Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9ULB1

- NRX1A_HUMAN

UniProt

Q9ULB1 - NRX1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neurexin-1

Gene

NRXN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca2+-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca2+-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi329 – 3291CalciumBy similarity
Metal bindingi329 – 3291Calcium 1By similarity
Metal bindingi346 – 3461Calcium 1; via carbonyl oxygenBy similarity
Metal bindingi407 – 4071Calcium 1; via carbonyl oxygenBy similarity
Metal bindingi765 – 7651Calcium 2By similarity
Metal bindingi782 – 7821Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi841 – 8411Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi1176 – 11761Calcium 3By similarity
Metal bindingi1193 – 11931Calcium 3; via carbonyl oxygenBy similarity
Metal bindingi1245 – 12451Calcium 3; via carbonyl oxygenBy similarity
Metal bindingi1247 – 12471Calcium 3By similarity

GO - Molecular functioni

  1. acetylcholine receptor binding Source: BHF-UCL
  2. calcium channel regulator activity Source: BHF-UCL
  3. calcium ion binding Source: BHF-UCL
  4. cell adhesion molecule binding Source: BHF-UCL
  5. neuroligin family protein binding Source: BHF-UCL
  6. receptor activity Source: ProtInc

GO - Biological processi

  1. adult behavior Source: BHF-UCL
  2. axon guidance Source: ProtInc
  3. calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules Source: Ensembl
  4. cerebellar granule cell differentiation Source: Ensembl
  5. establishment of protein localization Source: Ensembl
  6. extracellular matrix organization Source: Reactome
  7. gamma-aminobutyric acid receptor clustering Source: Ensembl
  8. gephyrin clustering Source: BHF-UCL
  9. guanylate kinase-associated protein clustering Source: Ensembl
  10. heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: Ensembl
  11. learning Source: BHF-UCL
  12. negative regulation of filopodium assembly Source: Ensembl
  13. neuroligin clustering Source: BHF-UCL
  14. neuromuscular process controlling balance Source: BHF-UCL
  15. neuron cell-cell adhesion Source: BHF-UCL
  16. neuron maturation Source: Ensembl
  17. neurotransmitter secretion Source: BHF-UCL
  18. N-methyl-D-aspartate receptor clustering Source: Ensembl
  19. positive regulation of establishment of protein localization to plasma membrane Source: Ensembl
  20. positive regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
  21. positive regulation of synapse assembly Source: BHF-UCL
  22. positive regulation of synapse maturation Source: BHF-UCL
  23. positive regulation of synaptic transmission, glutamatergic Source: BHF-UCL
  24. postsynaptic density protein 95 clustering Source: BHF-UCL
  25. postsynaptic membrane assembly Source: BHF-UCL
  26. presynaptic membrane assembly Source: Ensembl
  27. receptor localization to synapse Source: Ensembl
  28. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: Ensembl
  29. regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: Ensembl
  30. social behavior Source: BHF-UCL
  31. synapse assembly Source: BHF-UCL
  32. synaptic transmission Source: BHF-UCL
  33. synaptic vesicle clustering Source: Ensembl
  34. vocalization behavior Source: BHF-UCL
  35. vocal learning Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_163874. Non-integrin membrane-ECM interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neurexin-1
Alternative name(s):
Neurexin I-alpha
Neurexin-1-alpha
Gene namesi
Name:NRXN1
Synonyms:KIAA0578
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:8008. NRXN1.

Subcellular locationi

Cell membrane Curated; Single-pass type I membrane protein Curated. Cell junctionsynapse Curated
Note: Localized on the pre-synaptic membrane.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 14011371ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1402 – 142221HelicalSequence AnalysisAdd
BLAST
Topological domaini1423 – 147755CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. axonal growth cone Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. cell surface Source: BHF-UCL
  4. integral component of plasma membrane Source: ProtInc
  5. plasma membrane Source: BHF-UCL
  6. presynaptic membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31786.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030By similarityAdd
BLAST
Chaini31 – 14771447Neurexin-1PRO_0000019490Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi125 – 1251N-linked (GlcNAc...)Sequence Analysis
Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi228 ↔ 243By similarity
Disulfide bondi245 ↔ 255By similarity
Disulfide bondi437 ↔ 473By similarity
Disulfide bondi643 ↔ 672By similarity
Disulfide bondi680 ↔ 691By similarity
Disulfide bondi685 ↔ 700By similarity
Disulfide bondi702 ↔ 712By similarity
Glycosylationi790 – 7901N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1052 ↔ 1080By similarity
Disulfide bondi1087 ↔ 1098By similarity
Disulfide bondi1092 ↔ 1107By similarity
Disulfide bondi1109 ↔ 1119By similarity
Glycosylationi1223 – 12231N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated.By similarity
O-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ULB1.
PRIDEiQ9ULB1.

PTM databases

PhosphoSiteiQ9ULB1.

Expressioni

Tissue specificityi

Brain.1 Publication

Gene expression databases

BgeeiQ9ULB1.
CleanExiHS_NRXN1.
ExpressionAtlasiQ9ULB1. baseline and differential.
GenevestigatoriQ9ULB1.

Interactioni

Subunit structurei

Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1 forming a heterotetramer, where one NLGN1 dimer interacts with one NRXN1 dimer. Interacts (via laminin G-like domain 2 and/or laminin G-like domain 6) with NLGN1, NLGN2, NLGN3, NLGN4X and NLGN4Y; these interactions are calcium-dependent. Interacts (via laminin G-like domain 2) with NXPH1 and NXPH3. Interacts with CBLN1, CBLN2 and, less avidly, with CBLN4 (By similarity). Interacts with LRRTM1, LRRTM2, LRRTM3 and LRRTM4 (By similarity). Alpha-type isoforms (neurexin-1-alpha) interact (via laminin G-like domain 2 and/or laminin G-like domain 6) with DAG1 (via alpha-dystroglycan chain). Alpha-type isoforms interact with alpha-latrotoxin from spider venom. The cytoplasmic C-terminal region binds to CASK, CASKIN1 and APBA1. Interacts with SYT13 and SYTL1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi114779. 11 interactions.
IntActiQ9ULB1. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9ULB1.
SMRiQ9ULB1. Positions 216-260, 281-1300.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 217187Laminin G-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini213 – 25644EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini283 – 473191Laminin G-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini480 – 672193Laminin G-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini676 – 71338EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini718 – 891174Laminin G-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini905 – 1080176Laminin G-like 5PROSITE-ProRule annotationAdd
BLAST
Domaini1083 – 112038EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini1126 – 1294169Laminin G-like 6PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1324 – 13274Poly-Thr
Compositional biasi1409 – 14124Poly-Ala

Sequence similaritiesi

Belongs to the neurexin family.Curated
Contains 3 EGF-like domains.PROSITE-ProRule annotation
Contains 6 laminin G-like domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302266.
GeneTreeiENSGT00760000118991.
HOVERGENiHBG052670.
InParanoidiQ9ULB1.
KOiK07377.
OMAiDCSQEIK.
OrthoDBiEOG7XWPMM.
PhylomeDBiQ9ULB1.
TreeFamiTF321302.

Family and domain databases

Gene3Di2.60.120.200. 6 hits.
InterProiIPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PfamiPF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 6 hits.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: A number of isoforms are produced by alternative promoter usage including the alpha-type and beta-type isoforms which differ in their N-terminus. Additional isoforms may be produced by alternative splicing.2 Publications

Isoform 1a (identifier: Q9ULB1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTALLQRGG CFLLCLSLLL LGCWAELGSG LEFPGAEGQW TRFPKWNACC
60 70 80 90 100
ESEMSFQLKT RSARGLVLYF DDEGFCDFLE LILTRGGRLQ LSFSIFCAEP
110 120 130 140 150
ATLLADTPVN DGAWHSVRIR RQFRNTTLFI DQVEAKWVEV KSKRRDMTVF
160 170 180 190 200
SGLFVGGLPP ELRAAALKLT LASVREREPF KGWIRDVRVN SSQVLPVDSG
210 220 230 240 250
EVKLDDEPPN SGGGSPCEAG EEGEGGVCLN GGVCSVVDDQ AVCDCSRTGF
260 270 280 290 300
RGKDCSQEDN NVEGLAHLMM GDQGKSKGKE EYIATFKGSE YFCYDLSQNP
310 320 330 340 350
IQSSSDEITL SFKTLQRNGL MLHTGKSADY VNLALKNGAV SLVINLGSGA
360 370 380 390 400
FEALVEPVNG KFNDNAWHDV KVTRNLRQHS GIGHAMVTIS VDGILTTTGY
410 420 430 440 450
TQEDYTMLGS DDFFYVGGSP STADLPGSPV SNNFMGCLKE VVYKNNDVRL
460 470 480 490 500
ELSRLAKQGD PKMKIHGVVA FKCENVATLD PITFETPESF ISLPKWNAKK
510 520 530 540 550
TGSISFDFRT TEPNGLILFS HGKPRHQKDA KHPQMIKVDF FAIEMLDGHL
560 570 580 590 600
YLLLDMGSGT IKIKALLKKV NDGEWYHVDF QRDGRSGTIS VNTLRTPYTA
610 620 630 640 650
PGESEILDLD DELYLGGLPE NKAGLVFPTE VWTALLNYGY VGCIRDLFID
660 670 680 690 700
GQSKDIRQMA EVQSTAGVKP SCSKETAKPC LSNPCKNNGM CRDGWNRYVC
710 720 730 740 750
DCSGTGYLGR SCEREATVLS YDGSMFMKIQ LPVVMHTEAE DVSLRFRSQR
760 770 780 790 800
AYGILMATTS RDSADTLRLE LDAGRVKLTV NLDCIRINCN SSKGPETLFA
810 820 830 840 850
GYNLNDNEWH TVRVVRRGKS LKLTVDDQQA MTGQMAGDHT RLEFHNIETG
860 870 880 890 900
IITERRYLSS VPSNFIGHLQ SLTFNGMAYI DLCKNGDIDY CELNARFGFR
910 920 930 940 950
NIIADPVTFK TKSSYVALAT LQAYTSMHLF FQFKTTSLDG LILYNSGDGN
960 970 980 990 1000
DFIVVELVKG YLHYVFDLGN GANLIKGSSN KPLNDNQWHN VMISRDTSNL
1010 1020 1030 1040 1050
HTVKIDTKIT TQITAGARNL DLKSDLYIGG VAKETYKSLP KLVHAKEGFQ
1060 1070 1080 1090 1100
GCLASVDLNG RLPDLISDAL FCNGQIERGC EGPSTTCQED SCSNQGVCLQ
1110 1120 1130 1140 1150
QWDGFSCDCS MTSFSGPLCN DPGTTYIFSK GGGQITYKWP PNDRPSTRAD
1160 1170 1180 1190 1200
RLAIGFSTVQ KEAVLVRVDS SSGLGDYLEL HIHQGKIGVK FNVGTDDIAI
1210 1220 1230 1240 1250
EESNAIINDG KYHVVRFTRS GGNATLQVDS WPVIERYPAG RQLTIFNSQA
1260 1270 1280 1290 1300
TIIIGGKEQG QPFQGQLSGL YYNGLKVLNM AAENDANIAI VGNVRLVGEV
1310 1320 1330 1340 1350
PSSMTTESTA TAMQSEMSTS IMETTTTLAT STARRGKPPT KEPISQTTDD
1360 1370 1380 1390 1400
ILVASAECPS DDEDIDPCEP SSGGLANPTR AGGREPYPGS AEVIRESSST
1410 1420 1430 1440 1450
TGMVVGIVAA AALCILILLY AMYKYRNRDE GSYHVDESRN YISNSAQSNG
1460 1470
AVVKEKQPSS AKSSNKNKKN KDKEYYV
Length:1,477
Mass (Da):161,883
Last modified:May 1, 2000 - v1
Checksum:iFF845FB428B1A683
GO
Isoform 2a (identifier: Q9ULB1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: Missing.
     1240-1240: G → GNNDNERLAIARQRIPYRLGRVVDEWLLDKG

Note: Produced by alternative splicing. No experimental confirmation available.

Show »
Length:1,499
Mass (Da):164,655
Checksum:iF8481191C84C9CD7
GO
Isoform 3a (identifier: Q9ULB1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-258: E → EIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEK
     386-386: M → MVNKLHCS
     1239-1239: A → AGNNDNERLAIARQRIPYRLGRVVDEWLLDK

Note: Produced by alternative splicing.

Show »
Length:1,547
Mass (Da):169,913
Checksum:i2F6A3FBB6E53AA2E
GO
Isoform 1b (identifier: P58400-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry P58400.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:442
Mass (Da):46,861
GO

Sequence cautioni

The sequence BAA25504.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1373 – 13753Missing in BAA25504. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti28 – 281G → A.1 Publication
VAR_070274
Natural varianti400 – 4001Y → N.
Corresponds to variant rs17040901 [ dbSNP | Ensembl ].
VAR_050265

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei258 – 2581E → EIKFGLQCVLPVLLHDNDQG KYCCINTAKPLTEK in isoform 3a. 1 PublicationVSP_041353
Alternative sequencei379 – 3868Missing in isoform 2a. 1 PublicationVSP_014541
Alternative sequencei386 – 3861M → MVNKLHCS in isoform 3a. 1 PublicationVSP_041354
Alternative sequencei1239 – 12391A → AGNNDNERLAIARQRIPYRL GRVVDEWLLDK in isoform 3a. 1 PublicationVSP_041355
Alternative sequencei1240 – 12401G → GNNDNERLAIARQRIPYRLG RVVDEWLLDKG in isoform 2a. 1 PublicationVSP_014542

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF539882 mRNA. Translation: ABS86974.1.
AB035356 mRNA. Translation: BAA87821.1.
AB011150 mRNA. Translation: BAA25504.2. Different initiation.
AC007462 Genomic DNA. Translation: AAF03536.1.
AC007682 Genomic DNA. Translation: AAY14894.1.
AC009234 Genomic DNA. Translation: AAY14944.1.
AC068725 Genomic DNA. Translation: AAG59602.1.
AC069550 Genomic DNA. Translation: AAG38120.1.
AC078994 Genomic DNA. Translation: AAK06387.1.
AC068715 Genomic DNA. Translation: AAG59642.1.
CCDSiCCDS46282.1. [Q9ULB1-3]
CCDS54360.1. [Q9ULB1-1]
RefSeqiNP_001129131.1. NM_001135659.1. [Q9ULB1-3]
NP_004792.1. NM_004801.4. [Q9ULB1-1]
NP_620072.1. NM_138735.2.
UniGeneiHs.637685.

Genome annotation databases

EnsembliENST00000404971; ENSP00000385142; ENSG00000179915. [Q9ULB1-3]
ENST00000405472; ENSP00000434015; ENSG00000179915. [Q9ULB1-2]
ENST00000406316; ENSP00000384311; ENSG00000179915. [Q9ULB1-1]
GeneIDi9378.
KEGGihsa:9378.
UCSCiuc021vhg.1. human. [Q9ULB1-3]
uc021vhh.1. human. [Q9ULB1-1]

Polymorphism databases

DMDMi17369704.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF539882 mRNA. Translation: ABS86974.1 .
AB035356 mRNA. Translation: BAA87821.1 .
AB011150 mRNA. Translation: BAA25504.2 . Different initiation.
AC007462 Genomic DNA. Translation: AAF03536.1 .
AC007682 Genomic DNA. Translation: AAY14894.1 .
AC009234 Genomic DNA. Translation: AAY14944.1 .
AC068725 Genomic DNA. Translation: AAG59602.1 .
AC069550 Genomic DNA. Translation: AAG38120.1 .
AC078994 Genomic DNA. Translation: AAK06387.1 .
AC068715 Genomic DNA. Translation: AAG59642.1 .
CCDSi CCDS46282.1. [Q9ULB1-3 ]
CCDS54360.1. [Q9ULB1-1 ]
RefSeqi NP_001129131.1. NM_001135659.1. [Q9ULB1-3 ]
NP_004792.1. NM_004801.4. [Q9ULB1-1 ]
NP_620072.1. NM_138735.2.
UniGenei Hs.637685.

3D structure databases

ProteinModelPortali Q9ULB1.
SMRi Q9ULB1. Positions 216-260, 281-1300.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114779. 11 interactions.
IntActi Q9ULB1. 4 interactions.

PTM databases

PhosphoSitei Q9ULB1.

Polymorphism databases

DMDMi 17369704.

Proteomic databases

PaxDbi Q9ULB1.
PRIDEi Q9ULB1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000404971 ; ENSP00000385142 ; ENSG00000179915 . [Q9ULB1-3 ]
ENST00000405472 ; ENSP00000434015 ; ENSG00000179915 . [Q9ULB1-2 ]
ENST00000406316 ; ENSP00000384311 ; ENSG00000179915 . [Q9ULB1-1 ]
GeneIDi 9378.
KEGGi hsa:9378.
UCSCi uc021vhg.1. human. [Q9ULB1-3 ]
uc021vhh.1. human. [Q9ULB1-1 ]

Organism-specific databases

CTDi 9378.
GeneCardsi GC02M050145.
HGNCi HGNC:8008. NRXN1.
MIMi 600565. gene.
neXtProti NX_Q9ULB1.
PharmGKBi PA31786.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302266.
GeneTreei ENSGT00760000118991.
HOVERGENi HBG052670.
InParanoidi Q9ULB1.
KOi K07377.
OMAi DCSQEIK.
OrthoDBi EOG7XWPMM.
PhylomeDBi Q9ULB1.
TreeFami TF321302.

Enzyme and pathway databases

Reactomei REACT_163874. Non-integrin membrane-ECM interactions.

Miscellaneous databases

ChiTaRSi NRXN1. human.
GenomeRNAii 9378.
NextBioi 35134.
PROi Q9ULB1.
SOURCEi Search...

Gene expression databases

Bgeei Q9ULB1.
CleanExi HS_NRXN1.
ExpressionAtlasi Q9ULB1. baseline and differential.
Genevestigatori Q9ULB1.

Family and domain databases

Gene3Di 2.60.120.200. 6 hits.
InterProi IPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view ]
Pfami PF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view ]
SMARTi SM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 6 hits.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A).
  2. "Human neurexin I-alpha."
    Seki N., Yoshikawa T., Azuma T., Saito T., Muramatsu M.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A).
    Tissue: Brain.
  3. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2A), TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
    Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
    Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.
  7. Cited for: VARIANT ALA-28.

Entry informationi

Entry nameiNRX1A_HUMAN
AccessioniPrimary (citable) accession number: Q9ULB1
Secondary accession number(s): A7KRL9
, O60323, Q53TJ9, Q53TQ1, Q9C079, Q9C080, Q9C081, Q9H3M2, Q9UDM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2000
Last modified: November 26, 2014
This is version 147 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3