Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ULD2 (MTUS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Microtubule-associated tumor suppressor 1
Alternative name(s):
AT2 receptor-binding protein
Angiotensin-II type 2 receptor-interacting protein
Mitochondrial tumor suppressor 1
Gene names
Name:MTUS1
Synonyms:ATBP, ATIP, GK1, KIAA1288, MTSG1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1270 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cooperates with AGTR2 to inhibit ERK2 activation and cell proliferation. May be required for AGTR2 cell surface expression. Together with PTPN6, induces UBE2V2 expression upon angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell proliferation, delays the progression of mitosis by prolonging metaphase and reduces tumor growth. Ref.2 Ref.16

Subunit structure

Homodimer. Interacts with AGTR2. Interacts with PTPN6 By similarity. Isoform 1 associates with microtubules. Ref.3

Subcellular location

Mitochondrion. Golgi apparatus By similarity. Cell membrane By similarity. Nucleus By similarity. Note: In neurons, translocates into the nucleus after treatment with angiotensin-II By similarity. Ref.1 Ref.2 Ref.16

Isoform 1: Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonspindle. Note: Localizes with the mitotic spindle during mitosis and with the intercellular bridge during cytokinesis. Ref.1 Ref.2 Ref.16

Tissue specificity

Ubiquitously expressed (at protein level). Highly expressed in brain. Down-regulated in ovarian carcinoma, pancreas carcinoma, colon carcinoma and head and neck squamous cell carcinoma (HNSCC). Isoform 1 is the major isoform inmost peripheral tissues. Isoform 2 is abundant in most peripheral tissues. Isoform 3 is the major isoform inbrain, female reproductive tissues, thyroid and heart. Within brain it is highly expressed in corpus callosum and pons. Isoform 6 is brain-specific, it is the major isoform incerebellum and fetal brain. Ref.1 Ref.2 Ref.3 Ref.11 Ref.12 Ref.13 Ref.20

Induction

Isoform 1 is down-regulated in invasive breast carcinomas (at protein level). Ref.16

Involvement in disease

Hepatocellular carcinoma (HCC) [MIM:114550]: A primary malignant neoplasm of epithelial liver cells. The major risk factors for HCC are chronic hepatitis B virus (HBV) infection, chronic hepatitis C virus (HCV) infection, prolonged dietary aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to other causes.
Note: The gene represented in this entry may be involved in disease pathogenesis. Ref.19

Sequence similarities

Belongs to the MTUS1 family.

Sequence caution

The sequence AAH07328.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence AAH33842.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB14894.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ULD2-1)

Also known as: ATIP3a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ULD2-2)

Also known as: ATIP3b;

The sequence of this isoform differs from the canonical sequence as follows:
     763-817: GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNS → A
Isoform 3 (identifier: Q9ULD2-3)

Also known as: ATIP1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-834: Missing.
     835-874: QNGSSGSFYL...RKNLFTALNA → MLLSPKFSLS...FRRSTVVFHT
Isoform 4 (identifier: Q9ULD2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-928: Missing.
     929-946: GNTKFEALTVVIQHLLSE → MGCPSSKLCLYSPCAATR
Isoform 5 (identifier: Q9ULD2-5)

Also known as: ATIP2;

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: GKPTSLKT → VLPKAAFS
     771-1270: Missing.
Note: Expressed at very low levels in most tissues.
Isoform 6 (identifier: Q9ULD2-6)

Also known as: ATIP4;

The sequence of this isoform differs from the canonical sequence as follows:
     1-753: Missing.
     754-817: QRIRRVSSSG...SELSTYSNNS → MTVPGGFRSC...LLATFTGKKT
Isoform 7 (identifier: Q9ULD2-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-855: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12701270Microtubule-associated tumor suppressor 1
PRO_0000305197

Regions

Coiled coil940 – 1231292 Potential

Amino acid modifications

Modified residue3811Phosphoserine By similarity
Modified residue12241Phosphoserine Ref.18
Modified residue12551Phosphoserine By similarity
Modified residue12641Phosphoserine Ref.17
Modified residue12681Phosphoserine Ref.17 Ref.18

Natural variations

Alternative sequence1 – 928928Missing in isoform 4.
VSP_028270
Alternative sequence1 – 855855Missing in isoform 7.
VSP_044849
Alternative sequence1 – 834834Missing in isoform 3.
VSP_028271
Alternative sequence1 – 753753Missing in isoform 6.
VSP_028272
Alternative sequence754 – 81764QRIRR…YSNNS → MTVPGGFRSCTETDISSKIF INSTLTPPAGSERHYDATLL TLLVVGSYSLCIIPLLATFT GKKT in isoform 6.
VSP_028273
Alternative sequence763 – 81755GKPTS…YSNNS → A in isoform 2.
VSP_028274
Alternative sequence763 – 7708GKPTSLKT → VLPKAAFS in isoform 5.
VSP_028275
Alternative sequence771 – 1270500Missing in isoform 5.
VSP_028276
Alternative sequence835 – 87440QNGSS…TALNA → MLLSPKFSLSTIHIRLTAKG LLRNLRLPSGFRRSTVVFHT in isoform 3.
VSP_028277
Alternative sequence929 – 94618GNTKF…HLLSE → MGCPSSKLCLYSPCAATR in isoform 4.
VSP_028278
Natural variant751Q → K in HCC. Ref.19
Corresponds to variant rs61733703 [ dbSNP | Ensembl ].
VAR_035173
Natural variant1481C → R. Ref.7 Ref.8 Ref.9 Ref.19 Ref.20
Corresponds to variant rs3739407 [ dbSNP | Ensembl ].
VAR_035174
Natural variant1861T → S in HNSCC cell lines. Ref.20
Corresponds to variant rs141609607 [ dbSNP | Ensembl ].
VAR_035175
Natural variant4251T → M. Ref.19
Corresponds to variant rs61733694 [ dbSNP | Ensembl ].
VAR_035176
Natural variant4531K → T. Ref.19 Ref.20
Corresponds to variant rs17690844 [ dbSNP | Ensembl ].
VAR_035177
Natural variant5631A → S in HCC. Ref.19
VAR_035178
Natural variant5751H → R. Ref.9 Ref.19
Corresponds to variant rs209569 [ dbSNP | Ensembl ].
VAR_035179
Natural variant8731N → H in HCC. Ref.19
Corresponds to variant rs187103704 [ dbSNP | Ensembl ].
VAR_035180
Natural variant9111K → T. Ref.19
Corresponds to variant rs61748836 [ dbSNP | Ensembl ].
VAR_035181
Natural variant10631K → T. Ref.8
Corresponds to variant rs17853231 [ dbSNP | Ensembl ].
VAR_035182
Natural variant11051E → Q. Ref.19
Corresponds to variant rs61733705 [ dbSNP | Ensembl ].
VAR_035183
Natural variant12011Q → R in HCC. Ref.19
VAR_035184

Experimental info

Sequence conflict2661C → G in CAB50791. Ref.5
Sequence conflict9181F → L in BAG37243. Ref.4
Sequence conflict9991E → G in CAH56128. Ref.5
Sequence conflict11491I → T in BAB14894. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (ATIP3a) [UniParc].

Last modified October 2, 2007. Version 2.
Checksum: 2EAE962F627BFFE3

FASTA1,270141,397
        10         20         30         40         50         60 
MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN PDDMVVDYET 

        70         80         90        100        110        120 
DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD SICQCPALVG TEKPKYLQHS 

       130        140        150        160        170        180 
CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG YCDALELNQT FDMTVDKVNC TFISHHAIGK 

       190        200        210        220        230        240 
SQSFHTAGSL PPTGRRSGST SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD 

       250        260        270        280        290        300 
MTYTAFSDVV MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME 

       310        320        330        340        350        360 
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC PLMVPAFDKS 

       370        380        390        400        410        420 
EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP PGQKVGSSFG LTWDANDMVI 

       430        440        450        460        470        480 
STDKTMCMST PVLEPTKVTF SVSPIEATEK CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG 

       490        500        510        520        530        540 
KSTIKTNTPI GCKVRKTEII SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS 

       550        560        570        580        590        600 
SPSSVNSRQQ TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR 

       610        620        630        640        650        660 
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC LEMTYVPNID 

       670        680        690        700        710        720 
RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA SKTTTTSGRN ISKPDSCGLR 

       730        740        750        760        770        780 
QIAAPKAKVG PPVSCLRRNS DNRNPSADRA VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR 

       790        800        810        820        830        840 
PLPKSKASLK SPALRRTGST PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG 

       850        860        870        880        890        900 
SFYLKPLVSR AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE 

       910        920        930        940        950        960 
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA LKQHKTLSQE 

       970        980        990       1000       1010       1020 
LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK TERENRLKEF YTREYEKLRD 

      1030       1040       1050       1060       1070       1080 
TYIEEAEKYK MQLQEQFDNL NAAHETSKLE IEASHSEKLE LLKKAYEASL SEIKKGHEIE 

      1090       1100       1110       1120       1130       1140 
KKSLEDLLSE KQESLEKQIN DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL 

      1150       1160       1170       1180       1190       1200 
ESLKAVLEIK NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR 

      1210       1220       1230       1240       1250       1260 
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA IPLQSPRNSG 

      1270 
SFPSPSISPR 

« Hide

Isoform 2 (ATIP3b) [UniParc].

Checksum: ECC10DC1CA22BF72
Show »

FASTA1,216135,661
Isoform 3 (ATIP1) [UniParc].

Checksum: 196002F8C8D9A6DD
Show »

FASTA43650,544
Isoform 4 [UniParc].

Checksum: 20C0995FFE927E24
Show »

FASTA34239,775
Isoform 5 (ATIP2) [UniParc].

Checksum: 46E8EA82686165D8
Show »

FASTA77084,252
Isoform 6 (ATIP4) [UniParc].

Checksum: 43755CC4B064F012
Show »

FASTA51758,988
Isoform 7 [UniParc].

Checksum: 91955F97EA18D77D
Show »

FASTA41548,050

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of two novel genes on chromosome 8p21.3."
Kinjo T., Isomura M., Iwamasa T., Nakamura Y.
J. Hum. Genet. 45:12-17(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[2]"Identification of a new tumor suppressor gene located at chromosome 8p21.3-22."
Seibold S., Rudroff C., Weber M., Galle J., Wanner C., Marx M.
FASEB J. 17:1180-1182(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[3]"Trans-inactivation of receptor tyrosine kinases by novel angiotensin II AT2 receptor-interacting protein, ATIP."
Nouet S., Amzallag N., Li J.-M., Louis S., Seitz I., Cui T.-X., Alleaume A.-M., Di Benedetto M., Boden C., Masson M., Strosberg A.D., Horiuchi M., Couraud P.-O., Nahmias C.
J. Biol. Chem. 279:28989-28997(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORMS 1; 5 AND 6), SUBUNIT, TISSUE SPECIFICITY.
Tissue: Lung.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 875-1270 (ISOFORM 1).
Tissue: Brain, Fetal brain and Placenta.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 266-1270 (ISOFORM 5).
Tissue: Salivary gland and Uterus.
[6]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-148.
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ARG-148 AND THR-1063.
Tissue: Ovary, Skin and Testis.
[9]"Differential expression in normal trophoblast and gestational tumors."
Abadie P.A., Genti-Raimondi S.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-891 (ISOFORM 2), VARIANTS ARG-148 AND ARG-575.
[10]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-1270 (ISOFORM 1).
Tissue: Brain.
[11]"Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival."
Pils D., Horak P., Gleiss A., Sax C., Fabjani G., Moebus V.J., Zielinski C., Reinthaller A., Zeillinger R., Krainer M.
Cancer 104:2417-2429(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[12]"Structural organization and expression of human MTUS1, a candidate 8p22 tumor suppressor gene encoding a family of angiotensin II AT2 receptor-interacting proteins, ATIP."
Di Benedetto M., Bieche I., Deshayes F., Vacher S., Nouet S., Collura V., Seitz I., Louis S., Pineau P., Amsellem-Ouazana D., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Lidereau R., Nahmias C.
Gene 380:127-136(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[13]"Differential expression in normal-adenoma-carcinoma sequence suggests complex molecular carcinogenesis in colon."
Lee S., Bang S., Song K., Lee I.
Oncol. Rep. 16:747-754(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[14]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[15]"Large-scale proteomics analysis of the human kinome."
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H.
Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[16]"8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis."
Rodrigues-Ferreira S., Di Tommaso A., Dimitrov A., Cazaubon S., Gruel N., Colasson H., Nicolas A., Chaverot N., Molinie V., Reyal F., Sigal-Zafrani B., Terris B., Delattre O., Radvanyi F., Perez F., Vincent-Salomon A., Nahmias C.
PLoS ONE 4:E7239-E7239(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, ASSOCIATION WITH MICROTUBULES, SUBCELLULAR LOCATION, INDUCTION.
[17]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1264 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[18]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1224 AND SER-1268, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[19]"Mutation analysis of the 8p22 candidate tumor suppressor gene ATIP/MTUS1 in hepatocellular carcinoma."
Di Benedetto M., Pineau P., Nouet S., Berhouet S., Seitz I., Louis S., Dejean A., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Nahmias C.
Mol. Cell. Endocrinol. 252:207-215(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS HCC LYS-75; SER-563; HIS-873 AND ARG-1201, VARIANTS ARG-148; MET-425; THR-453; ARG-575; THR-911 AND GLN-1105.
[20]"Genomic assessments of the frequent loss of heterozygosity region on 8p21.3 approximately p22 in head and neck squamous cell carcinoma."
Ye H., Pungpravat N., Huang B.-L., Muzio L.L., Mariggio M.A., Chen Z., Wong D.T., Zhou X.
Cancer Genet. Cytogenet. 176:100-106(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS ARG-148 AND THR-453, VARIANT HNSCC SER-186, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF121259 mRNA. Translation: AAG33674.1.
AF293357 mRNA. Translation: AAL37035.1.
AK024357 mRNA. Translation: BAB14894.1. Different initiation.
AK125188 mRNA. Translation: BAG54161.1.
AK289750 mRNA. Translation: BAF82439.1.
AK294860 mRNA. Translation: BAG57964.1.
AK314692 mRNA. Translation: BAG37243.1.
AL096842 mRNA. Translation: CAB50791.1.
BX648879 mRNA. Translation: CAH56128.1.
AC027117 Genomic DNA. No translation available.
AC124069 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63804.1.
CH471080 Genomic DNA. Translation: EAW63805.1.
CH471080 Genomic DNA. Translation: EAW63810.1.
BC007328 mRNA. Translation: AAH07328.1. Sequence problems.
BC033842 mRNA. Translation: AAH33842.1. Different initiation.
BC136320 mRNA. Translation: AAI36321.1.
BC142971 mRNA. Translation: AAI42972.1.
AY363099 mRNA. Translation: AAQ24172.1.
AB033114 mRNA. Translation: BAA86602.1.
CCDSCCDS43716.1. [Q9ULD2-2]
CCDS43717.1. [Q9ULD2-1]
CCDS43718.1. [Q9ULD2-6]
CCDS43719.1. [Q9ULD2-3]
CCDS55204.1. [Q9ULD2-7]
RefSeqNP_001001924.1. NM_001001924.2. [Q9ULD2-1]
NP_001001925.1. NM_001001925.2. [Q9ULD2-2]
NP_001001931.1. NM_001001931.2. [Q9ULD2-6]
NP_001159865.1. NM_001166393.1. [Q9ULD2-7]
NP_065800.1. NM_020749.4. [Q9ULD2-3]
XP_005273636.1. XM_005273579.2. [Q9ULD2-1]
XP_005273639.1. XM_005273582.2. [Q9ULD2-2]
UniGeneHs.7946.

3D structure databases

ProteinModelPortalQ9ULD2.
SMRQ9ULD2. Positions 1202-1234.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121573. 4 interactions.
IntActQ9ULD2. 3 interactions.

PTM databases

PhosphoSiteQ9ULD2.

Polymorphism databases

DMDM158706128.

Proteomic databases

MaxQBQ9ULD2.
PaxDbQ9ULD2.
PRIDEQ9ULD2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
ENST00000381862; ENSP00000371286; ENSG00000129422. [Q9ULD2-5]
ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
ENST00000400046; ENSP00000382921; ENSG00000129422. [Q9ULD2-4]
ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
GeneID57509.
KEGGhsa:57509.
UCSCuc003wxs.3. human. [Q9ULD2-3]
uc003wxt.3. human. [Q9ULD2-6]
uc003wxv.3. human. [Q9ULD2-1]
uc003wxw.3. human. [Q9ULD2-2]
uc011kyg.2. human.

Organism-specific databases

CTD57509.
GeneCardsGC08M017501.
HGNCHGNC:29789. MTUS1.
MIM114550. phenotype.
609589. gene.
neXtProtNX_Q9ULD2.
PharmGKBPA134968054.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG117251.
HOVERGENHBG108158.
InParanoidQ9ULD2.
OMAQEFFCLS.
OrthoDBEOG76X5Z9.
PhylomeDBQ9ULD2.
TreeFamTF333416.

Gene expression databases

ArrayExpressQ9ULD2.
BgeeQ9ULD2.
CleanExHS_MTUS1.
GenevestigatorQ9ULD2.

Family and domain databases

ProtoNetSearch...

Other

ChiTaRSMTUS1. human.
GeneWikiMTUS1.
GenomeRNAi57509.
NextBio63856.
PROQ9ULD2.
SOURCESearch...

Entry information

Entry nameMTUS1_HUMAN
AccessionPrimary (citable) accession number: Q9ULD2
Secondary accession number(s): A8K135 expand/collapse secondary AC list , B2RBJ6, B3KWJ9, B4DH03, B9EGA1, D3DSP8, Q63HJ6, Q659F4, Q6PK49, Q6URW7, Q8N4M6, Q8WTT9, Q9H7T2
Entry history
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: July 9, 2014
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM