Q9ULB1 (NRX1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neurexin-1 Alternative name(s): Neurexin I-alpha Neurexin-1-alpha | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1477 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom By similarity. |
| Subunit structure | Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer. Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent. Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3. Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 By similarity. Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 By similarity. Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latroxin from spider venom. The cytoplasmic C-terminal region binds to CASK, CASKIN1 and APBA1. Interacts with SYT13 and SYTL1 By similarity. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Probable. Cell junction › synapse Probable. Note: Localized on the pre-synaptic membrane By similarity. |
| Tissue specificity | Brain. Ref.3 |
| Post-translational modification | N-glycosylated By similarity. O-glycosylated By similarity. |
| Sequence similarities | Belongs to the neurexin family. Contains 3 EGF-like domains. Contains 6 laminin G-like domains. |
| Sequence caution | The sequence BAA25504.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing. | ||||||
| Isoform 1a (identifier: Q9ULB1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2a (identifier: Q9ULB1-2) The sequence of this isoform differs from the canonical sequence as follows: 379-386: Missing. 1240-1240: G → GNNDNERLAIARQRIPYRLGRVVDEWLLDKG | ||||||
| Note: Produced by alternative splicing. No experimental confirmation available. | ||||||
| Isoform 3a (identifier: Q9ULB1-3) The sequence of this isoform differs from the canonical sequence as follows: 258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK 386-386: M → MVNKLHCS 1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 1b (identifier: P58400-1) The sequence of this isoform can be found in the external entry P58400. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | By similarity | ||||||||
| Chain | 31 – 1477 | 1447 | Neurexin-1 | PRO_0000019490 | |||||||
Regions | |||||||||||
| Topological domain | 31 – 1401 | 1371 | Extracellular Potential | ||||||||
| Transmembrane | 1402 – 1422 | 21 | Helical; Potential | ||||||||
| Topological domain | 1423 – 1477 | 55 | Cytoplasmic Potential | ||||||||
| Domain | 31 – 217 | 187 | Laminin G-like 1 | ||||||||
| Domain | 213 – 256 | 44 | EGF-like 1 | ||||||||
| Domain | 283 – 473 | 191 | Laminin G-like 2 | ||||||||
| Domain | 480 – 672 | 193 | Laminin G-like 3 | ||||||||
| Domain | 676 – 713 | 38 | EGF-like 2 | ||||||||
| Domain | 718 – 891 | 174 | Laminin G-like 4 | ||||||||
| Domain | 905 – 1080 | 176 | Laminin G-like 5 | ||||||||
| Domain | 1083 – 1120 | 38 | EGF-like 3 | ||||||||
| Domain | 1126 – 1294 | 169 | Laminin G-like 6 | ||||||||
| Compositional bias | 1324 – 1327 | 4 | Poly-Thr | ||||||||
| Compositional bias | 1409 – 1412 | 4 | Poly-Ala | ||||||||
Sites | |||||||||||
| Metal binding | 329 | 1 | Calcium By similarity | ||||||||
| Metal binding | 329 | 1 | Calcium 1 By similarity | ||||||||
| Metal binding | 346 | 1 | Calcium 1; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 407 | 1 | Calcium 1; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 765 | 1 | Calcium 2 By similarity | ||||||||
| Metal binding | 782 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 841 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 1176 | 1 | Calcium 3 By similarity | ||||||||
| Metal binding | 1193 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 1245 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 1247 | 1 | Calcium 3 By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 125 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 190 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 790 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1223 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 228 ↔ 243 | By similarity | |||||||||
| Disulfide bond | 245 ↔ 255 | By similarity | |||||||||
| Disulfide bond | 437 ↔ 473 | By similarity | |||||||||
| Disulfide bond | 643 ↔ 672 | By similarity | |||||||||
| Disulfide bond | 680 ↔ 691 | By similarity | |||||||||
| Disulfide bond | 685 ↔ 700 | By similarity | |||||||||
| Disulfide bond | 702 ↔ 712 | By similarity | |||||||||
| Disulfide bond | 1052 ↔ 1080 | By similarity | |||||||||
| Disulfide bond | 1087 ↔ 1098 | By similarity | |||||||||
| Disulfide bond | 1092 ↔ 1107 | By similarity | |||||||||
| Disulfide bond | 1109 ↔ 1119 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 258 | 1 | E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a. | VSP_041353 | |||||||
| Alternative sequence | 379 – 386 | 8 | Missing in isoform 2a. | VSP_014541 | |||||||
| Alternative sequence | 386 | 1 | M → MVNKLHCS in isoform 3a. | VSP_041354 | |||||||
| Alternative sequence | 1239 | 1 | A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a. | VSP_041355 | |||||||
| Alternative sequence | 1240 | 1 | G → GNNDNERLAIARQRIPYRLG RVVDEWLLDKG in isoform 2a. | VSP_014542 | |||||||
| Natural variant | 400 | 1 | Y → N. Corresponds to variant rs17040901 [ dbSNP | Ensembl ]. | VAR_050265 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1373 – 1375 | 3 | Missing in BAA25504. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Disruption of neurexin 1 associated with autism spectrum disorder." Kim H.G., Kishikawa S., Higgins A.W., Seong I.S., Donovan D.J., Shen Y., Lally E., Weiss L.A., Najm J., Kutsche K., Descartes M., Holt L., Braddock S., Troxell R., Kaplan L., Volkmar F., Klin A., Tsatsanis K. Gusella J.F.Am. J. Hum. Genet. 82:199-207(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A). |
| [2] | "Human neurexin I-alpha." Seki N., Yoshikawa T., Azuma T., Saito T., Muramatsu M. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). Tissue: Brain. |
| [3] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2A), TISSUE SPECIFICITY. Tissue: Brain. |
| [4] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity." Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R. Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | EF539882 mRNA. Translation: ABS86974.1. AB035356 mRNA. Translation: BAA87821.1. AB011150 mRNA. Translation: BAA25504.2. Different initiation. AC007462 Genomic DNA. Translation: AAF03536.1. AC007682 Genomic DNA. Translation: AAY14894.1. AC009234 Genomic DNA. Translation: AAY14944.1. AC068725 Genomic DNA. Translation: AAG59602.1. AC069550 Genomic DNA. Translation: AAG38120.1. AC078994 Genomic DNA. Translation: AAK06387.1. AC068715 Genomic DNA. Translation: AAG59642.1. |
| IPI | IPI00442299. IPI00855821. IPI01010752. |
| RefSeq | NP_001129131.1. NM_001135659.1. NP_004792.1. NM_004801.4. NP_620072.1. NM_138735.2. |
| UniGene | Hs.637685. |
3D structure databases | |
| ProteinModelPortal | Q9ULB1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9ULB1. 4 interactions. |
PTM databases | |
| PhosphoSite | Q9ULB1. |
Polymorphism databases | |
| DMDM | 17369704. |
Proteomic databases | |
| PaxDb | Q9ULB1. |
| PRIDE | Q9ULB1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000404971; ENSP00000385142; ENSG00000179915. ENST00000405472; ENSP00000434015; ENSG00000179915. ENST00000406316; ENSP00000384311; ENSG00000179915. |
| GeneID | 9378. |
| KEGG | hsa:9378. |
| UCSC | uc021vhg.1. human. uc021vhh.1. human. |
Organism-specific databases | |
| CTD | 9378. |
| GeneCards | GC02M050145. |
| HGNC | HGNC:8008. NRXN1. |
| MIM | 600565. gene. |
| neXtProt | NX_Q9ULB1. |
| Orphanet | 106. Autism. 221150. Pitt-Hopkins-like syndrome. 3140. Schizophrenia. |
| PharmGKB | PA31786. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG302266. |
| HOVERGEN | HBG052670. |
| KO | K07377. |
| OrthoDB | EOG41G339. |
Gene expression databases | |
| ArrayExpress | Q9ULB1. |
| Bgee | Q9ULB1. |
| CleanEx | HS_NRXN1. |
| Genevestigator | Q9ULB1. |
Family and domain databases | |
| Gene3D | 2.60.120.200. 6 hits. |
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR013320. ConA-like_subgrp. IPR000742. EG-like_dom. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR001791. Laminin_G. IPR003585. Neurexin-like. IPR027158. NRXN1-alpha. [Graphical view] |
| PANTHER | PTHR10127:SF309. PTHR10127:SF309. 1 hit. |
| Pfam | PF02210. Laminin_G_2. 6 hits. [Graphical view] |
| SMART | SM00294. 4.1m. 1 hit. SM00181. EGF. 3 hits. SM00282. LamG. 6 hits. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 6 hits. |
| PROSITE | PS00010. ASX_HYDROXYL. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. False negative. PS50026. EGF_3. 3 hits. PS50025. LAM_G_DOMAIN. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NRXN1. human. |
| GenomeRNAi | 9378. |
| NextBio | 35134. |
| SOURCE | Search... |
Entry information
| Entry name | NRX1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9ULB1 Secondary accession number(s): A7KRL9 Q9UDM6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
