Q9ULH7 (MKL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MKL/myocardin-like protein 2 Alternative name(s): Megakaryoblastic leukemia 2 Myocardin-related transcription factor B Short name=MRTF-B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1088 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation. Ref.1 |
| Subunit structure | Interacts with MKL1 and SRF. Ref.1 |
| Subcellular location | Nucleus By similarity. |
| Domain | The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity By similarity. |
| Post-translational modification | O-glycosylated By similarity. |
| Sequence similarities | Contains 3 RPEL repeats. Contains 1 SAP domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SRF | P11831 | 3 | EBI-493007,EBI-493034 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ULH7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ULH7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEV → M 350-418: PLNDKNSNSG...SGTKPDLIER → AYHTVSEVHM...VSSIIPGINS 419-1088: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9ULH7-3) The sequence of this isoform differs from the canonical sequence as follows: 350-461: PLNDKNSNSG...VALPVTTLHN → YGGAHAILNA...VSSIIPGINS 462-1088: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9ULH7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN 689-738: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1088 | 1088 | MKL/myocardin-like protein 2 | PRO_0000126628 | |||||
Regions | |||||||||
| Repeat | 40 – 65 | 26 | RPEL 1 | ||||||
| Repeat | 84 – 109 | 26 | RPEL 2 | ||||||
| Repeat | 128 – 153 | 26 | RPEL 3 | ||||||
| Domain | 389 – 423 | 35 | SAP | ||||||
| Region | 563 – 591 | 29 | Required for interaction with itself and with MKL1 | ||||||
| Coiled coil | 545 – 601 | 57 | Potential | ||||||
| Compositional bias | 671 – 787 | 117 | Gln-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 66 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 367 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 370 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 541 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 921 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MIDSS…SLKEV → M in isoform 2. | VSP_007653 | |||||
| Alternative sequence | 1 – 40 | 40 | MIDSS…KSLKE → MDHTGAIDTEDEVGPLAHLA PSPQSEAVAHEFQELSLQSS QNLPPLNERKN in isoform 4. | VSP_013355 | |||||
| Alternative sequence | 350 – 461 | 112 | PLNDK…TTLHN → YGGAHAILNAGFSVVFMRNY KLPKVECCHLFVLSNDFHFF VIRAYHTVSEVHMVRVACIP FQFLSSKIGSEFLQVRNAFS QLFIQICLLLEHQNSTRCSE KSVSSIIPGINS in isoform 3. | VSP_007656 | |||||
| Alternative sequence | 350 – 418 | 69 | PLNDK…DLIER → AYHTVSEVHMVRVACIPFQF LSSKIGSEFLQVRNAFSQLF IQICLLLEHQNSTRCSEKSV SSIIPGINS in isoform 2. | VSP_007654 | |||||
| Alternative sequence | 419 – 1088 | 670 | Missing in isoform 2. | VSP_007655 | |||||
| Alternative sequence | 462 – 1088 | 627 | Missing in isoform 3. | VSP_007657 | |||||
| Alternative sequence | 689 – 738 | 50 | Missing in isoform 4. | VSP_013356 | |||||
| Natural variant | 390 | 1 | D → G Found in a renal cell carcinoma sample; somatic mutation. Ref.12 | VAR_064732 | |||||
Experimental info | |||||||||
| Sequence conflict | 266 | 1 | K → R in BAC04200. Ref.2 | ||||||
| Sequence conflict | 350 | 1 | P → A in AAQ82435. Ref.1 | ||||||
| Sequence conflict | 592 | 1 | E → G in CAH18657. Ref.7 | ||||||
| Sequence conflict | 598 | 1 | Q → R in AAQ82435. Ref.1 | ||||||
| Sequence conflict | 629 | 1 | D → G in AAQ82435. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation." Selvaraj A., Prywes R. J. Biol. Chem. 278:41977-41987(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH MKL1 AND SRF. Tissue: Cervix carcinoma. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Thymus. |
| [3] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Medulla oblongata. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1088 (ISOFORM 1). Tissue: Brain. |
| [6] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1088 (ISOFORM 1). Tissue: Amygdala. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66; THR-367; THR-370 AND SER-921, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-541, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma." Varela I., Tarpey P., Raine K., Huang D., Ong C.K., Stephens P., Davies H., Jones D., Lin M.L., Teague J., Bignell G., Butler A., Cho J., Dalgliesh G.L., Galappaththige D., Greenman C., Hardy C., Jia M. Futreal P.A.Nature 469:539-542(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLY-390. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY374297 mRNA. Translation: AAQ82435.1. AK093577 mRNA. Translation: BAC04200.1. AC130650 Genomic DNA. No translation available. BC047761 mRNA. Translation: AAH47761.1. AB033069 mRNA. Translation: BAA86557.2. CR749797 mRNA. Translation: CAH18657.1. |
| IPI | IPI00329152. IPI00335641. IPI00335643. IPI00418489. |
| RefSeq | NP_054767.3. NM_014048.3. |
| UniGene | Hs.49143. |
3D structure databases | |
| ProteinModelPortal | Q9ULH7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9ULH7. 2 interactions. |
| MINT | MINT-1190534. |
| STRING | 9606.ENSP00000339086. |
PTM databases | |
| PhosphoSite | Q9ULH7. |
Polymorphism databases | |
| DMDM | 32363203. |
Proteomic databases | |
| PaxDb | Q9ULH7. |
| PRIDE | Q9ULH7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000318282; ENSP00000339086; ENSG00000186260. ENST00000341243; ENSP00000345841; ENSG00000186260. ENST00000573051; ENSP00000460589; ENSG00000186260. ENST00000574045; ENSP00000459205; ENSG00000186260. |
| GeneID | 57496. |
| KEGG | hsa:57496. |
| UCSC | uc002dcg.3. human. uc002dch.3. human. uc010uzb.2. human. |
Organism-specific databases | |
| CTD | 57496. |
| GeneCards | GC16P014072. |
| H-InvDB | HIX0012829. |
| HGNC | HGNC:29819. MKL2. |
| HPA | HPA011286. |
| MIM | 609463. gene. |
| neXtProt | NX_Q9ULH7. |
| PharmGKB | PA134981329. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG82832. |
| HOVERGEN | HBG036493. |
| InParanoid | Q9ULH7. |
| OMA | KQTRSAQ. |
Gene expression databases | |
| ArrayExpress | Q9ULH7. |
| Bgee | Q9ULH7. |
| CleanEx | HS_MKL2. |
| Genevestigator | Q9ULH7. |
| GermOnline | ENSG00000186260. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.720.30. 1 hit. |
| InterPro | IPR004018. RPEL_repeat. IPR003034. SAP_dom. [Graphical view] |
| Pfam | PF02755. RPEL. 3 hits. PF02037. SAP. 1 hit. [Graphical view] |
| SMART | SM00707. RPEL. 3 hits. SM00513. SAP. 1 hit. [Graphical view] |
| PROSITE | PS51073. RPEL. 3 hits. PS50800. SAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MKL2. human. |
| GenomeRNAi | 57496. |
| NextBio | 63808. |
| PMAP-CutDB | Q9ULH7. |
| SOURCE | Search... |
Entry information
| Entry name | MKL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULH7 Secondary accession number(s): A6ND53 Q8N226 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
