SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULD2

- MTUS1_HUMAN

UniProt

Q9ULD2 - MTUS1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Microtubule-associated tumor suppressor 1
Gene
MTUS1, ATBP, ATIP, GK1, KIAA1288, MTSG1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth.2 Publications

GO - Biological processi

  1. cellular response to peptide hormone stimulus Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated tumor suppressor 1
Alternative name(s):
AT2 receptor-binding protein
Angiotensin-II type 2 receptor-interacting protein
Mitochondrial tumor suppressor 1
Gene namesi
Name:MTUS1
Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:29789. MTUS1.

Subcellular locationi

Mitochondrion. Golgi apparatus By similarity. Cell membrane By similarity. Nucleus By similarity
Note: In neurons, translocates into the nucleus after treatment with angiotensin-II By similarity.3 Publications
Isoform 1 : Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonspindle
Note: Localizes with the mitotic spindle during mitosis and with the intercellular bridge during cytokinesis.3 Publications

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB-SubCell
  2. extracellular space Source: UniProt
  3. microtubule Source: UniProtKB-KW
  4. microtubule organizing center Source: UniProtKB-SubCell
  5. mitochondrion Source: UniProtKB-SubCell
  6. nucleus Source: UniProtKB-SubCell
  7. plasma membrane Source: UniProtKB-SubCell
  8. spindle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Mitochondrion, Nucleus

Pathology & Biotechi

Involvement in diseasei

Hepatocellular carcinoma (HCC) [MIM:114550]: A primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.
Note: The gene represented in this entry may be involved in disease pathogenesis.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751Q → K in HCC. 1 Publication
Corresponds to variant rs61733703 [ dbSNP | Ensembl ].
VAR_035173
Natural varianti563 – 5631A → S in HCC. 1 Publication
VAR_035178
Natural varianti873 – 8731N → H in HCC. 1 Publication
Corresponds to variant rs187103704 [ dbSNP | Ensembl ].
VAR_035180
Natural varianti1201 – 12011Q → R in HCC. 1 Publication
VAR_035184

Keywords - Diseasei

Disease mutation, Tumor suppressor

Organism-specific databases

MIMi114550. phenotype.
PharmGKBiPA134968054.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12701270Microtubule-associated tumor suppressor 1
PRO_0000305197Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei381 – 3811Phosphoserine By similarity
Modified residuei1224 – 12241Phosphoserine1 Publication
Modified residuei1255 – 12551Phosphoserine By similarity
Modified residuei1264 – 12641Phosphoserine1 Publication
Modified residuei1268 – 12681Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9ULD2.
PaxDbiQ9ULD2.
PRIDEiQ9ULD2.

PTM databases

PhosphoSiteiQ9ULD2.

Expressioni

Tissue specificityi

Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform in most peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform in brain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform in cerebellum and fetal brain.7 Publications

Inductioni

Isoform 1 is down-regulated in invasive breast carcinomas (at protein level).1 Publication

Gene expression databases

ArrayExpressiQ9ULD2.
BgeeiQ9ULD2.
CleanExiHS_MTUS1.
GenevestigatoriQ9ULD2.

Interactioni

Subunit structurei

Homodimer. Interacts with AGTR2. Interacts with PTPN6 By similarity. Isoform 1 associates with microtubules.1 Publication

Protein-protein interaction databases

BioGridi121573. 4 interactions.
IntActiQ9ULD2. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9ULD2.
SMRiQ9ULD2. Positions 1202-1234.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili940 – 1231292 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Belongs to the MTUS1 family.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG117251.
HOVERGENiHBG108158.
InParanoidiQ9ULD2.
OMAiQEFFCLS.
OrthoDBiEOG76X5Z9.
PhylomeDBiQ9ULD2.
TreeFamiTF333416.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9ULD2-1) [UniParc]FASTAAdd to Basket

Also known as: ATIP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN     50
PDDMVVDYET DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD 100
SICQCPALVG TEKPKYLQHS CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG 150
YCDALELNQT FDMTVDKVNC TFISHHAIGK SQSFHTAGSL PPTGRRSGST 200
SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD MTYTAFSDVV 250
MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME 300
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC 350
PLMVPAFDKS EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP 400
PGQKVGSSFG LTWDANDMVI STDKTMCMST PVLEPTKVTF SVSPIEATEK 450
CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG KSTIKTNTPI GCKVRKTEII 500
SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS SPSSVNSRQQ 550
TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR 600
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC 650
LEMTYVPNID RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA 700
SKTTTTSGRN ISKPDSCGLR QIAAPKAKVG PPVSCLRRNS DNRNPSADRA 750
VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR PLPKSKASLK SPALRRTGST 800
PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG SFYLKPLVSR 850
AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE 900
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA 950
LKQHKTLSQE LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK 1000
TERENRLKEF YTREYEKLRD TYIEEAEKYK MQLQEQFDNL NAAHETSKLE 1050
IEASHSEKLE LLKKAYEASL SEIKKGHEIE KKSLEDLLSE KQESLEKQIN 1100
DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL ESLKAVLEIK 1150
NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR 1200
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA 1250
IPLQSPRNSG SFPSPSISPR 1270
Length:1,270
Mass (Da):141,397
Last modified:October 2, 2007 - v2
Checksum:i2EAE962F627BFFE3
GO
Isoform 2 (identifier: Q9ULD2-2) [UniParc]FASTAAdd to Basket

Also known as: ATIP3b

The sequence of this isoform differs from the canonical sequence as follows:
     763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A

Show »
Length:1,216
Mass (Da):135,661
Checksum:iECC10DC1CA22BF72
GO
Isoform 3 (identifier: Q9ULD2-3) [UniParc]FASTAAdd to Basket

Also known as: ATIP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-834: Missing.
     835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT

Show »
Length:436
Mass (Da):50,544
Checksum:i196002F8C8D9A6DD
GO
Isoform 4 (identifier: Q9ULD2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-928: Missing.
     929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR

Show »
Length:342
Mass (Da):39,775
Checksum:i20C0995FFE927E24
GO
Isoform 5 (identifier: Q9ULD2-5) [UniParc]FASTAAdd to Basket

Also known as: ATIP2

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: GKPTSLKT → VLPKAAFS
     771-1270: Missing.

Note: Expressed at very low levels in most tissues.

Show »
Length:770
Mass (Da):84,252
Checksum:i46E8EA82686165D8
GO
Isoform 6 (identifier: Q9ULD2-6) [UniParc]FASTAAdd to Basket

Also known as: ATIP4

The sequence of this isoform differs from the canonical sequence as follows:
     1-753: Missing.
     754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT

Show »
Length:517
Mass (Da):58,988
Checksum:i43755CC4B064F012
GO
Isoform 7 (identifier: Q9ULD2-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-855: Missing.

Note: No experimental confirmation available.

Show »
Length:415
Mass (Da):48,050
Checksum:i91955F97EA18D77D
GO

Sequence cautioni

The sequence AAH07328.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAH33842.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB14894.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751Q → K in HCC. 1 Publication
Corresponds to variant rs61733703 [ dbSNP | Ensembl ].
VAR_035173
Natural varianti148 – 1481C → R.5 Publications
Corresponds to variant rs3739407 [ dbSNP | Ensembl ].
VAR_035174
Natural varianti186 – 1861T → S in HNSCC cell lines. 1 Publication
Corresponds to variant rs141609607 [ dbSNP | Ensembl ].
VAR_035175
Natural varianti425 – 4251T → M.1 Publication
Corresponds to variant rs61733694 [ dbSNP | Ensembl ].
VAR_035176
Natural varianti453 – 4531K → T.2 Publications
Corresponds to variant rs17690844 [ dbSNP | Ensembl ].
VAR_035177
Natural varianti563 – 5631A → S in HCC. 1 Publication
VAR_035178
Natural varianti575 – 5751H → R.2 Publications
Corresponds to variant rs209569 [ dbSNP | Ensembl ].
VAR_035179
Natural varianti873 – 8731N → H in HCC. 1 Publication
Corresponds to variant rs187103704 [ dbSNP | Ensembl ].
VAR_035180
Natural varianti911 – 9111K → T.1 Publication
Corresponds to variant rs61748836 [ dbSNP | Ensembl ].
VAR_035181
Natural varianti1063 – 10631K → T.1 Publication
Corresponds to variant rs17853231 [ dbSNP | Ensembl ].
VAR_035182
Natural varianti1105 – 11051E → Q.1 Publication
Corresponds to variant rs61733705 [ dbSNP | Ensembl ].
VAR_035183
Natural varianti1201 – 12011Q → R in HCC. 1 Publication
VAR_035184

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 928928Missing in isoform 4.
VSP_028270Add
BLAST
Alternative sequencei1 – 855855Missing in isoform 7.
VSP_044849Add
BLAST
Alternative sequencei1 – 834834Missing in isoform 3.
VSP_028271Add
BLAST
Alternative sequencei1 – 753753Missing in isoform 6.
VSP_028272Add
BLAST
Alternative sequencei754 – 81764QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6.
VSP_028273Add
BLAST
Alternative sequencei763 – 81755GKPTS…YSNNS → A in isoform 2.
VSP_028274Add
BLAST
Alternative sequencei763 – 7708GKPTSLKT → VLPKAAFS in isoform 5.
VSP_028275
Alternative sequencei771 – 1270500Missing in isoform 5.
VSP_028276Add
BLAST
Alternative sequencei835 – 87440QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3.
VSP_028277Add
BLAST
Alternative sequencei929 – 94618GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4.
VSP_028278Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti266 – 2661C → G in CAB50791. 1 Publication
Sequence conflicti918 – 9181F → L in BAG37243. 1 Publication
Sequence conflicti999 – 9991E → G in CAH56128. 1 Publication
Sequence conflicti1149 – 11491I → T in BAB14894. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF121259 mRNA. Translation: AAG33674.1.
AF293357 mRNA. Translation: AAL37035.1.
AK024357 mRNA. Translation: BAB14894.1. Different initiation.
AK125188 mRNA. Translation: BAG54161.1.
AK289750 mRNA. Translation: BAF82439.1.
AK294860 mRNA. Translation: BAG57964.1.
AK314692 mRNA. Translation: BAG37243.1.
AL096842 mRNA. Translation: CAB50791.1.
BX648879 mRNA. Translation: CAH56128.1.
AC027117 Genomic DNA. No translation available.
AC124069 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63804.1.
CH471080 Genomic DNA. Translation: EAW63805.1.
CH471080 Genomic DNA. Translation: EAW63810.1.
BC007328 mRNA. Translation: AAH07328.1. Sequence problems.
BC033842 mRNA. Translation: AAH33842.1. Different initiation.
BC136320 mRNA. Translation: AAI36321.1.
BC142971 mRNA. Translation: AAI42972.1.
AY363099 mRNA. Translation: AAQ24172.1.
AB033114 mRNA. Translation: BAA86602.1.
CCDSiCCDS43716.1. [Q9ULD2-2]
CCDS43717.1. [Q9ULD2-1]
CCDS43718.1. [Q9ULD2-6]
CCDS43719.1. [Q9ULD2-3]
CCDS55204.1. [Q9ULD2-7]
RefSeqiNP_001001924.1. NM_001001924.2. [Q9ULD2-1]
NP_001001925.1. NM_001001925.2. [Q9ULD2-2]
NP_001001931.1. NM_001001931.2. [Q9ULD2-6]
NP_001159865.1. NM_001166393.1. [Q9ULD2-7]
NP_065800.1. NM_020749.4. [Q9ULD2-3]
XP_005273636.1. XM_005273579.2. [Q9ULD2-1]
XP_005273639.1. XM_005273582.2. [Q9ULD2-2]
UniGeneiHs.7946.

Genome annotation databases

EnsembliENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
ENST00000381862; ENSP00000371286; ENSG00000129422. [Q9ULD2-5]
ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
ENST00000400046; ENSP00000382921; ENSG00000129422. [Q9ULD2-4]
ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
GeneIDi57509.
KEGGihsa:57509.
UCSCiuc003wxs.3. human. [Q9ULD2-3]
uc003wxt.3. human. [Q9ULD2-6]
uc003wxv.3. human. [Q9ULD2-1]
uc003wxw.3. human. [Q9ULD2-2]
uc011kyg.2. human.

Polymorphism databases

DMDMi158706128.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF121259 mRNA. Translation: AAG33674.1 .
AF293357 mRNA. Translation: AAL37035.1 .
AK024357 mRNA. Translation: BAB14894.1 . Different initiation.
AK125188 mRNA. Translation: BAG54161.1 .
AK289750 mRNA. Translation: BAF82439.1 .
AK294860 mRNA. Translation: BAG57964.1 .
AK314692 mRNA. Translation: BAG37243.1 .
AL096842 mRNA. Translation: CAB50791.1 .
BX648879 mRNA. Translation: CAH56128.1 .
AC027117 Genomic DNA. No translation available.
AC124069 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63804.1 .
CH471080 Genomic DNA. Translation: EAW63805.1 .
CH471080 Genomic DNA. Translation: EAW63810.1 .
BC007328 mRNA. Translation: AAH07328.1 . Sequence problems.
BC033842 mRNA. Translation: AAH33842.1 . Different initiation.
BC136320 mRNA. Translation: AAI36321.1 .
BC142971 mRNA. Translation: AAI42972.1 .
AY363099 mRNA. Translation: AAQ24172.1 .
AB033114 mRNA. Translation: BAA86602.1 .
CCDSi CCDS43716.1. [Q9ULD2-2 ]
CCDS43717.1. [Q9ULD2-1 ]
CCDS43718.1. [Q9ULD2-6 ]
CCDS43719.1. [Q9ULD2-3 ]
CCDS55204.1. [Q9ULD2-7 ]
RefSeqi NP_001001924.1. NM_001001924.2. [Q9ULD2-1 ]
NP_001001925.1. NM_001001925.2. [Q9ULD2-2 ]
NP_001001931.1. NM_001001931.2. [Q9ULD2-6 ]
NP_001159865.1. NM_001166393.1. [Q9ULD2-7 ]
NP_065800.1. NM_020749.4. [Q9ULD2-3 ]
XP_005273636.1. XM_005273579.2. [Q9ULD2-1 ]
XP_005273639.1. XM_005273582.2. [Q9ULD2-2 ]
UniGenei Hs.7946.

3D structure databases

ProteinModelPortali Q9ULD2.
SMRi Q9ULD2. Positions 1202-1234.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121573. 4 interactions.
IntActi Q9ULD2. 3 interactions.

PTM databases

PhosphoSitei Q9ULD2.

Polymorphism databases

DMDMi 158706128.

Proteomic databases

MaxQBi Q9ULD2.
PaxDbi Q9ULD2.
PRIDEi Q9ULD2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262102 ; ENSP00000262102 ; ENSG00000129422 . [Q9ULD2-1 ]
ENST00000297488 ; ENSP00000297488 ; ENSG00000129422 . [Q9ULD2-3 ]
ENST00000381861 ; ENSP00000371285 ; ENSG00000129422 . [Q9ULD2-6 ]
ENST00000381862 ; ENSP00000371286 ; ENSG00000129422 . [Q9ULD2-5 ]
ENST00000381869 ; ENSP00000371293 ; ENSG00000129422 . [Q9ULD2-2 ]
ENST00000400046 ; ENSP00000382921 ; ENSG00000129422 . [Q9ULD2-4 ]
ENST00000519263 ; ENSP00000430167 ; ENSG00000129422 . [Q9ULD2-2 ]
ENST00000544260 ; ENSP00000445738 ; ENSG00000129422 . [Q9ULD2-7 ]
GeneIDi 57509.
KEGGi hsa:57509.
UCSCi uc003wxs.3. human. [Q9ULD2-3 ]
uc003wxt.3. human. [Q9ULD2-6 ]
uc003wxv.3. human. [Q9ULD2-1 ]
uc003wxw.3. human. [Q9ULD2-2 ]
uc011kyg.2. human.

Organism-specific databases

CTDi 57509.
GeneCardsi GC08M017501.
HGNCi HGNC:29789. MTUS1.
MIMi 114550. phenotype.
609589. gene.
neXtProti NX_Q9ULD2.
PharmGKBi PA134968054.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG117251.
HOVERGENi HBG108158.
InParanoidi Q9ULD2.
OMAi QEFFCLS.
OrthoDBi EOG76X5Z9.
PhylomeDBi Q9ULD2.
TreeFami TF333416.

Miscellaneous databases

ChiTaRSi MTUS1. human.
GeneWikii MTUS1.
GenomeRNAii 57509.
NextBioi 63856.
PROi Q9ULD2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9ULD2.
Bgeei Q9ULD2.
CleanExi HS_MTUS1.
Genevestigatori Q9ULD2.

Family and domain databases

ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of two novel genes on chromosome 8p21.3."
    Kinjo T., Isomura M., Iwamasa T., Nakamura Y.
    J. Hum. Genet. 45:12-17(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "Identification of a new tumor suppressor gene located at chromosome 8p21.3-22."
    Seibold S., Rudroff C., Weber M., Galle J., Wanner C., Marx M.
    FASEB J. 17:1180-1182(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  3. "Trans-inactivation of receptor tyrosine kinases by novel angiotensin II AT2 receptor-interacting protein, ATIP."
    Nouet S., Amzallag N., Li J.-M., Louis S., Seitz I., Cui T.-X., Alleaume A.-M., Di Benedetto M., Boden C., Masson M., Strosberg A.D., Horiuchi M., Couraud P.-O., Nahmias C.
    J. Biol. Chem. 279:28989-28997(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORMS 1; 5 AND 6), SUBUNIT, TISSUE SPECIFICITY.
    Tissue: Lung.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 875-1270 (ISOFORM 1).
    Tissue: Brain, Fetal brain and Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 266-1270 (ISOFORM 5).
    Tissue: Salivary gland and Uterus.
  6. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-148.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ARG-148 AND THR-1063.
    Tissue: Ovary, Skin and Testis.
  9. "Differential expression in normal trophoblast and gestational tumors."
    Abadie P.A., Genti-Raimondi S.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-891 (ISOFORM 2), VARIANTS ARG-148 AND ARG-575.
  10. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-1270 (ISOFORM 1).
    Tissue: Brain.
  11. "Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival."
    Pils D., Horak P., Gleiss A., Sax C., Fabjani G., Moebus V.J., Zielinski C., Reinthaller A., Zeillinger R., Krainer M.
    Cancer 104:2417-2429(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  12. "Structural organization and expression of human MTUS1, a candidate 8p22 tumor suppressor gene encoding a family of angiotensin II AT2 receptor-interacting proteins, ATIP."
    Di Benedetto M., Bieche I., Deshayes F., Vacher S., Nouet S., Collura V., Seitz I., Louis S., Pineau P., Amsellem-Ouazana D., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Lidereau R., Nahmias C.
    Gene 380:127-136(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  13. "Differential expression in normal-adenoma-carcinoma sequence suggests complex molecular carcinogenesis in colon."
    Lee S., Bang S., Song K., Lee I.
    Oncol. Rep. 16:747-754(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis."
    Rodrigues-Ferreira S., Di Tommaso A., Dimitrov A., Cazaubon S., Gruel N., Colasson H., Nicolas A., Chaverot N., Molinie V., Reyal F., Sigal-Zafrani B., Terris B., Delattre O., Radvanyi F., Perez F., Vincent-Salomon A., Nahmias C.
    PLoS ONE 4:E7239-E7239(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ASSOCIATION WITH MICROTUBULES, SUBCELLULAR LOCATION, INDUCTION.
  17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1264 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1224 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. "Mutation analysis of the 8p22 candidate tumor suppressor gene ATIP/MTUS1 in hepatocellular carcinoma."
    Di Benedetto M., Pineau P., Nouet S., Berhouet S., Seitz I., Louis S., Dejean A., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Nahmias C.
    Mol. Cell. Endocrinol. 252:207-215(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS HCC LYS-75; SER-563; HIS-873 AND ARG-1201, VARIANTS ARG-148; MET-425; THR-453; ARG-575; THR-911 AND GLN-1105.
  20. "Genomic assessments of the frequent loss of heterozygosity region on 8p21.3 approximately p22 in head and neck squamous cell carcinoma."
    Ye H., Pungpravat N., Huang B.-L., Muzio L.L., Mariggio M.A., Chen Z., Wong D.T., Zhou X.
    Cancer Genet. Cytogenet. 176:100-106(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ARG-148 AND THR-453, VARIANT HNSCC SER-186, TISSUE SPECIFICITY.

Entry informationi

Entry nameiMTUS1_HUMAN
AccessioniPrimary (citable) accession number: Q9ULD2
Secondary accession number(s): A8K135
, B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: July 9, 2014
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi