Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9ULB1

- NRX1A_HUMAN

UniProt

Q9ULB1 - NRX1A_HUMAN

Protein

Neurexin-1

Gene

NRXN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 145 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi329 – 3291CalciumBy similarity
    Metal bindingi329 – 3291Calcium 1By similarity
    Metal bindingi346 – 3461Calcium 1; via carbonyl oxygenBy similarity
    Metal bindingi407 – 4071Calcium 1; via carbonyl oxygenBy similarity
    Metal bindingi765 – 7651Calcium 2By similarity
    Metal bindingi782 – 7821Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi841 – 8411Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi1176 – 11761Calcium 3By similarity
    Metal bindingi1193 – 11931Calcium 3; via carbonyl oxygenBy similarity
    Metal bindingi1245 – 12451Calcium 3; via carbonyl oxygenBy similarity
    Metal bindingi1247 – 12471Calcium 3By similarity

    GO - Molecular functioni

    1. acetylcholine receptor binding Source: BHF-UCL
    2. calcium channel regulator activity Source: BHF-UCL
    3. calcium ion binding Source: BHF-UCL
    4. cell adhesion molecule binding Source: BHF-UCL
    5. neuroligin family protein binding Source: BHF-UCL
    6. protein binding Source: UniProtKB
    7. receptor activity Source: ProtInc

    GO - Biological processi

    1. adult behavior Source: BHF-UCL
    2. axon guidance Source: ProtInc
    3. extracellular matrix organization Source: Reactome
    4. gephyrin clustering Source: BHF-UCL
    5. learning Source: BHF-UCL
    6. neuroligin clustering Source: BHF-UCL
    7. neuromuscular process controlling balance Source: BHF-UCL
    8. neuron cell-cell adhesion Source: BHF-UCL
    9. neurotransmitter secretion Source: BHF-UCL
    10. positive regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
    11. positive regulation of synapse assembly Source: BHF-UCL
    12. positive regulation of synapse maturation Source: BHF-UCL
    13. positive regulation of synaptic transmission, glutamatergic Source: BHF-UCL
    14. postsynaptic density protein 95 clustering Source: BHF-UCL
    15. postsynaptic membrane assembly Source: BHF-UCL
    16. prepulse inhibition Source: Ensembl
    17. regulation of grooming behavior Source: Ensembl
    18. social behavior Source: BHF-UCL
    19. synapse assembly Source: BHF-UCL
    20. synaptic transmission Source: BHF-UCL
    21. vocalization behavior Source: BHF-UCL
    22. vocal learning Source: BHF-UCL

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_163874. Non-integrin membrane-ECM interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neurexin-1
    Alternative name(s):
    Neurexin I-alpha
    Neurexin-1-alpha
    Gene namesi
    Name:NRXN1
    Synonyms:KIAA0578
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:8008. NRXN1.

    Subcellular locationi

    Cell membrane Curated; Single-pass type I membrane protein Curated. Cell junctionsynapse Curated
    Note: Localized on the pre-synaptic membrane.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cell surface Source: BHF-UCL
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: BHF-UCL
    5. presynaptic membrane Source: BHF-UCL

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31786.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3030By similarityAdd
    BLAST
    Chaini31 – 14771447Neurexin-1PRO_0000019490Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi125 – 1251N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi228 ↔ 243By similarity
    Disulfide bondi245 ↔ 255By similarity
    Disulfide bondi437 ↔ 473By similarity
    Disulfide bondi643 ↔ 672By similarity
    Disulfide bondi680 ↔ 691By similarity
    Disulfide bondi685 ↔ 700By similarity
    Disulfide bondi702 ↔ 712By similarity
    Glycosylationi790 – 7901N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1052 ↔ 1080By similarity
    Disulfide bondi1087 ↔ 1098By similarity
    Disulfide bondi1092 ↔ 1107By similarity
    Disulfide bondi1109 ↔ 1119By similarity
    Glycosylationi1223 – 12231N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.By similarity
    O-glycosylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9ULB1.
    PRIDEiQ9ULB1.

    PTM databases

    PhosphoSiteiQ9ULB1.

    Expressioni

    Tissue specificityi

    Brain.1 Publication

    Gene expression databases

    ArrayExpressiQ9ULB1.
    BgeeiQ9ULB1.
    CleanExiHS_NRXN1.
    GenevestigatoriQ9ULB1.

