SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULB1

- NRX1A_HUMAN

UniProt

Q9ULB1 - NRX1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Neurexin-1
Gene
NRXN1, KIAA0578
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi329 – 3291Calcium By similarity
Metal bindingi329 – 3291Calcium 1 By similarity
Metal bindingi346 – 3461Calcium 1; via carbonyl oxygen By similarity
Metal bindingi407 – 4071Calcium 1; via carbonyl oxygen By similarity
Metal bindingi765 – 7651Calcium 2 By similarity
Metal bindingi782 – 7821Calcium 2; via carbonyl oxygen By similarity
Metal bindingi841 – 8411Calcium 2; via carbonyl oxygen By similarity
Metal bindingi1176 – 11761Calcium 3 By similarity
Metal bindingi1193 – 11931Calcium 3; via carbonyl oxygen By similarity
Metal bindingi1245 – 12451Calcium 3; via carbonyl oxygen By similarity
Metal bindingi1247 – 12471Calcium 3 By similarity

GO - Molecular functioni

  1. acetylcholine receptor binding Source: BHF-UCL
  2. calcium channel regulator activity Source: BHF-UCL
  3. calcium ion binding Source: BHF-UCL
  4. cell adhesion molecule binding Source: BHF-UCL
  5. neuroligin family protein binding Source: BHF-UCL
  6. protein binding Source: UniProtKB
  7. receptor activity Source: ProtInc

GO - Biological processi

  1. adult behavior Source: BHF-UCL
  2. axon guidance Source: ProtInc
  3. extracellular matrix organization Source: Reactome
  4. gephyrin clustering Source: BHF-UCL
  5. learning Source: BHF-UCL
  6. neuroligin clustering Source: BHF-UCL
  7. neuromuscular process controlling balance Source: BHF-UCL
  8. neuron cell-cell adhesion Source: BHF-UCL
  9. neurotransmitter secretion Source: BHF-UCL
  10. positive regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
  11. positive regulation of synapse assembly Source: BHF-UCL
  12. positive regulation of synapse maturation Source: BHF-UCL
  13. positive regulation of synaptic transmission, glutamatergic Source: BHF-UCL
  14. postsynaptic density protein 95 clustering Source: BHF-UCL
  15. postsynaptic membrane assembly Source: BHF-UCL
  16. prepulse inhibition Source: Ensembl
  17. regulation of grooming behavior Source: Ensembl
  18. social behavior Source: BHF-UCL
  19. synapse assembly Source: BHF-UCL
  20. synaptic transmission Source: BHF-UCL
  21. vocal learning Source: BHF-UCL
  22. vocalization behavior Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_163874. Non-integrin membrane-ECM interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neurexin-1
Alternative name(s):
Neurexin I-alpha
Neurexin-1-alpha
Gene namesi
Name:NRXN1
Synonyms:KIAA0578
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:8008. NRXN1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein Inferred. Cell junctionsynapse Inferred
Note: Localized on the pre-synaptic membrane By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 14011371Extracellular Reviewed prediction
Add
BLAST
Transmembranei1402 – 142221Helical; Reviewed prediction
Add
BLAST
Topological domaini1423 – 147755Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cell surface Source: BHF-UCL
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: BHF-UCL
  5. presynaptic membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31786.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 By similarity
Add
BLAST
Chaini31 – 14771447Neurexin-1
PRO_0000019490Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi125 – 1251N-linked (GlcNAc...) Reviewed prediction
Glycosylationi190 – 1901N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi228 ↔ 243 By similarity
Disulfide bondi245 ↔ 255 By similarity
Disulfide bondi437 ↔ 473 By similarity
Disulfide bondi643 ↔ 672 By similarity
Disulfide bondi680 ↔ 691 By similarity
Disulfide bondi685 ↔ 700 By similarity
Disulfide bondi702 ↔ 712 By similarity
Glycosylationi790 – 7901N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi1052 ↔ 1080 By similarity
Disulfide bondi1087 ↔ 1098 By similarity
Disulfide bondi1092 ↔ 1107 By similarity
Disulfide bondi1109 ↔ 1119 By similarity
Glycosylationi1223 – 12231N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N-glycosylated By similarity.
O-glycosylated By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ULB1.
PRIDEiQ9ULB1.

PTM databases

PhosphoSiteiQ9ULB1.

Expressioni

Tissue specificityi

Brain.1 Publication

Gene expression databases

ArrayExpressiQ9ULB1.
BgeeiQ9ULB1.
CleanExiHS_NRXN1.
GenevestigatoriQ9ULB1.

Interactioni

Subunit structurei

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer. Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent. Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3. Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 By similarity. Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 By similarity. Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latrotoxin from spider venom. The cytoplasmic C-terminal region binds to CASK, CASKIN1 and APBA1. Interacts with SYT13 and SYTL1 By similarity.

Protein-protein interaction databases

BioGridi114779. 11 interactions.
IntActiQ9ULB1. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9ULB1.
SMRiQ9ULB1. Positions 209-257, 281-1300.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 217187Laminin G-like 1
Add
BLAST
Domaini213 – 25644EGF-like 1
Add
BLAST
Domaini283 – 473191Laminin G-like 2
Add
BLAST
Domaini480 – 672193Laminin G-like 3
Add
BLAST
Domaini676 – 71338EGF-like 2
Add
BLAST
Domaini718 – 891174Laminin G-like 4
Add
BLAST
Domaini905 – 1080176Laminin G-like 5
Add
BLAST
Domaini1083 – 112038EGF-like 3
Add
BLAST
Domaini1126 – 1294169Laminin G-like 6
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1324 – 13274Poly-Thr
Compositional biasi1409 – 14124Poly-Ala

Sequence similaritiesi

Belongs to the neurexin family.
Contains 3 EGF-like domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302266.
HOVERGENiHBG052670.
KOiK07377.
OMAiDCSQEIK.
OrthoDBiEOG7XWPMM.
PhylomeDBiQ9ULB1.
TreeFamiTF321302.

Family and domain databases

Gene3Di2.60.120.200. 6 hits.
InterProiIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PfamiPF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 6 hits.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing.

Isoform 1a (identifier: Q9ULB1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGTALLQRGG CFLLCLSLLL LGCWAELGSG LEFPGAEGQW TRFPKWNACC     50
ESEMSFQLKT RSARGLVLYF DDEGFCDFLE LILTRGGRLQ LSFSIFCAEP 100
ATLLADTPVN DGAWHSVRIR RQFRNTTLFI DQVEAKWVEV KSKRRDMTVF 150
SGLFVGGLPP ELRAAALKLT LASVREREPF KGWIRDVRVN SSQVLPVDSG 200
EVKLDDEPPN SGGGSPCEAG EEGEGGVCLN GGVCSVVDDQ AVCDCSRTGF 250
RGKDCSQEDN NVEGLAHLMM GDQGKSKGKE EYIATFKGSE YFCYDLSQNP 300
IQSSSDEITL SFKTLQRNGL MLHTGKSADY VNLALKNGAV SLVINLGSGA 350
FEALVEPVNG KFNDNAWHDV KVTRNLRQHS GIGHAMVTIS VDGILTTTGY 400
TQEDYTMLGS DDFFYVGGSP STADLPGSPV SNNFMGCLKE VVYKNNDVRL 450
ELSRLAKQGD PKMKIHGVVA FKCENVATLD PITFETPESF ISLPKWNAKK 500
TGSISFDFRT TEPNGLILFS HGKPRHQKDA KHPQMIKVDF FAIEMLDGHL 550
YLLLDMGSGT IKIKALLKKV NDGEWYHVDF QRDGRSGTIS VNTLRTPYTA 600
PGESEILDLD DELYLGGLPE NKAGLVFPTE VWTALLNYGY VGCIRDLFID 650
GQSKDIRQMA EVQSTAGVKP SCSKETAKPC LSNPCKNNGM CRDGWNRYVC 700
DCSGTGYLGR SCEREATVLS YDGSMFMKIQ LPVVMHTEAE DVSLRFRSQR 750
AYGILMATTS RDSADTLRLE LDAGRVKLTV NLDCIRINCN SSKGPETLFA 800
GYNLNDNEWH TVRVVRRGKS LKLTVDDQQA MTGQMAGDHT RLEFHNIETG 850
IITERRYLSS VPSNFIGHLQ SLTFNGMAYI DLCKNGDIDY CELNARFGFR 900
NIIADPVTFK TKSSYVALAT LQAYTSMHLF FQFKTTSLDG LILYNSGDGN 950
DFIVVELVKG YLHYVFDLGN GANLIKGSSN KPLNDNQWHN VMISRDTSNL 1000
HTVKIDTKIT TQITAGARNL DLKSDLYIGG VAKETYKSLP KLVHAKEGFQ 1050
GCLASVDLNG RLPDLISDAL FCNGQIERGC EGPSTTCQED SCSNQGVCLQ 1100
QWDGFSCDCS MTSFSGPLCN DPGTTYIFSK GGGQITYKWP PNDRPSTRAD 1150
RLAIGFSTVQ KEAVLVRVDS SSGLGDYLEL HIHQGKIGVK FNVGTDDIAI 1200
EESNAIINDG KYHVVRFTRS GGNATLQVDS WPVIERYPAG RQLTIFNSQA 1250
TIIIGGKEQG QPFQGQLSGL YYNGLKVLNM AAENDANIAI VGNVRLVGEV 1300
PSSMTTESTA TAMQSEMSTS IMETTTTLAT STARRGKPPT KEPISQTTDD 1350
ILVASAECPS DDEDIDPCEP SSGGLANPTR AGGREPYPGS AEVIRESSST 1400
TGMVVGIVAA AALCILILLY AMYKYRNRDE GSYHVDESRN YISNSAQSNG 1450
AVVKEKQPSS AKSSNKNKKN KDKEYYV 1477
Length:1,477
Mass (Da):161,883
Last modified:May 1, 2000 - v1
Checksum:iFF845FB428B1A683
GO
Isoform 2a (identifier: Q9ULB1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: Missing.
     1240-1240: G → GNNDNERLAIARQRIPYRLGRVVDEWLLDKG

Note: Produced by alternative splicing. No experimental confirmation available.

Show »
Length:1,499
Mass (Da):164,655
Checksum:iF8481191C84C9CD7
GO
Isoform 3a (identifier: Q9ULB1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK
     386-386: M → MVNKLHCS
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK

Note: Produced by alternative splicing.

Show »
Length:1,547
Mass (Da):169,913
Checksum:i2F6A3FBB6E53AA2E
GO
Isoform 1b (identifier: P58400-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:442
Mass (Da):46,861
GO

Sequence cautioni

The sequence BAA25504.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti28 – 281G → A.1 Publication
VAR_070274
Natural varianti400 – 4001Y → N.
Corresponds to variant rs17040901 [ dbSNP | Ensembl ].
VAR_050265

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei258 – 2581E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a.
VSP_041353
Alternative sequencei379 – 3868Missing in isoform 2a.
VSP_014541
Alternative sequencei386 – 3861M → MVNKLHCS in isoform 3a.
VSP_041354
Alternative sequencei1239 – 12391A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a.
VSP_041355
Alternative sequencei1240 – 12401G → GNNDNERLAIARQRIPYRLG RVVDEWLLDKG in isoform 2a.
VSP_014542

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1373 – 13753Missing in BAA25504. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EF539882 mRNA. Translation: ABS86974.1.
AB035356 mRNA. Translation: BAA87821.1.
AB011150 mRNA. Translation: BAA25504.2. Different initiation.
AC007462 Genomic DNA. Translation: AAF03536.1.
AC007682 Genomic DNA. Translation: AAY14894.1.
AC009234 Genomic DNA. Translation: AAY14944.1.
AC068725 Genomic DNA. Translation: AAG59602.1.
AC069550 Genomic DNA. Translation: AAG38120.1.
AC078994 Genomic DNA. Translation: AAK06387.1.
AC068715 Genomic DNA. Translation: AAG59642.1.
CCDSiCCDS46282.1. [Q9ULB1-3]
CCDS54360.1. [Q9ULB1-1]
RefSeqiNP_001129131.1. NM_001135659.1. [Q9ULB1-3]
NP_004792.1. NM_004801.4. [Q9ULB1-1]
NP_620072.1. NM_138735.2.
UniGeneiHs.637685.

Genome annotation databases

EnsembliENST00000404971; ENSP00000385142; ENSG00000179915. [Q9ULB1-3]
ENST00000405472; ENSP00000434015; ENSG00000179915. [Q9ULB1-2]
ENST00000406316; ENSP00000384311; ENSG00000179915. [Q9ULB1-1]
GeneIDi9378.
KEGGihsa:9378.
UCSCiuc021vhg.1. human. [Q9ULB1-3]
uc021vhh.1. human. [Q9ULB1-1]

Polymorphism databases

DMDMi17369704.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EF539882 mRNA. Translation: ABS86974.1 .
AB035356 mRNA. Translation: BAA87821.1 .
AB011150 mRNA. Translation: BAA25504.2 . Different initiation.
AC007462 Genomic DNA. Translation: AAF03536.1 .
AC007682 Genomic DNA. Translation: AAY14894.1 .
AC009234 Genomic DNA. Translation: AAY14944.1 .
AC068725 Genomic DNA. Translation: AAG59602.1 .
AC069550 Genomic DNA. Translation: AAG38120.1 .
AC078994 Genomic DNA. Translation: AAK06387.1 .
AC068715 Genomic DNA. Translation: AAG59642.1 .
CCDSi CCDS46282.1. [Q9ULB1-3 ]
CCDS54360.1. [Q9ULB1-1 ]
RefSeqi NP_001129131.1. NM_001135659.1. [Q9ULB1-3 ]
NP_004792.1. NM_004801.4. [Q9ULB1-1 ]
NP_620072.1. NM_138735.2.
UniGenei Hs.637685.

3D structure databases

ProteinModelPortali Q9ULB1.
SMRi Q9ULB1. Positions 209-257, 281-1300.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114779. 11 interactions.
IntActi Q9ULB1. 4 interactions.

PTM databases

PhosphoSitei Q9ULB1.

Polymorphism databases

DMDMi 17369704.

Proteomic databases

PaxDbi Q9ULB1.
PRIDEi Q9ULB1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000404971 ; ENSP00000385142 ; ENSG00000179915 . [Q9ULB1-3 ]
ENST00000405472 ; ENSP00000434015 ; ENSG00000179915 . [Q9ULB1-2 ]
ENST00000406316 ; ENSP00000384311 ; ENSG00000179915 . [Q9ULB1-1 ]
GeneIDi 9378.
KEGGi hsa:9378.
UCSCi uc021vhg.1. human. [Q9ULB1-3 ]
uc021vhh.1. human. [Q9ULB1-1 ]

Organism-specific databases

CTDi 9378.
GeneCardsi GC02M050145.
HGNCi HGNC:8008. NRXN1.
MIMi 600565. gene.
neXtProti NX_Q9ULB1.
PharmGKBi PA31786.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302266.
HOVERGENi HBG052670.
KOi K07377.
OMAi DCSQEIK.
OrthoDBi EOG7XWPMM.
PhylomeDBi Q9ULB1.
TreeFami TF321302.

Enzyme and pathway databases

Reactomei REACT_163874. Non-integrin membrane-ECM interactions.

Miscellaneous databases

ChiTaRSi NRXN1. human.
GenomeRNAii 9378.
NextBioi 35134.
PROi Q9ULB1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9ULB1.
Bgeei Q9ULB1.
CleanExi HS_NRXN1.
Genevestigatori Q9ULB1.

Family and domain databases

Gene3Di 2.60.120.200. 6 hits.
InterProi IPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view ]
Pfami PF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view ]
SMARTi SM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 6 hits.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A).
  2. "Human neurexin I-alpha."
    Seki N., Yoshikawa T., Azuma T., Saito T., Muramatsu M.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A).
    Tissue: Brain.
  3. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2A), TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
    Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
    Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.
  7. Cited for: VARIANT ALA-28.

Entry informationi

Entry nameiNRX1A_HUMAN
AccessioniPrimary (citable) accession number: Q9ULB1
Secondary accession number(s): A7KRL9
, O60323, Q53TJ9, Q53TQ1, Q9C079, Q9C080, Q9C081, Q9H3M2, Q9UDM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2000
Last modified: September 3, 2014
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi