Q9ULC5 (ACSL5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Long-chain-fatty-acid--CoA ligase 5 EC=6.2.1.3 Alternative name(s): Long-chain acyl-CoA synthetase 5 Short name=LACS 5 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 683 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage By similarity. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids By similarity. It was suggested that it may also stimulate fatty acid oxidation By similarity. At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. Ref.8 Ref.9 Ref.10 |
| Catalytic activity | ATP + a long-chain carboxylic acid + CoA = AMP + diphosphate + an acyl-CoA. |
| Cofactor | Magnesium By similarity. |
| Subcellular location | Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane; Single-pass type III membrane protein By similarity. Endoplasmic reticulum membrane; Single-pass type III membrane protein By similarity Ref.8 Ref.10. |
| Sequence similarities | Belongs to the ATP-dependent AMP-binding enzyme family. |
| Biophysicochemical properties | Kinetic parameters: KM=0.11 µM for palmitic acid (isoform 1 at pH 7.5) Ref.8 KM=0.38 µM for palmitic acid (isoform 1 at pH 9.5) KM=0.04 µM for palmitic acid (isoform 3 at pH 7.5) KM=0.15 µM for palmitic acid (isoform 3 at pH 8.5) pH dependence: |
| Sequence caution | The sequence BAA85979.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA86054.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ULC5-1) Also known as: ACSL5b; ACSL5-fl; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Localize in mitochodrion and endoplasmic reticulum. | ||||||
| Isoform 2 (identifier: Q9ULC5-3) Also known as: ACSL5a; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKM | ||||||
| Isoform 3 (identifier: Q9ULC5-4) Also known as: ACSL5delta20; The sequence of this isoform differs from the canonical sequence as follows: 614-637: Missing. | ||||||
| Note: Localize in mitochodrion and endoplasmic reticulum. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 683 | 683 | Long-chain-fatty-acid--CoA ligase 5 | PRO_0000193112 | |||||
Regions | |||||||||
| Transmembrane | 12 – 32 | 21 | Helical; Signal-anchor for type III membrane protein; Potential | ||||||
| Topological domain | 33 – 683 | 651 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MDALKPPCLWRNHERGKKDR DSCGRKNSEPGSPHSLEALR DAAPSQGLNFLLLFTKM in isoform 2. | VSP_037947 | |||||
| Alternative sequence | 614 – 637 | 24 | Missing in isoform 3. | VSP_038233 | |||||
| Natural variant | 182 | 1 | M → V. Corresponds to variant rs3736946 [ dbSNP | Ensembl ]. | VAR_022117 | |||||
| Natural variant | 388 | 1 | K → R in a colorectal cancer sample; somatic mutation. Ref.11 | VAR_036377 | |||||
| Natural variant | 466 | 1 | G → D in a colorectal cancer sample; somatic mutation. Ref.11 | VAR_036378 | |||||
| Natural variant | 486 | 1 | T → A. Corresponds to variant rs12254915 [ dbSNP | Ensembl ]. | VAR_048240 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hepatoma. |
| [3] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Liver. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [7] | "Human FACL5 (or ACS5)." Yamashita Y. Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2). |
| [8] | "Regulation of enterocyte apoptosis by acyl-CoA synthetase 5 splicing." Gassler N., Roth W., Funke B., Schneider A., Herzog F., Ehemann V., Sykora J., Haas T.L., Walczak H., Ganten T., Zentgraf H., Erb P., Alonso A., Autschbach F., Schirmacher P., Knuechel R., Kopitz J. Gastroenterology 133:587-598(2007) [PubMed: 17681178] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, BIOPHYSICOCHEMICAL PROPERTIES. |
| [9] | "Acyl-CoA synthetase as a cancer survival factor: its inhibition enhances the efficacy of etoposide." Mashima T., Sato S., Okabe S., Miyata S., Matsuura M., Sugimoto Y., Tsuruo T., Seimiya H. Cancer Sci. 100:1556-1562(2009) [PubMed: 19459852] [Abstract] Cited for: FUNCTION. |
| [10] | "Promotion of glioma cell survival by acyl-CoA synthetase 5 under extracellular acidosis conditions." Mashima T., Sato S., Sugimoto Y., Tsuruo T., Seimiya H. Oncogene 28:9-19(2009) [PubMed: 18806831] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [11] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-388 AND ASP-466. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358520 mRNA. Translation: AAQ88884.1. AK000339 mRNA. No translation available. AK222782 mRNA. No translation available. AL157786 Genomic DNA. Translation: CAH72510.1. CH471066 Genomic DNA. Translation: EAW49532.1. CH471066 Genomic DNA. Translation: EAW49535.1. CH471066 Genomic DNA. Translation: EAW49536.1. CH471066 Genomic DNA. Translation: EAW49539.1. BC007985 mRNA. Translation: AAH07985.2. AB033899 mRNA. Translation: BAA85979.1. Different initiation. AB033920 Genomic DNA. Translation: BAA86054.1. Sequence problems. |
| IPI | IPI00008037. IPI00401990. IPI00854706. |
| RefSeq | NP_057318.2. NM_016234.3. NP_976313.1. NM_203379.1. NP_976314.1. NM_203380.1. |
| UniGene | Hs.11638. |
3D structure databases | |
| ProteinModelPortal | Q9ULC5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9ULC5. |
PTM databases | |
| PhosphoSite | Q9ULC5. |
Polymorphism databases | |
| DMDM | 13431659. |
Proteomic databases | |
| PRIDE | Q9ULC5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000354273; ENSP00000346223; ENSG00000197142. ENST00000354655; ENSP00000346680; ENSG00000197142. ENST00000356116; ENSP00000348429; ENSG00000197142. ENST00000393081; ENSP00000376796; ENSG00000197142. |
| GeneID | 51703. |
| KEGG | hsa:51703. |
| UCSC | uc001kzs.1. human. |
Organism-specific databases | |
| CTD | 51703. |
| GeneCards | GC10P114123. |
| H-InvDB | HIX0009206. |
| HGNC | HGNC:16526. ACSL5. |
| MIM | 605677. gene. |
| neXtProt | NX_Q9ULC5. |
| PharmGKB | PA27969. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09605. |
| GeneTree | ENSGT00600000084142. |
| HOGENOM | HBG721674. |
| HOVERGEN | HBG050452. |
| InParanoid | Q9ULC5. |
| OMA | YFASNGE. |
| OrthoDB | EOG4P2Q1T. |
| PhylomeDB | Q9ULC5. |
Enzyme and pathway databases | |
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. |
Gene expression databases | |
| ArrayExpress | Q9ULC5. |
| Bgee | Q9ULC5. |
| CleanEx | HS_ACSL5. |
| Genevestigator | Q9ULC5. |
| GermOnline | ENSG00000197142. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020845. AMP-binding_CS. IPR000873. AMP-dep_Synth/Lig. [Graphical view] |
| KO | K01897. |
| Pfam | PF00501. AMP-binding. 1 hit. [Graphical view] |
| PROSITE | PS00455. AMP_BINDING. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 55732. |
| SOURCE | Search... |
Entry information
| Entry name | ACSL5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULC5 Secondary accession number(s): D3DRB3, Q6UX44, Q9UIU4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with