDTFPQH VLSQPQQVRK VFTNSASSNT 800
VLPYQRHPAP AVQQPFINKA SNSVLQSRNA PLPSLQNGPN TPNKPSSPPP 850
PQQFVVQHSL FGSPVAKTKD PPRYEEAIKQ TRSTQAPLPE ISNAHSQQMD 900
DLFDILIKSG EISLPIKEEP SPISKMRPVT ASITTMPVNT VVSRPPPQVQ 950
MAPPVSLEPM GSLSASLENQ LEAFLDGTLP SANEIPPLQS SSEDREPFSL 1000
IEDLQNDLLS HSGMLDHSHS PMETSETQFA AGTPCLSLDL SDSNLDNMEW 1050
LDITMPNSSS GLTPLSTTAP SMFSADFLDP QDLPLPWD 1088
Length:1,088
Mass (Da):118,127
Last modified:June 27, 2003 - v3
Checksum:i0CA4A52A115C0C83
GO
Isoform 2 (identifier: Q9ULH7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEV → M
     350-418: PLNDKNSNSG...SGTKPDLIER → AYHTVSEVHM...VSSIIPGINS
     419-1088: Missing.

Note: No experimental confirmation available.

Show »
Length:378
Mass (Da):42,496
Checksum:i265D363A09230333
GO
Isoform 3 (identifier: Q9ULH7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-461: PLNDKNSNSG...VALPVTTLHN → YGGAHAILNA...VSSIIPGINS
     462-1088: Missing.

Note: No experimental confirmation available.

Show »
Length:461
Mass (Da):51,902
Checksum:i94540BFA3F4213AB
GO
Isoform 4 (identifier: Q9ULH7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN
     689-738: Missing.

Show »
Length:1,049
Mass (Da):114,119
Checksum:iE8DC053F48F8AA4F
GO
Isoform 5 (identifier: Q9ULH7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN

Show »
Length:1,099
Mass (Da):119,165
Checksum:i36FB8F1653F10868
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti390 – 3901D → G Found in a renal cell carcinoma sample; somatic mutation. 1 Publication
VAR_064732

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141MIDSS…SLKEV → M in isoform 2.
VSP_007653Add
BLAST
Alternative sequencei1 – 4040MIDSS…KSLKE → MDHTGAIDTEDEVGPLAHLA PSPQSEAVAHEFQELSLQSS QNLPPLNERKN in isoform 4 and isoform 5.
VSP_013355Add
BLAST
Alternative sequencei350 – 461112PLNDK…TTLHN → YGGAHAILNAGFSVVFMRNY KLPKVECCHLFVLSNDFHFF VIRAYHTVSEVHMVRVACIP FQFLSSKIGSEFLQVRNAFS QLFIQICLLLEHQNSTRCSE KSVSSIIPGINS in isoform 3.
VSP_007656Add
BLAST
Alternative sequencei350 – 41869PLNDK…DLIER → AYHTVSEVHMVRVACIPFQF LSSKIGSEFLQVRNAFSQLF IQICLLLEHQNSTRCSEKSV SSIIPGINS in isoform 2.
VSP_007654Add
BLAST
Alternative sequencei419 – 1088670Missing in isoform 2.
VSP_007655Add
BLAST
Alternative sequencei462 – 1088627Missing in isoform 3.
VSP_007657Add
BLAST
Alternative sequencei689 – 73850Missing in isoform 4.
VSP_013356Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti266 – 2661K → R in BAC04200. 1 Publication
Sequence conflicti350 – 3501P → A in AAQ82435. 1 Publication
Sequence conflicti592 – 5921E → G in CAH18657. 1 Publication
Sequence conflicti598 – 5981Q → R in AAQ82435. 1 Publication
Sequence conflicti629 – 6291D → G in AAQ82435. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY374297 mRNA. Translation: AAQ82435.1.
AK093577 mRNA. Translation: BAC04200.1.
AK294765 mRNA. Translation: BAG57899.1.
AC012626 Genomic DNA. No translation available.
AC040173 Genomic DNA. No translation available.
AC130650 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85112.1.
BC047761 mRNA. Translation: AAH47761.1.
BC136260 mRNA. Translation: AAI36261.1.
BC171750 mRNA. Translation: AAI71750.1.
AB033069 mRNA. Translation: BAA86557.2.
CR749797 mRNA. Translation: CAH18657.1.
CCDSiCCDS32391.1. [Q9ULH7-4]
RefSeqiNP_054767.3. NM_014048.3. [Q9ULH7-4]
XP_005255508.1. XM_005255451.2. [Q9ULH7-5]
XP_005255509.1. XM_005255452.2. [Q9ULH7-5]
XP_005255510.1. XM_005255453.2. [Q9ULH7-5]
XP_005255512.1. XM_005255455.2. [Q9ULH7-1]
XP_006720971.1. XM_006720908.1. [Q9ULH7-5]
XP_006720972.1. XM_006720909.1. [Q9ULH7-5]
XP_006720973.1. XM_006720910.1. [Q9ULH7-5]
XP_006720974.1. XM_006720911.1. [Q9ULH7-5]
XP_006720977.1. XM_006720914.1. [Q9ULH7-4]
UniGeneiHs.49143.

Genome annotation databases

EnsembliENST00000318282; ENSP00000339086; ENSG00000186260. [Q9ULH7-4]
ENST00000341243; ENSP00000345841; ENSG00000186260. [Q9ULH7-1]
ENST00000571589; ENSP00000459626; ENSG00000186260.
ENST00000573051; ENSP00000460589; ENSG00000186260. [Q9ULH7-2]
ENST00000574045; ENSP00000459205; ENSG00000186260. [Q9ULH7-4]
GeneIDi57496.
KEGGihsa:57496.
UCSCiuc002dcg.3. human. [Q9ULH7-4]
uc010uza.2. human.
uc010uzb.2. human. [Q9ULH7-2]

Polymorphism databases

DMDMi32363203.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY374297 mRNA. Translation: AAQ82435.1 .
AK093577 mRNA. Translation: BAC04200.1 .
AK294765 mRNA. Translation: BAG57899.1 .
AC012626 Genomic DNA. No translation available.
AC040173 Genomic DNA. No translation available.
AC130650 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85112.1 .
BC047761 mRNA. Translation: AAH47761.1 .
BC136260 mRNA. Translation: AAI36261.1 .
BC171750 mRNA. Translation: AAI71750.1 .
AB033069 mRNA. Translation: BAA86557.2 .
CR749797 mRNA. Translation: CAH18657.1 .
CCDSi CCDS32391.1. [Q9ULH7-4 ]
RefSeqi NP_054767.3. NM_014048.3. [Q9ULH7-4 ]
XP_005255508.1. XM_005255451.2. [Q9ULH7-5 ]
XP_005255509.1. XM_005255452.2. [Q9ULH7-5 ]
XP_005255510.1. XM_005255453.2. [Q9ULH7-5 ]
XP_005255512.1. XM_005255455.2. [Q9ULH7-1 ]
XP_006720971.1. XM_006720908.1. [Q9ULH7-5 ]
XP_006720972.1. XM_006720909.1. [Q9ULH7-5 ]
XP_006720973.1. XM_006720910.1. [Q9ULH7-5 ]
XP_006720974.1. XM_006720911.1. [Q9ULH7-5 ]
XP_006720977.1. XM_006720914.1. [Q9ULH7-4 ]
UniGenei Hs.49143.

3D structure databases

ProteinModelPortali Q9ULH7.
SMRi Q9ULH7. Positions 39-151, 376-424.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121563. 10 interactions.
IntActi Q9ULH7. 5 interactions.
MINTi MINT-1190534.
STRINGi 9606.ENSP00000339086.

PTM databases

PhosphoSitei Q9ULH7.

Polymorphism databases

DMDMi 32363203.

Proteomic databases

MaxQBi Q9ULH7.
PaxDbi Q9ULH7.
PRIDEi Q9ULH7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000318282 ; ENSP00000339086 ; ENSG00000186260 . [Q9ULH7-4 ]
ENST00000341243 ; ENSP00000345841 ; ENSG00000186260 . [Q9ULH7-1 ]
ENST00000571589 ; ENSP00000459626 ; ENSG00000186260 .
ENST00000573051 ; ENSP00000460589 ; ENSG00000186260 . [Q9ULH7-2 ]
ENST00000574045 ; ENSP00000459205 ; ENSG00000186260 . [Q9ULH7-4 ]
GeneIDi 57496.
KEGGi hsa:57496.
UCSCi uc002dcg.3. human. [Q9ULH7-4 ]
uc010uza.2. human.
uc010uzb.2. human. [Q9ULH7-2 ]

Organism-specific databases

CTDi 57496.
GeneCardsi GC16P014072.
H-InvDB HIX0012829.
HGNCi HGNC:29819. MKL2.
HPAi HPA011286.
MIMi 609463. gene.
neXtProti NX_Q9ULH7.
PharmGKBi PA134981329.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG82832.
HOVERGENi HBG036493.
InParanoidi Q9ULH7.
PhylomeDBi Q9ULH7.
TreeFami TF326024.

Miscellaneous databases

ChiTaRSi MKL2. human.
GeneWikii MKL2.
GenomeRNAii 57496.
NextBioi 35471837.
PMAP-CutDB Q9ULH7.
PROi Q9ULH7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9ULH7.
Bgeei Q9ULH7.
CleanExi HS_MKL2.
Genevestigatori Q9ULH7.

Family and domain databases

Gene3Di 1.10.720.30. 1 hit.
InterProi IPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view ]
Pfami PF02755. RPEL. 3 hits.
PF02037. SAP. 1 hit.
[Graphical view ]
SMARTi SM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view ]
PROSITEi PS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation."
    Selvaraj A., Prywes R.
    J. Biol. Chem. 278:41977-41987(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH MKL1 AND SRF.
    Tissue: Cervix carcinoma.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
    Tissue: Brain and Thymus.
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Tissue: Brain, Medulla oblongata and Testis.
  6. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1088 (ISOFORM 1).
    Tissue: Brain.
  7. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1088 (ISOFORM 1).
    Tissue: Amygdala.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66; THR-367; THR-370 AND SER-921, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma."
    Huang D., Sumegi J., Dal Cin P., Reith J.D., Yasuda T., Nelson M., Muirhead D., Bridge J.A.
    Genes Chromosomes Cancer 49:810-818(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHROMOSOMAL TRANSLOCATION WITH C11ORF95.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-541, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: VARIANT GLY-390.

Entry informationi

Entry nameiMKL2_HUMAN
AccessioniPrimary (citable) accession number: Q9ULH7
Secondary accession number(s): A6ND53
, B4DGT8, Q68CT1, Q6UB16, Q86WW2, Q8N226
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: June 27, 2003
Last modified: September 3, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi