Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULH7

- MKL2_HUMAN

UniProt

Q9ULH7 - MKL2_HUMAN

Protein

MKL/myocardin-like protein 2

Gene

MKL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (27 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei394 – 3941Breakpoint for translocation to form C11orf95-MLK2 fusion protein

    GO - Molecular functioni

    1. nucleic acid binding Source: InterPro
    2. protein binding Source: UniProtKB
    3. sequence-specific DNA binding transcription factor activity Source: Ensembl
    4. transcription coactivator activity Source: UniProtKB

    GO - Biological processi

    1. blood vessel morphogenesis Source: Ensembl
    2. cardiac muscle tissue development Source: Ensembl
    3. embryonic organ development Source: Ensembl
    4. heart morphogenesis Source: Ensembl
    5. in utero embryonic development Source: Ensembl
    6. liver development Source: Ensembl
    7. muscle organ development Source: UniProtKB-KW
    8. positive regulation of striated muscle tissue development Source: UniProtKB
    9. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    10. smooth muscle cell differentiation Source: Ensembl
    11. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Developmental protein

    Keywords - Biological processi

    Differentiation, Myogenesis, Transcription, Transcription regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MKL/myocardin-like protein 2
    Alternative name(s):
    Megakaryoblastic leukemia 2
    Myocardin-related transcription factor B
    Short name:
    MRTF-B
    Gene namesi
    Name:MKL2
    Synonyms:KIAA1243, MRTFB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:29819. MKL2.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. cytoplasm Source: Ensembl
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving C11orf95 is found in 3 chondroid lipomas. Translocation t(11;16)(q13;p13) with C11orf95 produces a C11orf95-MKL2 fusion protein (PubMed:20607705).1 Publication

    Organism-specific databases

    PharmGKBiPA134981329.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10881088MKL/myocardin-like protein 2PRO_0000126628Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei66 – 661Phosphoserine1 Publication
    Modified residuei367 – 3671Phosphothreonine1 Publication
    Modified residuei370 – 3701Phosphothreonine1 Publication
    Modified residuei541 – 5411Phosphoserine1 Publication
    Modified residuei921 – 9211Phosphoserine1 Publication

    Post-translational modificationi

    O-glycosylated.By similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9ULH7.
    PaxDbiQ9ULH7.
    PRIDEiQ9ULH7.

    PTM databases

    PhosphoSiteiQ9ULH7.

    Miscellaneous databases

    PMAP-CutDBQ9ULH7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9ULH7.
    BgeeiQ9ULH7.
    CleanExiHS_MKL2.
    GenevestigatoriQ9ULH7.

    Organism-specific databases

    HPAiHPA011286.

    Interactioni

    Subunit structurei

    Interacts with MKL1 and SRF.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SRFP118313EBI-493007,EBI-493034

    Protein-protein interaction databases

    BioGridi121563. 10 interactions.
    IntActiQ9ULH7. 5 interactions.
    MINTiMINT-1190534.
    STRINGi9606.ENSP00000339086.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULH7.
    SMRiQ9ULH7. Positions 39-151, 376-424.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati40 – 6526RPEL 1Add
    BLAST
    Repeati84 – 10926RPEL 2Add
    BLAST
    Repeati128 – 15326RPEL 3Add
    BLAST
    Domaini389 – 42335SAPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni563 – 59129Required for interaction with itself and with MKL1Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili545 – 60157Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi671 – 787117Gln-richAdd
    BLAST

    Domaini

    The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity.By similarity

    Sequence similaritiesi

    Contains 3 RPEL repeats.PROSITE-ProRule annotation
    Contains 1 SAP domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiNOG82832.
    HOVERGENiHBG036493.
    InParanoidiQ9ULH7.
    PhylomeDBiQ9ULH7.
    TreeFamiTF326024.

    Family and domain databases

    Gene3Di1.10.720.30. 1 hit.
    InterProiIPR004018. RPEL_repeat.
    IPR003034. SAP_dom.
    [Graphical view]
    PfamiPF02755. RPEL. 3 hits.
    PF02037. SAP. 1 hit.
    [Graphical view]
    SMARTiSM00707. RPEL. 3 hits.
    SM00513. SAP. 1 hit.
    [Graphical view]
    PROSITEiPS51073. RPEL. 3 hits.
    PS50800. SAP. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ULH7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIDSSKKQQQ GFPEILTAGD FEPLKEKECL EGSNQKSLKE VLQLRLQQRR     50
    TREQLVDQGI MPPLKSPAAF HEQIKSLERA RTENFLKHKI RSRPDRSELV 100
    RMHILEETFA EPSLQATQMK LKRARLADDL NEKIAQRPGP MELVEKNILP 150
    VDSSVKEAII GVGKEDYPHT QGDFSFDEDS SDALSPDQPA SQESQGSAAS 200
    PSEPKVSESP SPVTTNTPAQ FASVSPTVPE FLKTPPTADQ PPPRPAAPVL 250
    PTNTVSSAKP GPALVKQSHP KNPNDKHRSK KCKDPKPRVK KLKYHQYIPP 300
    DQKGEKNEPQ MDSNYARLLQ QQQLFLQLQI LSQQKQHYNY QTILPAPFKP 350
    LNDKNSNSGN SALNNATPNT PRQNTSTPVR KPGPLPSSLD DLKVSELKTE 400
    LKLRGLPVSG TKPDLIERLK PYQEVNSSGL AAGGIVAVSS SAIVTSNPEV 450
    TVALPVTTLH NTVTSSVSTL KAELPPTGTS NATRVENVHS PLPISPSPSE 500
    QSSLSTDDTN MADTFTEIMT MMSPSQFLSS SPLRMTNNED SLSPTSSTLS 550
    NLELDAAEKD RKLQEKEKQI EELKRKLEQE QKLVEVLKMQ LEVEKRGQQQ 600
    RPLEAQPSAP GHSVKSDQKH GSLGSSIKDE ASLPDCSSSR QPIPVASHAV 650
    GQPVSTGGQT LVAKKAVVIK QEVPVGQAEQ QSVVSQFYVS SQGQPPPAVV 700
    AQPQALLTTQ TAQLLLPVSI QGSSVTSVQL PVGSLKLQTS PQAGMQTQPQ 750
    IATAAQIPTA ALASGLAPTV PQTQDTFPQH VLSQPQQVRK VFTNSASSNT 800
    VLPYQRHPAP AVQQPFINKA SNSVLQSRNA PLPSLQNGPN TPNKPSSPPP 850
    PQQFVVQHSL FGSPVAKTKD PPRYEEAIKQ TRSTQAPLPE ISNAHSQQMD 900
    DLFDILIKSG EISLPIKEEP SPISKMRPVT ASITTMPVNT VVSRPPPQVQ 950
    MAPPVSLEPM GSLSASLENQ LEAFLDGTLP SANEIPPLQS SSEDREPFSL 1000
    IEDLQNDLLS HSGMLDHSHS PMETSETQFA AGTPCLSLDL SDSNLDNMEW 1050
    LDITMPNSSS GLTPLSTTAP SMFSADFLDP QDLPLPWD 1088
    Length:1,088
    Mass (Da):118,127
    Last modified:June 27, 2003 - v3
    Checksum:i0CA4A52A115C0C83
    GO
    Isoform 2 (identifier: Q9ULH7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEV → M
         350-418: PLNDKNSNSG...SGTKPDLIER → AYHTVSEVHM...VSSIIPGINS
         419-1088: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:378
    Mass (Da):42,496
    Checksum:i265D363A09230333
    GO
    Isoform 3 (identifier: Q9ULH7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         350-461: PLNDKNSNSG...VALPVTTLHN → YGGAHAILNA...VSSIIPGINS
         462-1088: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:461
    Mass (Da):51,902
    Checksum:i94540BFA3F4213AB
    GO
    Isoform 4 (identifier: Q9ULH7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN
         689-738: Missing.

    Show »
    Length:1,049
    Mass (Da):114,119
    Checksum:iE8DC053F48F8AA4F
    GO
    Isoform 5 (identifier: Q9ULH7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN

    Show »
    Length:1,099
    Mass (Da):119,165
    Checksum:i36FB8F1653F10868
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti266 – 2661K → R in BAC04200. (PubMed:14702039)Curated
    Sequence conflicti350 – 3501P → A in AAQ82435. (PubMed:14565952)Curated
    Sequence conflicti592 – 5921E → G in CAH18657. (PubMed:17974005)Curated
    Sequence conflicti598 – 5981Q → R in AAQ82435. (PubMed:14565952)Curated
    Sequence conflicti629 – 6291D → G in AAQ82435. (PubMed:14565952)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti390 – 3901D → G Found in a renal cell carcinoma sample; somatic mutation. 1 Publication
    VAR_064732

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MIDSS…SLKEV → M in isoform 2. 1 PublicationVSP_007653Add
    BLAST
    Alternative sequencei1 – 4040MIDSS…KSLKE → MDHTGAIDTEDEVGPLAHLA PSPQSEAVAHEFQELSLQSS QNLPPLNERKN in isoform 4 and isoform 5. 3 PublicationsVSP_013355Add
    BLAST
    Alternative sequencei350 – 461112PLNDK…TTLHN → YGGAHAILNAGFSVVFMRNY KLPKVECCHLFVLSNDFHFF VIRAYHTVSEVHMVRVACIP FQFLSSKIGSEFLQVRNAFS QLFIQICLLLEHQNSTRCSE KSVSSIIPGINS in isoform 3. 1 PublicationVSP_007656Add
    BLAST
    Alternative sequencei350 – 41869PLNDK…DLIER → AYHTVSEVHMVRVACIPFQF LSSKIGSEFLQVRNAFSQLF IQICLLLEHQNSTRCSEKSV SSIIPGINS in isoform 2. 1 PublicationVSP_007654Add
    BLAST
    Alternative sequencei419 – 1088670Missing in isoform 2. 1 PublicationVSP_007655Add
    BLAST
    Alternative sequencei462 – 1088627Missing in isoform 3. 1 PublicationVSP_007657Add
    BLAST
    Alternative sequencei689 – 73850Missing in isoform 4. 1 PublicationVSP_013356Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY374297 mRNA. Translation: AAQ82435.1.
    AK093577 mRNA. Translation: BAC04200.1.
    AK294765 mRNA. Translation: BAG57899.1.
    AC012626 Genomic DNA. No translation available.
    AC040173 Genomic DNA. No translation available.
    AC130650 Genomic DNA. No translation available.
    CH471112 Genomic DNA. Translation: EAW85112.1.
    BC047761 mRNA. Translation: AAH47761.1.
    BC136260 mRNA. Translation: AAI36261.1.
    BC171750 mRNA. Translation: AAI71750.1.
    AB033069 mRNA. Translation: BAA86557.2.
    CR749797 mRNA. Translation: CAH18657.1.
    CCDSiCCDS32391.1. [Q9ULH7-4]
    RefSeqiNP_054767.3. NM_014048.3. [Q9ULH7-4]
    XP_005255508.1. XM_005255451.2. [Q9ULH7-5]
    XP_005255509.1. XM_005255452.2. [Q9ULH7-5]
    XP_005255510.1. XM_005255453.2. [Q9ULH7-5]
    XP_005255512.1. XM_005255455.2. [Q9ULH7-1]
    XP_006720971.1. XM_006720908.1. [Q9ULH7-5]
    XP_006720972.1. XM_006720909.1. [Q9ULH7-5]
    XP_006720973.1. XM_006720910.1. [Q9ULH7-5]
    XP_006720974.1. XM_006720911.1. [Q9ULH7-5]
    XP_006720977.1. XM_006720914.1. [Q9ULH7-4]
    UniGeneiHs.49143.

    Genome annotation databases

    EnsembliENST00000318282; ENSP00000339086; ENSG00000186260. [Q9ULH7-4]
    ENST00000571589; ENSP00000459626; ENSG00000186260. [Q9ULH7-5]
    ENST00000573051; ENSP00000460589; ENSG00000186260. [Q9ULH7-2]
    ENST00000574045; ENSP00000459205; ENSG00000186260. [Q9ULH7-4]
    GeneIDi57496.
    KEGGihsa:57496.
    UCSCiuc002dcg.3. human. [Q9ULH7-4]
    uc010uza.2. human.
    uc010uzb.2. human. [Q9ULH7-2]

    Polymorphism databases

    DMDMi32363203.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY374297 mRNA. Translation: AAQ82435.1 .
    AK093577 mRNA. Translation: BAC04200.1 .
    AK294765 mRNA. Translation: BAG57899.1 .
    AC012626 Genomic DNA. No translation available.
    AC040173 Genomic DNA. No translation available.
    AC130650 Genomic DNA. No translation available.
    CH471112 Genomic DNA. Translation: EAW85112.1 .
    BC047761 mRNA. Translation: AAH47761.1 .
    BC136260 mRNA. Translation: AAI36261.1 .
    BC171750 mRNA. Translation: AAI71750.1 .
    AB033069 mRNA. Translation: BAA86557.2 .
    CR749797 mRNA. Translation: CAH18657.1 .
    CCDSi CCDS32391.1. [Q9ULH7-4 ]
    RefSeqi NP_054767.3. NM_014048.3. [Q9ULH7-4 ]
    XP_005255508.1. XM_005255451.2. [Q9ULH7-5 ]
    XP_005255509.1. XM_005255452.2. [Q9ULH7-5 ]
    XP_005255510.1. XM_005255453.2. [Q9ULH7-5 ]
    XP_005255512.1. XM_005255455.2. [Q9ULH7-1 ]
    XP_006720971.1. XM_006720908.1. [Q9ULH7-5 ]
    XP_006720972.1. XM_006720909.1. [Q9ULH7-5 ]
    XP_006720973.1. XM_006720910.1. [Q9ULH7-5 ]
    XP_006720974.1. XM_006720911.1. [Q9ULH7-5 ]
    XP_006720977.1. XM_006720914.1. [Q9ULH7-4 ]
    UniGenei Hs.49143.

    3D structure databases

    ProteinModelPortali Q9ULH7.
    SMRi Q9ULH7. Positions 39-151, 376-424.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121563. 10 interactions.
    IntActi Q9ULH7. 5 interactions.
    MINTi MINT-1190534.
    STRINGi 9606.ENSP00000339086.

    PTM databases

    PhosphoSitei Q9ULH7.

    Polymorphism databases

    DMDMi 32363203.

    Proteomic databases

    MaxQBi Q9ULH7.
    PaxDbi Q9ULH7.
    PRIDEi Q9ULH7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318282 ; ENSP00000339086 ; ENSG00000186260 . [Q9ULH7-4 ]
    ENST00000571589 ; ENSP00000459626 ; ENSG00000186260 . [Q9ULH7-5 ]
    ENST00000573051 ; ENSP00000460589 ; ENSG00000186260 . [Q9ULH7-2 ]
    ENST00000574045 ; ENSP00000459205 ; ENSG00000186260 . [Q9ULH7-4 ]
    GeneIDi 57496.
    KEGGi hsa:57496.
    UCSCi uc002dcg.3. human. [Q9ULH7-4 ]
    uc010uza.2. human.
    uc010uzb.2. human. [Q9ULH7-2 ]

    Organism-specific databases

    CTDi 57496.
    GeneCardsi GC16P014072.
    H-InvDB HIX0012829.
    HGNCi HGNC:29819. MKL2.
    HPAi HPA011286.
    MIMi 609463. gene.
    neXtProti NX_Q9ULH7.
    PharmGKBi PA134981329.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG82832.
    HOVERGENi HBG036493.
    InParanoidi Q9ULH7.
    PhylomeDBi Q9ULH7.
    TreeFami TF326024.

    Miscellaneous databases

    ChiTaRSi MKL2. human.
    GeneWikii MKL2.
    GenomeRNAii 57496.
    NextBioi 35471837.
    PMAP-CutDB Q9ULH7.
    PROi Q9ULH7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULH7.
    Bgeei Q9ULH7.
    CleanExi HS_MKL2.
    Genevestigatori Q9ULH7.

    Family and domain databases

    Gene3Di 1.10.720.30. 1 hit.
    InterProi IPR004018. RPEL_repeat.
    IPR003034. SAP_dom.
    [Graphical view ]
    Pfami PF02755. RPEL. 3 hits.
    PF02037. SAP. 1 hit.
    [Graphical view ]
    SMARTi SM00707. RPEL. 3 hits.
    SM00513. SAP. 1 hit.
    [Graphical view ]
    PROSITEi PS51073. RPEL. 3 hits.
    PS50800. SAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation."
      Selvaraj A., Prywes R.
      J. Biol. Chem. 278:41977-41987(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH MKL1 AND SRF.
      Tissue: Cervix carcinoma.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
      Tissue: Brain and Thymus.
    3. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
      Tissue: Brain, Medulla oblongata and Testis.
    6. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1088 (ISOFORM 1).
      Tissue: Brain.
    7. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1088 (ISOFORM 1).
      Tissue: Amygdala.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66; THR-367; THR-370 AND SER-921, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. "C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma."
      Huang D., Sumegi J., Dal Cin P., Reith J.D., Yasuda T., Nelson M., Muirhead D., Bridge J.A.
      Genes Chromosomes Cancer 49:810-818(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHROMOSOMAL TRANSLOCATION WITH C11ORF95.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-541, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: VARIANT GLY-390.

    Entry informationi

    Entry nameiMKL2_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULH7
    Secondary accession number(s): A6ND53
    , B4DGT8, Q68CT1, Q6UB16, Q86WW2, Q8N226
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2003
    Last sequence update: June 27, 2003
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3