Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULD2

- MTUS1_HUMAN

UniProt

Q9ULD2 - MTUS1_HUMAN

Protein

Microtubule-associated tumor suppressor 1

Gene

MTUS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 2 (02 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth.2 Publications

    GO - Biological processi

    1. cellular response to peptide hormone stimulus Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Microtubule-associated tumor suppressor 1
    Alternative name(s):
    AT2 receptor-binding protein
    Angiotensin-II type 2 receptor-interacting protein
    Mitochondrial tumor suppressor 1
    Gene namesi
    Name:MTUS1
    Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:29789. MTUS1.

    Subcellular locationi

    Mitochondrion 3 Publications. Golgi apparatus By similarity. Cell membrane By similarity. Nucleus By similarity
    Note: In neurons, translocates into the nucleus after treatment with angiotensin-II.By similarity
    Isoform 1 : Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonspindle
    Note: Localizes with the mitotic spindle during mitosis and with the intercellular bridge during cytokinesis.

    GO - Cellular componenti

    1. extracellular space Source: UniProt
    2. Golgi apparatus Source: UniProtKB-SubCell
    3. microtubule Source: UniProtKB-KW
    4. microtubule organizing center Source: UniProtKB-SubCell
    5. mitochondrion Source: UniProtKB-SubCell
    6. nucleus Source: UniProtKB-SubCell
    7. plasma membrane Source: UniProtKB-SubCell
    8. spindle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Mitochondrion, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Hepatocellular carcinoma (HCC) [MIM:114550]: A primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.1 Publication
    Note: The gene represented in this entry may be involved in disease pathogenesis.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti75 – 751Q → K in HCC. 1 Publication
    Corresponds to variant rs61733703 [ dbSNP | Ensembl ].
    VAR_035173
    Natural varianti563 – 5631A → S in HCC. 1 Publication
    VAR_035178
    Natural varianti873 – 8731N → H in HCC. 1 Publication
    Corresponds to variant rs187103704 [ dbSNP | Ensembl ].
    VAR_035180
    Natural varianti1201 – 12011Q → R in HCC. 1 Publication
    VAR_035184

    Keywords - Diseasei

    Disease mutation, Tumor suppressor

    Organism-specific databases

    MIMi114550. phenotype.
    PharmGKBiPA134968054.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12701270Microtubule-associated tumor suppressor 1PRO_0000305197Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei381 – 3811PhosphoserineBy similarity
    Modified residuei1224 – 12241Phosphoserine1 Publication
    Modified residuei1255 – 12551PhosphoserineBy similarity
    Modified residuei1264 – 12641Phosphoserine1 Publication
    Modified residuei1268 – 12681Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9ULD2.
    PaxDbiQ9ULD2.
    PRIDEiQ9ULD2.

    PTM databases

    PhosphoSiteiQ9ULD2.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform in most peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform in brain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform in cerebellum and fetal brain.7 Publications

    Inductioni

    Isoform 1 is down-regulated in invasive breast carcinomas (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ9ULD2.
    BgeeiQ9ULD2.
    CleanExiHS_MTUS1.
    GenevestigatoriQ9ULD2.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with AGTR2. Interacts with PTPN6 By similarity. Isoform 1 associates with microtubules.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi121573. 5 interactions.
    IntActiQ9ULD2. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULD2.
    SMRiQ9ULD2. Positions 1202-1234.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili940 – 1231292Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MTUS1 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG117251.
    HOVERGENiHBG108158.
    InParanoidiQ9ULD2.
    OMAiQEFFCLS.
    OrthoDBiEOG76X5Z9.
    PhylomeDBiQ9ULD2.
    TreeFamiTF333416.

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9ULD2-1) [UniParc]FASTAAdd to Basket

    Also known as: ATIP3a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN     50
    PDDMVVDYET DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD 100
    SICQCPALVG TEKPKYLQHS CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG 150
    YCDALELNQT FDMTVDKVNC TFISHHAIGK SQSFHTAGSL PPTGRRSGST 200
    SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD MTYTAFSDVV 250
    MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME 300
    VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC 350
    PLMVPAFDKS EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP 400
    PGQKVGSSFG LTWDANDMVI STDKTMCMST PVLEPTKVTF SVSPIEATEK 450
    CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG KSTIKTNTPI GCKVRKTEII 500
    SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS SPSSVNSRQQ 550
    TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR 600
    VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC 650
    LEMTYVPNID RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA 700
    SKTTTTSGRN ISKPDSCGLR QIAAPKAKVG PPVSCLRRNS DNRNPSADRA 750
    VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR PLPKSKASLK SPALRRTGST 800
    PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG SFYLKPLVSR 850
    AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE 900
    KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA 950
    LKQHKTLSQE LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK 1000
    TERENRLKEF YTREYEKLRD TYIEEAEKYK MQLQEQFDNL NAAHETSKLE 1050
    IEASHSEKLE LLKKAYEASL SEIKKGHEIE KKSLEDLLSE KQESLEKQIN 1100
    DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL ESLKAVLEIK 1150
    NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR 1200
    QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA 1250
    IPLQSPRNSG SFPSPSISPR 1270
    Length:1,270
    Mass (Da):141,397
    Last modified:October 2, 2007 - v2
    Checksum:i2EAE962F627BFFE3
    GO
    Isoform 2 (identifier: Q9ULD2-2) [UniParc]FASTAAdd to Basket

    Also known as: ATIP3b

    The sequence of this isoform differs from the canonical sequence as follows:
         763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A

    Show »
    Length:1,216
    Mass (Da):135,661
    Checksum:iECC10DC1CA22BF72
    GO
    Isoform 3 (identifier: Q9ULD2-3) [UniParc]FASTAAdd to Basket

    Also known as: ATIP1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-834: Missing.
         835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT

    Show »
    Length:436
    Mass (Da):50,544
    Checksum:i196002F8C8D9A6DD
    GO
    Isoform 4 (identifier: Q9ULD2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-928: Missing.
         929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR

    Show »
    Length:342
    Mass (Da):39,775
    Checksum:i20C0995FFE927E24
    GO
    Isoform 5 (identifier: Q9ULD2-5) [UniParc]FASTAAdd to Basket

    Also known as: ATIP2

    The sequence of this isoform differs from the canonical sequence as follows:
         763-770: GKPTSLKT → VLPKAAFS
         771-1270: Missing.

    Note: Expressed at very low levels in most tissues.

    Show »
    Length:770
    Mass (Da):84,252
    Checksum:i46E8EA82686165D8
    GO
    Isoform 6 (identifier: Q9ULD2-6) [UniParc]FASTAAdd to Basket

    Also known as: ATIP4

    The sequence of this isoform differs from the canonical sequence as follows:
         1-753: Missing.
         754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT

    Show »
    Length:517
    Mass (Da):58,988
    Checksum:i43755CC4B064F012
    GO
    Isoform 7 (identifier: Q9ULD2-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-855: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:415
    Mass (Da):48,050
    Checksum:i91955F97EA18D77D
    GO

    Sequence cautioni

    The sequence AAH07328.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAH33842.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB14894.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti266 – 2661C → G in CAB50791. (PubMed:17974005)Curated
    Sequence conflicti918 – 9181F → L in BAG37243. (PubMed:14702039)Curated
    Sequence conflicti999 – 9991E → G in CAH56128. (PubMed:17974005)Curated
    Sequence conflicti1149 – 11491I → T in BAB14894. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti75 – 751Q → K in HCC. 1 Publication
    Corresponds to variant rs61733703 [ dbSNP | Ensembl ].
    VAR_035173
    Natural varianti148 – 1481C → R.5 Publications
    Corresponds to variant rs3739407 [ dbSNP | Ensembl ].
    VAR_035174
    Natural varianti186 – 1861T → S in HNSCC cell lines. 1 Publication
    Corresponds to variant rs141609607 [ dbSNP | Ensembl ].
    VAR_035175
    Natural varianti425 – 4251T → M.1 Publication
    Corresponds to variant rs61733694 [ dbSNP | Ensembl ].
    VAR_035176
    Natural varianti453 – 4531K → T.2 Publications
    Corresponds to variant rs17690844 [ dbSNP | Ensembl ].
    VAR_035177
    Natural varianti563 – 5631A → S in HCC. 1 Publication
    VAR_035178
    Natural varianti575 – 5751H → R.2 Publications
    Corresponds to variant rs209569 [ dbSNP | Ensembl ].
    VAR_035179
    Natural varianti873 – 8731N → H in HCC. 1 Publication
    Corresponds to variant rs187103704 [ dbSNP | Ensembl ].
    VAR_035180
    Natural varianti911 – 9111K → T.1 Publication
    Corresponds to variant rs61748836 [ dbSNP | Ensembl ].
    VAR_035181
    Natural varianti1063 – 10631K → T.1 Publication
    Corresponds to variant rs17853231 [ dbSNP | Ensembl ].
    VAR_035182
    Natural varianti1105 – 11051E → Q.1 Publication
    Corresponds to variant rs61733705 [ dbSNP | Ensembl ].
    VAR_035183
    Natural varianti1201 – 12011Q → R in HCC. 1 Publication
    VAR_035184

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 928928Missing in isoform 4. 1 PublicationVSP_028270Add
    BLAST
    Alternative sequencei1 – 855855Missing in isoform 7. 1 PublicationVSP_044849Add
    BLAST
    Alternative sequencei1 – 834834Missing in isoform 3. 4 PublicationsVSP_028271Add
    BLAST
    Alternative sequencei1 – 753753Missing in isoform 6. 1 PublicationVSP_028272Add
    BLAST
    Alternative sequencei754 – 81764QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6. 1 PublicationVSP_028273Add
    BLAST
    Alternative sequencei763 – 81755GKPTS…YSNNS → A in isoform 2. 1 PublicationVSP_028274Add
    BLAST
    Alternative sequencei763 – 7708GKPTSLKT → VLPKAAFS in isoform 5. 1 PublicationVSP_028275
    Alternative sequencei771 – 1270500Missing in isoform 5. 1 PublicationVSP_028276Add
    BLAST
    Alternative sequencei835 – 87440QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3. 4 PublicationsVSP_028277Add
    BLAST
    Alternative sequencei929 – 94618GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4. 1 PublicationVSP_028278Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF121259 mRNA. Translation: AAG33674.1.
    AF293357 mRNA. Translation: AAL37035.1.
    AK024357 mRNA. Translation: BAB14894.1. Different initiation.
    AK125188 mRNA. Translation: BAG54161.1.
    AK289750 mRNA. Translation: BAF82439.1.
    AK294860 mRNA. Translation: BAG57964.1.
    AK314692 mRNA. Translation: BAG37243.1.
    AL096842 mRNA. Translation: CAB50791.1.
    BX648879 mRNA. Translation: CAH56128.1.
    AC027117 Genomic DNA. No translation available.
    AC124069 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63804.1.
    CH471080 Genomic DNA. Translation: EAW63805.1.
    CH471080 Genomic DNA. Translation: EAW63810.1.
    BC007328 mRNA. Translation: AAH07328.1. Sequence problems.
    BC033842 mRNA. Translation: AAH33842.1. Different initiation.
    BC136320 mRNA. Translation: AAI36321.1.
    BC142971 mRNA. Translation: AAI42972.1.
    AY363099 mRNA. Translation: AAQ24172.1.
    AB033114 mRNA. Translation: BAA86602.1.
    CCDSiCCDS43716.1. [Q9ULD2-2]
    CCDS43717.1. [Q9ULD2-1]
    CCDS43718.1. [Q9ULD2-6]
    CCDS43719.1. [Q9ULD2-3]
    CCDS55204.1. [Q9ULD2-7]
    RefSeqiNP_001001924.1. NM_001001924.2. [Q9ULD2-1]
    NP_001001925.1. NM_001001925.2. [Q9ULD2-2]
    NP_001001931.1. NM_001001931.2. [Q9ULD2-6]
    NP_001159865.1. NM_001166393.1. [Q9ULD2-7]
    NP_065800.1. NM_020749.4. [Q9ULD2-3]
    XP_005273636.1. XM_005273579.2. [Q9ULD2-1]
    XP_005273639.1. XM_005273582.2. [Q9ULD2-2]
    UniGeneiHs.7946.

    Genome annotation databases

    EnsembliENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
    ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
    ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
    ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
    ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
    ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
    GeneIDi57509.
    KEGGihsa:57509.
    UCSCiuc003wxs.3. human. [Q9ULD2-3]
    uc003wxt.3. human. [Q9ULD2-6]
    uc003wxv.3. human. [Q9ULD2-1]
    uc003wxw.3. human. [Q9ULD2-2]
    uc011kyg.2. human.

    Polymorphism databases

    DMDMi158706128.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF121259 mRNA. Translation: AAG33674.1 .
    AF293357 mRNA. Translation: AAL37035.1 .
    AK024357 mRNA. Translation: BAB14894.1 . Different initiation.
    AK125188 mRNA. Translation: BAG54161.1 .
    AK289750 mRNA. Translation: BAF82439.1 .
    AK294860 mRNA. Translation: BAG57964.1 .
    AK314692 mRNA. Translation: BAG37243.1 .
    AL096842 mRNA. Translation: CAB50791.1 .
    BX648879 mRNA. Translation: CAH56128.1 .
    AC027117 Genomic DNA. No translation available.
    AC124069 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63804.1 .
    CH471080 Genomic DNA. Translation: EAW63805.1 .
    CH471080 Genomic DNA. Translation: EAW63810.1 .
    BC007328 mRNA. Translation: AAH07328.1 . Sequence problems.
    BC033842 mRNA. Translation: AAH33842.1 . Different initiation.
    BC136320 mRNA. Translation: AAI36321.1 .
    BC142971 mRNA. Translation: AAI42972.1 .
    AY363099 mRNA. Translation: AAQ24172.1 .
    AB033114 mRNA. Translation: BAA86602.1 .
    CCDSi CCDS43716.1. [Q9ULD2-2 ]
    CCDS43717.1. [Q9ULD2-1 ]
    CCDS43718.1. [Q9ULD2-6 ]
    CCDS43719.1. [Q9ULD2-3 ]
    CCDS55204.1. [Q9ULD2-7 ]
    RefSeqi NP_001001924.1. NM_001001924.2. [Q9ULD2-1 ]
    NP_001001925.1. NM_001001925.2. [Q9ULD2-2 ]
    NP_001001931.1. NM_001001931.2. [Q9ULD2-6 ]
    NP_001159865.1. NM_001166393.1. [Q9ULD2-7 ]
    NP_065800.1. NM_020749.4. [Q9ULD2-3 ]
    XP_005273636.1. XM_005273579.2. [Q9ULD2-1 ]
    XP_005273639.1. XM_005273582.2. [Q9ULD2-2 ]
    UniGenei Hs.7946.

    3D structure databases

    ProteinModelPortali Q9ULD2.
    SMRi Q9ULD2. Positions 1202-1234.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121573. 5 interactions.
    IntActi Q9ULD2. 3 interactions.

    PTM databases

    PhosphoSitei Q9ULD2.

    Polymorphism databases

    DMDMi 158706128.

    Proteomic databases

    MaxQBi Q9ULD2.
    PaxDbi Q9ULD2.
    PRIDEi Q9ULD2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262102 ; ENSP00000262102 ; ENSG00000129422 . [Q9ULD2-1 ]
    ENST00000297488 ; ENSP00000297488 ; ENSG00000129422 . [Q9ULD2-3 ]
    ENST00000381861 ; ENSP00000371285 ; ENSG00000129422 . [Q9ULD2-6 ]
    ENST00000381869 ; ENSP00000371293 ; ENSG00000129422 . [Q9ULD2-2 ]
    ENST00000519263 ; ENSP00000430167 ; ENSG00000129422 . [Q9ULD2-2 ]
    ENST00000544260 ; ENSP00000445738 ; ENSG00000129422 . [Q9ULD2-7 ]
    GeneIDi 57509.
    KEGGi hsa:57509.
    UCSCi uc003wxs.3. human. [Q9ULD2-3 ]
    uc003wxt.3. human. [Q9ULD2-6 ]
    uc003wxv.3. human. [Q9ULD2-1 ]
    uc003wxw.3. human. [Q9ULD2-2 ]
    uc011kyg.2. human.

    Organism-specific databases

    CTDi 57509.
    GeneCardsi GC08M017501.
    HGNCi HGNC:29789. MTUS1.
    MIMi 114550. phenotype.
    609589. gene.
    neXtProti NX_Q9ULD2.
    PharmGKBi PA134968054.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG117251.
    HOVERGENi HBG108158.
    InParanoidi Q9ULD2.
    OMAi QEFFCLS.
    OrthoDBi EOG76X5Z9.
    PhylomeDBi Q9ULD2.
    TreeFami TF333416.

    Miscellaneous databases

    ChiTaRSi MTUS1. human.
    GeneWikii MTUS1.
    GenomeRNAii 57509.
    NextBioi 63856.
    PROi Q9ULD2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULD2.
    Bgeei Q9ULD2.
    CleanExi HS_MTUS1.
    Genevestigatori Q9ULD2.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of two novel genes on chromosome 8p21.3."
      Kinjo T., Isomura M., Iwamasa T., Nakamura Y.
      J. Hum. Genet. 45:12-17(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    2. "Identification of a new tumor suppressor gene located at chromosome 8p21.3-22."
      Seibold S., Rudroff C., Weber M., Galle J., Wanner C., Marx M.
      FASEB J. 17:1180-1182(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    3. "Trans-inactivation of receptor tyrosine kinases by novel angiotensin II AT2 receptor-interacting protein, ATIP."
      Nouet S., Amzallag N., Li J.-M., Louis S., Seitz I., Cui T.-X., Alleaume A.-M., Di Benedetto M., Boden C., Masson M., Strosberg A.D., Horiuchi M., Couraud P.-O., Nahmias C.
      J. Biol. Chem. 279:28989-28997(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORMS 1; 5 AND 6), SUBUNIT, TISSUE SPECIFICITY.
      Tissue: Lung.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 875-1270 (ISOFORM 1).
      Tissue: Brain, Fetal brain and Placenta.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 266-1270 (ISOFORM 5).
      Tissue: Salivary gland and Uterus.
    6. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-148.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ARG-148 AND THR-1063.
      Tissue: Ovary, Skin and Testis.
    9. "Differential expression in normal trophoblast and gestational tumors."
      Abadie P.A., Genti-Raimondi S.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-891 (ISOFORM 2), VARIANTS ARG-148 AND ARG-575.
    10. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-1270 (ISOFORM 1).
      Tissue: Brain.
    11. "Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival."
      Pils D., Horak P., Gleiss A., Sax C., Fabjani G., Moebus V.J., Zielinski C., Reinthaller A., Zeillinger R., Krainer M.
      Cancer 104:2417-2429(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    12. "Structural organization and expression of human MTUS1, a candidate 8p22 tumor suppressor gene encoding a family of angiotensin II AT2 receptor-interacting proteins, ATIP."
      Di Benedetto M., Bieche I., Deshayes F., Vacher S., Nouet S., Collura V., Seitz I., Louis S., Pineau P., Amsellem-Ouazana D., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Lidereau R., Nahmias C.
      Gene 380:127-136(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    13. "Differential expression in normal-adenoma-carcinoma sequence suggests complex molecular carcinogenesis in colon."
      Lee S., Bang S., Song K., Lee I.
      Oncol. Rep. 16:747-754(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis."
      Rodrigues-Ferreira S., Di Tommaso A., Dimitrov A., Cazaubon S., Gruel N., Colasson H., Nicolas A., Chaverot N., Molinie V., Reyal F., Sigal-Zafrani B., Terris B., Delattre O., Radvanyi F., Perez F., Vincent-Salomon A., Nahmias C.
      PLoS ONE 4:E7239-E7239(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ASSOCIATION WITH MICROTUBULES, SUBCELLULAR LOCATION, INDUCTION.
    17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1264 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1224 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    19. "Mutation analysis of the 8p22 candidate tumor suppressor gene ATIP/MTUS1 in hepatocellular carcinoma."
      Di Benedetto M., Pineau P., Nouet S., Berhouet S., Seitz I., Louis S., Dejean A., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Nahmias C.
      Mol. Cell. Endocrinol. 252:207-215(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS HCC LYS-75; SER-563; HIS-873 AND ARG-1201, VARIANTS ARG-148; MET-425; THR-453; ARG-575; THR-911 AND GLN-1105.
    20. "Genomic assessments of the frequent loss of heterozygosity region on 8p21.3 approximately p22 in head and neck squamous cell carcinoma."
      Ye H., Pungpravat N., Huang B.-L., Muzio L.L., Mariggio M.A., Chen Z., Wong D.T., Zhou X.
      Cancer Genet. Cytogenet. 176:100-106(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ARG-148 AND THR-453, VARIANT HNSCC SER-186, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiMTUS1_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULD2
    Secondary accession number(s): A8K135
    , B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: October 2, 2007
    Last modified: October 1, 2014
    This is version 96 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3