Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated tumor suppressor 1

Gene

MTUS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth.2 Publications

Enzyme and pathway databases

BioCyciZFISH:ENSG00000129422-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated tumor suppressor 1
Alternative name(s):
AT2 receptor-binding protein
Angiotensin-II type 2 receptor-interacting protein
Mitochondrial tumor suppressor 1
Gene namesi
Name:MTUS1
Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:29789. MTUS1.

Subcellular locationi

Isoform 1 :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Mitochondrion, Nucleus

Pathology & Biotechi

Involvement in diseasei

Hepatocellular carcinoma (HCC)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.
See also OMIM:114550
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant rs61733703dbSNPEnsembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant rs187103704dbSNPEnsembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant rs567116808dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation, Tumor suppressor

Organism-specific databases

DisGeNETi57509.
MalaCardsiMTUS1.
MIMi114550. phenotype.
OpenTargetsiENSG00000129422.
PharmGKBiPA134968054.

Polymorphism and mutation databases

BioMutaiMTUS1.
DMDMi158706128.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003051971 – 1270Microtubule-associated tumor suppressor 1Add BLAST1270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei186PhosphothreonineCombined sources1
Modified residuei381PhosphoserineBy similarity1
Modified residuei399PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei1203PhosphoserineBy similarity1
Modified residuei1224PhosphoserineCombined sources1
Modified residuei1245PhosphoserineCombined sources1
Modified residuei1255PhosphoserineBy similarity1
Modified residuei1259PhosphoserineBy similarity1
Modified residuei1261PhosphoserineBy similarity1
Modified residuei1264PhosphoserineCombined sources1
Modified residuei1268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9ULD2.
PaxDbiQ9ULD2.
PeptideAtlasiQ9ULD2.
PRIDEiQ9ULD2.

PTM databases

iPTMnetiQ9ULD2.
PhosphoSitePlusiQ9ULD2.

Expressioni

Tissue specificityi

Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform in most peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform in brain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform in cerebellum and fetal brain.7 Publications

Inductioni

Isoform 1 is down-regulated in invasive breast carcinomas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000129422.
CleanExiHS_MTUS1.
ExpressionAtlasiQ9ULD2. baseline and differential.
GenevisibleiQ9ULD2. HS.

Organism-specific databases

HPAiHPA067903.
HPA069795.

Interactioni

Subunit structurei

Homodimer. Interacts with AGTR2. Interacts with PTPN6 (By similarity). Isoform 1 associates with microtubules.By similarity1 Publication

Protein-protein interaction databases

BioGridi121573. 22 interactors.
IntActiQ9ULD2. 20 interactors.
STRINGi9606.ENSP00000262102.

Structurei

3D structure databases

ProteinModelPortaliQ9ULD2.
SMRiQ9ULD2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili940 – 1231Sequence analysisAdd BLAST292

Sequence similaritiesi

Belongs to the MTUS1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEXM. Eukaryota.
ENOG41118DX. LUCA.
GeneTreeiENSGT00390000006245.
HOGENOMiHOG000013016.
HOVERGENiHBG108158.
InParanoidiQ9ULD2.
OMAiMVVDYET.
OrthoDBiEOG091G0DE4.
PhylomeDBiQ9ULD2.
TreeFamiTF333416.

Family and domain databases

InterProiIPR029786. MTUS1.
[Graphical view]
PANTHERiPTHR24200:SF7. PTHR24200:SF7. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ULD2-1) [UniParc]FASTAAdd to basket
Also known as: ATIP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN
60 70 80 90 100
PDDMVVDYET DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD
110 120 130 140 150
SICQCPALVG TEKPKYLQHS CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG
160 170 180 190 200
YCDALELNQT FDMTVDKVNC TFISHHAIGK SQSFHTAGSL PPTGRRSGST
210 220 230 240 250
SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD MTYTAFSDVV
260 270 280 290 300
MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME
310 320 330 340 350
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC
360 370 380 390 400
PLMVPAFDKS EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP
410 420 430 440 450
PGQKVGSSFG LTWDANDMVI STDKTMCMST PVLEPTKVTF SVSPIEATEK
460 470 480 490 500
CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG KSTIKTNTPI GCKVRKTEII
510 520 530 540 550
SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS SPSSVNSRQQ
560 570 580 590 600
TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR
610 620 630 640 650
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC
660 670 680 690 700
LEMTYVPNID RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA
710 720 730 740 750
SKTTTTSGRN ISKPDSCGLR QIAAPKAKVG PPVSCLRRNS DNRNPSADRA
760 770 780 790 800
VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR PLPKSKASLK SPALRRTGST
810 820 830 840 850
PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG SFYLKPLVSR
860 870 880 890 900
AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE
910 920 930 940 950
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA
960 970 980 990 1000
LKQHKTLSQE LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK
1010 1020 1030 1040 1050
TERENRLKEF YTREYEKLRD TYIEEAEKYK MQLQEQFDNL NAAHETSKLE
1060 1070 1080 1090 1100
IEASHSEKLE LLKKAYEASL SEIKKGHEIE KKSLEDLLSE KQESLEKQIN
1110 1120 1130 1140 1150
DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL ESLKAVLEIK
1160 1170 1180 1190 1200
NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR
1210 1220 1230 1240 1250
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA
1260 1270
IPLQSPRNSG SFPSPSISPR
Length:1,270
Mass (Da):141,397
Last modified:October 2, 2007 - v2
Checksum:i2EAE962F627BFFE3
GO
Isoform 2 (identifier: Q9ULD2-2) [UniParc]FASTAAdd to basket
Also known as: ATIP3b

The sequence of this isoform differs from the canonical sequence as follows:
     763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A

Show »
Length:1,216
Mass (Da):135,661
Checksum:iECC10DC1CA22BF72
GO
Isoform 3 (identifier: Q9ULD2-3) [UniParc]FASTAAdd to basket
Also known as: ATIP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-834: Missing.
     835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT

Show »
Length:436
Mass (Da):50,544
Checksum:i196002F8C8D9A6DD
GO
Isoform 4 (identifier: Q9ULD2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-928: Missing.
     929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR

Show »
Length:342
Mass (Da):39,775
Checksum:i20C0995FFE927E24
GO
Isoform 5 (identifier: Q9ULD2-5) [UniParc]FASTAAdd to basket
Also known as: ATIP2

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: GKPTSLKT → VLPKAAFS
     771-1270: Missing.

Note: Expressed at very low levels in most tissues.
Show »
Length:770
Mass (Da):84,252
Checksum:i46E8EA82686165D8
GO
Isoform 6 (identifier: Q9ULD2-6) [UniParc]FASTAAdd to basket
Also known as: ATIP4

The sequence of this isoform differs from the canonical sequence as follows:
     1-753: Missing.
     754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT

Show »
Length:517
Mass (Da):58,988
Checksum:i43755CC4B064F012
GO
Isoform 7 (identifier: Q9ULD2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-855: Missing.

Note: No experimental confirmation available.
Show »
Length:415
Mass (Da):48,050
Checksum:i91955F97EA18D77D
GO

Sequence cautioni

The sequence AAH07328 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH33842 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14894 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti266C → G in CAB50791 (PubMed:17974005).Curated1
Sequence conflicti918F → L in BAG37243 (PubMed:14702039).Curated1
Sequence conflicti999E → G in CAH56128 (PubMed:17974005).Curated1
Sequence conflicti1149I → T in BAB14894 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03517375Q → K in HCC. 1 PublicationCorresponds to variant rs61733703dbSNPEnsembl.1
Natural variantiVAR_035174148C → R.5 PublicationsCorresponds to variant rs3739407dbSNPEnsembl.1
Natural variantiVAR_035175186T → S in HNSCC cell lines. 1 PublicationCorresponds to variant rs141609607dbSNPEnsembl.1
Natural variantiVAR_035176425T → M.1 PublicationCorresponds to variant rs61733694dbSNPEnsembl.1
Natural variantiVAR_035177453K → T.2 PublicationsCorresponds to variant rs17690844dbSNPEnsembl.1
Natural variantiVAR_035178563A → S in HCC. 1 Publication1
Natural variantiVAR_035179575H → R.2 PublicationsCorresponds to variant rs209569dbSNPEnsembl.1
Natural variantiVAR_035180873N → H in HCC. 1 PublicationCorresponds to variant rs187103704dbSNPEnsembl.1
Natural variantiVAR_035181911K → T.1 PublicationCorresponds to variant rs61748836dbSNPEnsembl.1
Natural variantiVAR_0351821063K → T.1 PublicationCorresponds to variant rs17853231dbSNPEnsembl.1
Natural variantiVAR_0351831105E → Q.1 PublicationCorresponds to variant rs61733705dbSNPEnsembl.1
Natural variantiVAR_0351841201Q → R in HCC. 1 PublicationCorresponds to variant rs567116808dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0282701 – 928Missing in isoform 4. 1 PublicationAdd BLAST928
Alternative sequenceiVSP_0448491 – 855Missing in isoform 7. 1 PublicationAdd BLAST855
Alternative sequenceiVSP_0282711 – 834Missing in isoform 3. 4 PublicationsAdd BLAST834
Alternative sequenceiVSP_0282721 – 753Missing in isoform 6. 1 PublicationAdd BLAST753
Alternative sequenceiVSP_028273754 – 817QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_028274763 – 817GKPTS…YSNNS → A in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_028275763 – 770GKPTSLKT → VLPKAAFS in isoform 5. 1 Publication8
Alternative sequenceiVSP_028276771 – 1270Missing in isoform 5. 1 PublicationAdd BLAST500
Alternative sequenceiVSP_028277835 – 874QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3. 4 PublicationsAdd BLAST40
Alternative sequenceiVSP_028278929 – 946GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF121259 mRNA. Translation: AAG33674.1.
AF293357 mRNA. Translation: AAL37035.1.
AK024357 mRNA. Translation: BAB14894.1. Different initiation.
AK125188 mRNA. Translation: BAG54161.1.
AK289750 mRNA. Translation: BAF82439.1.
AK294860 mRNA. Translation: BAG57964.1.
AK314692 mRNA. Translation: BAG37243.1.
AL096842 mRNA. Translation: CAB50791.1.
BX648879 mRNA. Translation: CAH56128.1.
AC027117 Genomic DNA. No translation available.
AC124069 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63804.1.
CH471080 Genomic DNA. Translation: EAW63805.1.
CH471080 Genomic DNA. Translation: EAW63810.1.
BC007328 mRNA. Translation: AAH07328.1. Sequence problems.
BC033842 mRNA. Translation: AAH33842.1. Different initiation.
BC136320 mRNA. Translation: AAI36321.1.
BC142971 mRNA. Translation: AAI42972.1.
AY363099 mRNA. Translation: AAQ24172.1.
AB033114 mRNA. Translation: BAA86602.1.
CCDSiCCDS43716.1. [Q9ULD2-2]
CCDS43717.1. [Q9ULD2-1]
CCDS43718.1. [Q9ULD2-6]
CCDS43719.1. [Q9ULD2-3]
CCDS55204.1. [Q9ULD2-7]
CCDS83254.1. [Q9ULD2-4]
RefSeqiNP_001001924.1. NM_001001924.2. [Q9ULD2-1]
NP_001001925.1. NM_001001925.2. [Q9ULD2-2]
NP_001001931.1. NM_001001931.2. [Q9ULD2-6]
NP_001159865.1. NM_001166393.1. [Q9ULD2-7]
NP_001317399.1. NM_001330470.1.
NP_065800.1. NM_020749.4. [Q9ULD2-3]
XP_005273636.1. XM_005273579.3. [Q9ULD2-1]
XP_005273639.1. XM_005273582.3. [Q9ULD2-2]
XP_016869189.1. XM_017013700.1. [Q9ULD2-1]
XP_016869190.1. XM_017013701.1. [Q9ULD2-1]
XP_016869191.1. XM_017013702.1. [Q9ULD2-2]
UniGeneiHs.7946.

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422. [Q9ULD2-4]
GeneIDi57509.
KEGGihsa:57509.
UCSCiuc003wxs.4. human. [Q9ULD2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF121259 mRNA. Translation: AAG33674.1.
AF293357 mRNA. Translation: AAL37035.1.
AK024357 mRNA. Translation: BAB14894.1. Different initiation.
AK125188 mRNA. Translation: BAG54161.1.
AK289750 mRNA. Translation: BAF82439.1.
AK294860 mRNA. Translation: BAG57964.1.
AK314692 mRNA. Translation: BAG37243.1.
AL096842 mRNA. Translation: CAB50791.1.
BX648879 mRNA. Translation: CAH56128.1.
AC027117 Genomic DNA. No translation available.
AC124069 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63804.1.
CH471080 Genomic DNA. Translation: EAW63805.1.
CH471080 Genomic DNA. Translation: EAW63810.1.
BC007328 mRNA. Translation: AAH07328.1. Sequence problems.
BC033842 mRNA. Translation: AAH33842.1. Different initiation.
BC136320 mRNA. Translation: AAI36321.1.
BC142971 mRNA. Translation: AAI42972.1.
AY363099 mRNA. Translation: AAQ24172.1.
AB033114 mRNA. Translation: BAA86602.1.
CCDSiCCDS43716.1. [Q9ULD2-2]
CCDS43717.1. [Q9ULD2-1]
CCDS43718.1. [Q9ULD2-6]
CCDS43719.1. [Q9ULD2-3]
CCDS55204.1. [Q9ULD2-7]
CCDS83254.1. [Q9ULD2-4]
RefSeqiNP_001001924.1. NM_001001924.2. [Q9ULD2-1]
NP_001001925.1. NM_001001925.2. [Q9ULD2-2]
NP_001001931.1. NM_001001931.2. [Q9ULD2-6]
NP_001159865.1. NM_001166393.1. [Q9ULD2-7]
NP_001317399.1. NM_001330470.1.
NP_065800.1. NM_020749.4. [Q9ULD2-3]
XP_005273636.1. XM_005273579.3. [Q9ULD2-1]
XP_005273639.1. XM_005273582.3. [Q9ULD2-2]
XP_016869189.1. XM_017013700.1. [Q9ULD2-1]
XP_016869190.1. XM_017013701.1. [Q9ULD2-1]
XP_016869191.1. XM_017013702.1. [Q9ULD2-2]
UniGeneiHs.7946.

3D structure databases

ProteinModelPortaliQ9ULD2.
SMRiQ9ULD2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121573. 22 interactors.
IntActiQ9ULD2. 20 interactors.
STRINGi9606.ENSP00000262102.

PTM databases

iPTMnetiQ9ULD2.
PhosphoSitePlusiQ9ULD2.

Polymorphism and mutation databases

BioMutaiMTUS1.
DMDMi158706128.

Proteomic databases

EPDiQ9ULD2.
PaxDbiQ9ULD2.
PeptideAtlasiQ9ULD2.
PRIDEiQ9ULD2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
ENST00000634613; ENSP00000489288; ENSG00000129422. [Q9ULD2-4]
GeneIDi57509.
KEGGihsa:57509.
UCSCiuc003wxs.4. human. [Q9ULD2-1]

Organism-specific databases

CTDi57509.
DisGeNETi57509.
GeneCardsiMTUS1.
HGNCiHGNC:29789. MTUS1.
HPAiHPA067903.
HPA069795.
MalaCardsiMTUS1.
MIMi114550. phenotype.
609589. gene.
neXtProtiNX_Q9ULD2.
OpenTargetsiENSG00000129422.
PharmGKBiPA134968054.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEXM. Eukaryota.
ENOG41118DX. LUCA.
GeneTreeiENSGT00390000006245.
HOGENOMiHOG000013016.
HOVERGENiHBG108158.
InParanoidiQ9ULD2.
OMAiMVVDYET.
OrthoDBiEOG091G0DE4.
PhylomeDBiQ9ULD2.
TreeFamiTF333416.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000129422-MONOMER.

Miscellaneous databases

ChiTaRSiMTUS1. human.
GeneWikiiMTUS1.
GenomeRNAii57509.
PROiQ9ULD2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129422.
CleanExiHS_MTUS1.
ExpressionAtlasiQ9ULD2. baseline and differential.
GenevisibleiQ9ULD2. HS.

Family and domain databases

InterProiIPR029786. MTUS1.
[Graphical view]
PANTHERiPTHR24200:SF7. PTHR24200:SF7. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMTUS1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULD2
Secondary accession number(s): A8K135
, B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: November 30, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.