    Interactioni

    Subunit structurei

    Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer. Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent. Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3. Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 By similarity. Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 By similarity. Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latrotoxin from spider venom. The cytoplasmic C-terminal region binds to CASK, CASKIN1 and APBA1. Interacts with SYT13 and SYTL1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi114779. 11 interactions.
    IntActiQ9ULB1. 4 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9ULB1.
    SMRiQ9ULB1. Positions 209-257, 281-1300.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini31 – 14011371ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1423 – 147755CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1402 – 142221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini31 – 217187Laminin G-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini213 – 25644EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini283 – 473191Laminin G-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini480 – 672193Laminin G-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini676 – 71338EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini718 – 891174Laminin G-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini905 – 1080176Laminin G-like 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini1083 – 112038EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1126 – 1294169Laminin G-like 6PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1324 – 13274Poly-Thr
    Compositional biasi1409 – 14124Poly-Ala

    Sequence similaritiesi

    Belongs to the neurexin family.Curated
    Contains 3 EGF-like domains.PROSITE-ProRule annotation
    Contains 6 laminin G-like domains.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG302266.
    HOVERGENiHBG052670.
    KOiK07377.
    OMAiDCSQEIK.
    OrthoDBiEOG7XWPMM.
    PhylomeDBiQ9ULB1.
    TreeFamiTF321302.

    Family and domain databases

    Gene3Di2.60.120.200. 6 hits.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view]
    PfamiPF02210. Laminin_G_2. 6 hits.
    PF01034. Syndecan. 1 hit.
    [Graphical view]
    SMARTiSM00294. 4.1m. 1 hit.
    SM00181. EGF. 3 hits.
    SM00282. LamG. 6 hits.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 6 hits.
    PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
    PS50026. EGF_3. 3 hits.
    PS50025. LAM_G_DOMAIN. 6 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing.2 Publications

    Isoform 1a (identifier: Q9ULB1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGTALLQRGG CFLLCLSLLL LGCWAELGSG LEFPGAEGQW TRFPKWNACC     50
    ESEMSFQLKT RSARGLVLYF DDEGFCDFLE LILTRGGRLQ LSFSIFCAEP 100
    ATLLADTPVN DGAWHSVRIR RQFRNTTLFI DQVEAKWVEV KSKRRDMTVF 150
    SGLFVGGLPP ELRAAALKLT LASVREREPF KGWIRDVRVN SSQVLPVDSG 200
    EVKLDDEPPN SGGGSPCEAG EEGEGGVCLN GGVCSVVDDQ AVCDCSRTGF 250
    RGKDCSQEDN NVEGLAHLMM GDQGKSKGKE EYIATFKGSE YFCYDLSQNP 300
    IQSSSDEITL SFKTLQRNGL MLHTGKSADY VNLALKNGAV SLVINLGSGA 350
    FEALVEPVNG KFNDNAWHDV KVTRNLRQHS GIGHAMVTIS VDGILTTTGY 400
    TQEDYTMLGS DDFFYVGGSP STADLPGSPV SNNFMGCLKE VVYKNNDVRL 450
    ELSRLAKQGD PKMKIHGVVA FKCENVATLD PITFETPESF ISLPKWNAKK 500
    TGSISFDFRT TEPNGLILFS HGKPRHQKDA KHPQMIKVDF FAIEMLDGHL 550
    YLLLDMGSGT IKIKALLKKV NDGEWYHVDF QRDGRSGTIS VNTLRTPYTA 600
    PGESEILDLD DELYLGGLPE NKAGLVFPTE VWTALLNYGY VGCIRDLFID 650
    GQSKDIRQMA EVQSTAGVKP SCSKETAKPC LSNPCKNNGM CRDGWNRYVC 700
    DCSGTGYLGR SCEREATVLS YDGSMFMKIQ LPVVMHTEAE DVSLRFRSQR 750
    AYGILMATTS RDSADTLRLE LDAGRVKLTV NLDCIRINCN SSKGPETLFA 800
    GYNLNDNEWH TVRVVRRGKS LKLTVDDQQA MTGQMAGDHT RLEFHNIETG 850
    IITERRYLSS VPSNFIGHLQ SLTFNGMAYI DLCKNGDIDY CELNARFGFR 900
    NIIADPVTFK TKSSYVALAT LQAYTSMHLF FQFKTTSLDG LILYNSGDGN 950
    DFIVVELVKG YLHYVFDLGN GANLIKGSSN KPLNDNQWHN VMISRDTSNL 1000
    HTVKIDTKIT TQITAGARNL DLKSDLYIGG VAKETYKSLP KLVHAKEGFQ 1050
    GCLASVDLNG RLPDLISDAL FCNGQIERGC EGPSTTCQED SCSNQGVCLQ 1100
    QWDGFSCDCS MTSFSGPLCN DPGTTYIFSK GGGQITYKWP PNDRPSTRAD 1150
    RLAIGFSTVQ KEAVLVRVDS SSGLGDYLEL HIHQGKIGVK FNVGTDDIAI 1200
    EESNAIINDG KYHVVRFTRS GGNATLQVDS WPVIERYPAG RQLTIFNSQA 1250
    TIIIGGKEQG QPFQGQLSGL YYNGLKVLNM AAENDANIAI VGNVRLVGEV 1300
    PSSMTTESTA TAMQSEMSTS IMETTTTLAT STARRGKPPT KEPISQTTDD 1350
    ILVASAECPS DDEDIDPCEP SSGGLANPTR AGGREPYPGS AEVIRESSST 1400
    TGMVVGIVAA AALCILILLY AMYKYRNRDE GSYHVDESRN YISNSAQSNG 1450
    AVVKEKQPSS AKSSNKNKKN KDKEYYV 1477
    Length:1,477
    Mass (Da):161,883
    Last modified:May 1, 2000 - v1
    Checksum:iFF845FB428B1A683
    GO
    Isoform 2a (identifier: Q9ULB1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         379-386: Missing.
         1240-1240: G → GNNDNERLAIARQRIPYRLGRVVDEWLLDKG

    Note: Produced by alternative splicing. No experimental confirmation available.

    Show »
    Length:1,499
    Mass (Da):164,655
    Checksum:iF8481191C84C9CD7
    GO
    Isoform 3a (identifier: Q9ULB1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK
         386-386: M → MVNKLHCS
         1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK

    Note: Produced by alternative splicing.

    Show »
    Length:1,547
    Mass (Da):169,913
    Checksum:i2F6A3FBB6E53AA2E
    GO
    Isoform 1b (identifier: P58400-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry P58400.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:442
    Mass (Da):46,861
    GO

    Sequence cautioni

    The sequence BAA25504.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1373 – 13753Missing in BAA25504. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti28 – 281G → A.1 Publication
    VAR_070274
    Natural varianti400 – 4001Y → N.
    Corresponds to variant rs17040901 [ dbSNP | Ensembl ].
    VAR_050265

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei258 – 2581E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a. 1 PublicationVSP_041353
    Alternative sequencei379 – 3868Missing in isoform 2a. 1 PublicationVSP_014541
    Alternative sequencei386 – 3861M → MVNKLHCS in isoform 3a. 1 PublicationVSP_041354
    Alternative sequencei1239 – 12391A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a. 1 PublicationVSP_041355
    Alternative sequencei1240 – 12401G → GNNDNERLAIARQRIPYRLG RVVDEWLLDKG in isoform 2a. 1 PublicationVSP_014542

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    EF539882 mRNA. Translation: ABS86974.1.
    AB035356 mRNA. Translation: BAA87821.1.
    AB011150 mRNA. Translation: BAA25504.2. Different initiation.
    AC007462 Genomic DNA. Translation: AAF03536.1.
    AC007682 Genomic DNA. Translation: AAY14894.1.
    AC009234 Genomic DNA. Translation: AAY14944.1.
    AC068725 Genomic DNA. Translation: AAG59602.1.
    AC069550 Genomic DNA. Translation: AAG38120.1.
    AC078994 Genomic DNA. Translation: AAK06387.1.
    AC068715 Genomic DNA. Translation: AAG59642.1.
    CCDSiCCDS46282.1. [Q9ULB1-3]
    CCDS54360.1. [Q9ULB1-1]
    RefSeqiNP_001129131.1. NM_001135659.1. [Q9ULB1-3]
    NP_004792.1. NM_004801.4. [Q9ULB1-1]
    NP_620072.1. NM_138735.2.
    UniGeneiHs.637685.

    Genome annotation databases

    EnsembliENST00000404971; ENSP00000385142; ENSG00000179915. [Q9ULB1-3]
    ENST00000405472; ENSP00000434015; ENSG00000179915. [Q9ULB1-2]
    ENST00000406316; ENSP00000384311; ENSG00000179915. [Q9ULB1-1]
    GeneIDi9378.
    KEGGihsa:9378.
    UCSCiuc021vhg.1. human. [Q9ULB1-3]
    uc021vhh.1. human. [Q9ULB1-1]

    Polymorphism databases

    DMDMi17369704.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    EF539882 mRNA. Translation: ABS86974.1 .
    AB035356 mRNA. Translation: BAA87821.1 .
    AB011150 mRNA. Translation: BAA25504.2 . Different initiation.
    AC007462 Genomic DNA. Translation: AAF03536.1 .
    AC007682 Genomic DNA. Translation: AAY14894.1 .
    AC009234 Genomic DNA. Translation: AAY14944.1 .
    AC068725 Genomic DNA. Translation: AAG59602.1 .
    AC069550 Genomic DNA. Translation: AAG38120.1 .
    AC078994 Genomic DNA. Translation: AAK06387.1 .
    AC068715 Genomic DNA. Translation: AAG59642.1 .
    CCDSi CCDS46282.1. [Q9ULB1-3 ]
    CCDS54360.1. [Q9ULB1-1 ]
    RefSeqi NP_001129131.1. NM_001135659.1. [Q9ULB1-3 ]
    NP_004792.1. NM_004801.4. [Q9ULB1-1 ]
    NP_620072.1. NM_138735.2.
    UniGenei Hs.637685.

    3D structure databases

    ProteinModelPortali Q9ULB1.
    SMRi Q9ULB1. Positions 209-257, 281-1300.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114779. 11 interactions.
    IntActi Q9ULB1. 4 interactions.

    PTM databases

    PhosphoSitei Q9ULB1.

    Polymorphism databases

    DMDMi 17369704.

    Proteomic databases

    PaxDbi Q9ULB1.
    PRIDEi Q9ULB1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000404971 ; ENSP00000385142 ; ENSG00000179915 . [Q9ULB1-3 ]
    ENST00000405472 ; ENSP00000434015 ; ENSG00000179915 . [Q9ULB1-2 ]
    ENST00000406316 ; ENSP00000384311 ; ENSG00000179915 . [Q9ULB1-1 ]
    GeneIDi 9378.
    KEGGi hsa:9378.
    UCSCi uc021vhg.1. human. [Q9ULB1-3 ]
    uc021vhh.1. human. [Q9ULB1-1 ]

    Organism-specific databases

    CTDi 9378.
    GeneCardsi GC02M050145.
    HGNCi HGNC:8008. NRXN1.
    MIMi 600565. gene.
    neXtProti NX_Q9ULB1.
    PharmGKBi PA31786.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302266.
    HOVERGENi HBG052670.
    KOi K07377.
    OMAi DCSQEIK.
    OrthoDBi EOG7XWPMM.
    PhylomeDBi Q9ULB1.
    TreeFami TF321302.

    Enzyme and pathway databases

    Reactomei REACT_163874. Non-integrin membrane-ECM interactions.

    Miscellaneous databases

    ChiTaRSi NRXN1. human.
    GenomeRNAii 9378.
    NextBioi 35134.
    PROi Q9ULB1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9ULB1.
    Bgeei Q9ULB1.
    CleanExi HS_NRXN1.
    Genevestigatori Q9ULB1.

    Family and domain databases

    Gene3Di 2.60.120.200. 6 hits.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view ]
    Pfami PF02210. Laminin_G_2. 6 hits.
    PF01034. Syndecan. 1 hit.
    [Graphical view ]
    SMARTi SM00294. 4.1m. 1 hit.
    SM00181. EGF. 3 hits.
    SM00282. LamG. 6 hits.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 6 hits.
    PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
    PS50026. EGF_3. 3 hits.
    PS50025. LAM_G_DOMAIN. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A).
    2. "Human neurexin I-alpha."
      Seki N., Yoshikawa T., Azuma T., Saito T., Muramatsu M.
      Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A).
      Tissue: Brain.
    3. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2A), TISSUE SPECIFICITY.
      Tissue: Brain.
    4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
      Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
      Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING.
    7. Cited for: VARIANT ALA-28.

    Entry informationi

    Entry nameiNRX1A_HUMAN
    AccessioniPrimary (citable) accession number: Q9ULB1
    Secondary accession number(s): A7KRL9
    , O60323, Q53TJ9, Q53TQ1, Q9C079, Q9C080, Q9C081, Q9H3M2, Q9UDM6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 16, 2001
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 145 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3