Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ULH7 (MKL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
MKL/myocardin-like protein 2
Alternative name(s):
Megakaryoblastic leukemia 2
Myocardin-related transcription factor B
Short name=MRTF-B
Gene names
Name:MKL2
Synonyms:KIAA1243, MRTFB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1088 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation. Ref.1

Subunit structure

Interacts with MKL1 and SRF. Ref.1

Subcellular location

Nucleus By similarity.

Domain

The N-terminal region is required for nuclear localization and the C-terminal region mediates transcriptional activity By similarity.

Post-translational modification

O-glycosylated By similarity.

Sequence similarities

Contains 3 RPEL repeats.

Contains 1 SAP domain.

Ontologies

Keywords
   Biological processDifferentiation
Myogenesis
Transcription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
Repeat
   Molecular functionActivator
Developmental protein
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processblood vessel morphogenesis

Inferred from electronic annotation. Source: Ensembl

cardiac muscle tissue development

Inferred from electronic annotation. Source: Ensembl

embryonic organ development

Inferred from electronic annotation. Source: Ensembl

heart morphogenesis

Inferred from electronic annotation. Source: Ensembl

in utero embryonic development

Inferred from electronic annotation. Source: Ensembl

liver development

Inferred from electronic annotation. Source: Ensembl

muscle organ development

Inferred from electronic annotation. Source: UniProtKB-KW

positive regulation of striated muscle tissue development

Inferred from direct assay Ref.1. Source: UniProtKB

positive regulation of transcription from RNA polymerase II promoter

Inferred from direct assay Ref.1. Source: UniProtKB

smooth muscle cell differentiation

Inferred from electronic annotation. Source: Ensembl

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: Ensembl

nucleus

Inferred by curator Ref.1. Source: UniProtKB

   Molecular_functionnucleic acid binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: Ensembl

transcription coactivator activity

Inferred from direct assay Ref.1. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

SRFP118313EBI-493007,EBI-493034

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ULH7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ULH7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEV → M
     350-418: PLNDKNSNSG...SGTKPDLIER → AYHTVSEVHM...VSSIIPGINS
     419-1088: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9ULH7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     350-461: PLNDKNSNSG...VALPVTTLHN → YGGAHAILNA...VSSIIPGINS
     462-1088: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9ULH7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MIDSSKKQQQ...EGSNQKSLKE → MDHTGAIDTE...NLPPLNERKN
     689-738: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10881088MKL/myocardin-like protein 2
PRO_0000126628

Regions

Repeat40 – 6526RPEL 1
Repeat84 – 10926RPEL 2
Repeat128 – 15326RPEL 3
Domain389 – 42335SAP
Region563 – 59129Required for interaction with itself and with MKL1
Coiled coil545 – 60157 Potential
Compositional bias671 – 787117Gln-rich

Amino acid modifications

Modified residue661Phosphoserine Ref.8
Modified residue3671Phosphothreonine Ref.8
Modified residue3701Phosphothreonine Ref.8
Modified residue5411Phosphoserine Ref.10
Modified residue9211Phosphoserine Ref.8

Natural variations

Alternative sequence1 – 4141MIDSS…SLKEV → M in isoform 2.
VSP_007653
Alternative sequence1 – 4040MIDSS…KSLKE → MDHTGAIDTEDEVGPLAHLA PSPQSEAVAHEFQELSLQSS QNLPPLNERKN in isoform 4.
VSP_013355
Alternative sequence350 – 461112PLNDK…TTLHN → YGGAHAILNAGFSVVFMRNY KLPKVECCHLFVLSNDFHFF VIRAYHTVSEVHMVRVACIP FQFLSSKIGSEFLQVRNAFS QLFIQICLLLEHQNSTRCSE KSVSSIIPGINS in isoform 3.
VSP_007656
Alternative sequence350 – 41869PLNDK…DLIER → AYHTVSEVHMVRVACIPFQF LSSKIGSEFLQVRNAFSQLF IQICLLLEHQNSTRCSEKSV SSIIPGINS in isoform 2.
VSP_007654
Alternative sequence419 – 1088670Missing in isoform 2.
VSP_007655
Alternative sequence462 – 1088627Missing in isoform 3.
VSP_007657
Alternative sequence689 – 73850Missing in isoform 4.
VSP_013356
Natural variant3901D → G Found in a renal cell carcinoma sample; somatic mutation. Ref.12
VAR_064732

Experimental info

Sequence conflict2661K → R in BAC04200. Ref.2
Sequence conflict3501P → A in AAQ82435. Ref.1
Sequence conflict5921E → G in CAH18657. Ref.7
Sequence conflict5981Q → R in AAQ82435. Ref.1
Sequence conflict6291D → G in AAQ82435. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 27, 2003. Version 3.
Checksum: 0CA4A52A115C0C83

FASTA1,088118,127
        10         20         30         40         50         60 
MIDSSKKQQQ GFPEILTAGD FEPLKEKECL EGSNQKSLKE VLQLRLQQRR TREQLVDQGI 

        70         80         90        100        110        120 
MPPLKSPAAF HEQIKSLERA RTENFLKHKI RSRPDRSELV RMHILEETFA EPSLQATQMK 

       130        140        150        160        170        180 
LKRARLADDL NEKIAQRPGP MELVEKNILP VDSSVKEAII GVGKEDYPHT QGDFSFDEDS 

       190        200        210        220        230        240 
SDALSPDQPA SQESQGSAAS PSEPKVSESP SPVTTNTPAQ FASVSPTVPE FLKTPPTADQ 

       250        260        270        280        290        300 
PPPRPAAPVL PTNTVSSAKP GPALVKQSHP KNPNDKHRSK KCKDPKPRVK KLKYHQYIPP 

       310        320        330        340        350        360 
DQKGEKNEPQ MDSNYARLLQ QQQLFLQLQI LSQQKQHYNY QTILPAPFKP LNDKNSNSGN 

       370        380        390        400        410        420 
SALNNATPNT PRQNTSTPVR KPGPLPSSLD DLKVSELKTE LKLRGLPVSG TKPDLIERLK 

       430        440        450        460        470        480 
PYQEVNSSGL AAGGIVAVSS SAIVTSNPEV TVALPVTTLH NTVTSSVSTL KAELPPTGTS 

       490        500        510        520        530        540 
NATRVENVHS PLPISPSPSE QSSLSTDDTN MADTFTEIMT MMSPSQFLSS SPLRMTNNED 

       550        560        570        580        590        600 
SLSPTSSTLS NLELDAAEKD RKLQEKEKQI EELKRKLEQE QKLVEVLKMQ LEVEKRGQQQ 

       610        620        630        640        650        660 
RPLEAQPSAP GHSVKSDQKH GSLGSSIKDE ASLPDCSSSR QPIPVASHAV GQPVSTGGQT 

       670        680        690        700        710        720 
LVAKKAVVIK QEVPVGQAEQ QSVVSQFYVS SQGQPPPAVV AQPQALLTTQ TAQLLLPVSI 

       730        740        750        760        770        780 
QGSSVTSVQL PVGSLKLQTS PQAGMQTQPQ IATAAQIPTA ALASGLAPTV PQTQDTFPQH 

       790        800        810        820        830        840 
VLSQPQQVRK VFTNSASSNT VLPYQRHPAP AVQQPFINKA SNSVLQSRNA PLPSLQNGPN 

       850        860        870        880        890        900 
TPNKPSSPPP PQQFVVQHSL FGSPVAKTKD PPRYEEAIKQ TRSTQAPLPE ISNAHSQQMD 

       910        920        930        940        950        960 
DLFDILIKSG EISLPIKEEP SPISKMRPVT ASITTMPVNT VVSRPPPQVQ MAPPVSLEPM 

       970        980        990       1000       1010       1020 
GSLSASLENQ LEAFLDGTLP SANEIPPLQS SSEDREPFSL IEDLQNDLLS HSGMLDHSHS 

      1030       1040       1050       1060       1070       1080 
PMETSETQFA AGTPCLSLDL SDSNLDNMEW LDITMPNSSS GLTPLSTTAP SMFSADFLDP 


QDLPLPWD 

« Hide

Isoform 2 [UniParc].

Checksum: 265D363A09230333
Show »

FASTA37842,496
Isoform 3 [UniParc].

Checksum: 94540BFA3F4213AB
Show »

FASTA46151,902
Isoform 4 [UniParc].

Checksum: E8DC053F48F8AA4F
Show »

FASTA1,049114,119

References

« Hide 'large scale' references
[1]"Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation."
Selvaraj A., Prywes R.
J. Biol. Chem. 278:41977-41987(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH MKL1 AND SRF.
Tissue: Cervix carcinoma.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Thymus.
[3]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Medulla oblongata.
[5]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1088 (ISOFORM 1).
Tissue: Brain.
[6]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1088 (ISOFORM 1).
Tissue: Amygdala.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66; THR-367; THR-370 AND SER-921, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[10]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-541, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma."
Varela I., Tarpey P., Raine K., Huang D., Ong C.K., Stephens P., Davies H., Jones D., Lin M.L., Teague J., Bignell G., Butler A., Cho J., Dalgliesh G.L., Galappaththige D., Greenman C., Hardy C., Jia M. expand/collapse author list , Latimer C., Lau K.W., Marshall J., McLaren S., Menzies A., Mudie L., Stebbings L., Largaespada D.A., Wessels L.F.A., Richard S., Kahnoski R.J., Anema J., Tuveson D.A., Perez-Mancera P.A., Mustonen V., Fischer A., Adams D.J., Rust A., Chan-On W., Subimerb C., Dykema K., Furge K., Campbell P.J., Teh B.T., Stratton M.R., Futreal P.A.
Nature 469:539-542(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT GLY-390.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY374297 mRNA. Translation: AAQ82435.1.
AK093577 mRNA. Translation: BAC04200.1.
AC130650 Genomic DNA. No translation available.
BC047761 mRNA. Translation: AAH47761.1.
AB033069 mRNA. Translation: BAA86557.2.
CR749797 mRNA. Translation: CAH18657.1.
RefSeqNP_054767.3. NM_014048.3.
XP_005255512.1. XM_005255455.2.
UniGeneHs.49143.

3D structure databases

ProteinModelPortalQ9ULH7.
SMRQ9ULH7. Positions 39-151, 376-424.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121563. 10 interactions.
IntActQ9ULH7. 5 interactions.
MINTMINT-1190534.
STRING9606.ENSP00000339086.

PTM databases

PhosphoSiteQ9ULH7.

Polymorphism databases

DMDM32363203.

Proteomic databases

PaxDbQ9ULH7.
PRIDEQ9ULH7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000318282; ENSP00000339086; ENSG00000186260. [Q9ULH7-4]
ENST00000341243; ENSP00000345841; ENSG00000186260. [Q9ULH7-1]
ENST00000573051; ENSP00000460589; ENSG00000186260. [Q9ULH7-2]
ENST00000574045; ENSP00000459205; ENSG00000186260. [Q9ULH7-4]
GeneID57496.
KEGGhsa:57496.
UCSCuc002dcg.3. human. [Q9ULH7-4]
uc010uzb.2. human. [Q9ULH7-2]

Organism-specific databases

CTD57496.
GeneCardsGC16P014072.
H-InvDBHIX0012829.
HGNCHGNC:29819. MKL2.
HPAHPA011286.
MIM609463. gene.
neXtProtNX_Q9ULH7.
PharmGKBPA134981329.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG82832.
HOVERGENHBG036493.
InParanoidQ9ULH7.
PhylomeDBQ9ULH7.
TreeFamTF326024.

Gene expression databases

ArrayExpressQ9ULH7.
BgeeQ9ULH7.
CleanExHS_MKL2.
GenevestigatorQ9ULH7.

Family and domain databases

Gene3D1.10.720.30. 1 hit.
InterProIPR004018. RPEL_repeat.
IPR003034. SAP_dom.
[Graphical view]
PfamPF02755. RPEL. 3 hits.
PF02037. SAP. 1 hit.
[Graphical view]
SMARTSM00707. RPEL. 3 hits.
SM00513. SAP. 1 hit.
[Graphical view]
PROSITEPS51073. RPEL. 3 hits.
PS50800. SAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMKL2. human.
GeneWikiMKL2.
GenomeRNAi57496.
NextBio63808.
PMAP-CutDBQ9ULH7.
PROQ9ULH7.
SOURCESearch...

Entry information

Entry nameMKL2_HUMAN
AccessionPrimary (citable) accession number: Q9ULH7
Secondary accession number(s): A6ND53 expand/collapse secondary AC list , Q68CT1, Q6UB16, Q86WW2, Q8N226
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: June 27, 2003
Last modified: April 16, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM