Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 215

Gene

ZNF215

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri379 – 401C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri407 – 429C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri462 – 484C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000149054-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 215
Alternative name(s):
BWSCR2-associated zinc finger protein 2
Short name:
BAZ-2
Zinc finger protein with KRAB and SCAN domains 11
Gene namesi
Name:ZNF215
Synonyms:BAZ2, ZKSCAN11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:13007. ZNF215.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7762.
OpenTargetsiENSG00000149054.
PharmGKBiPA37586.

Polymorphism and mutation databases

BioMutaiZNF215.
DMDMi296453039.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000474591 – 517Zinc finger protein 215Add BLAST517

Proteomic databases

PaxDbiQ9UL58.
PeptideAtlasiQ9UL58.
PRIDEiQ9UL58.

PTM databases

iPTMnetiQ9UL58.
PhosphoSitePlusiQ9UL58.

Expressioni

Gene expression databases

BgeeiENSG00000149054.
CleanExiHS_ZNF215.
ExpressionAtlasiQ9UL58. baseline and differential.
GenevisibleiQ9UL58. HS.

Organism-specific databases

HPAiHPA051010.

Interactioni

Protein-protein interaction databases

BioGridi113545. 3 interactors.
IntActiQ9UL58. 5 interactors.
STRINGi9606.ENSP00000278319.

Structurei

3D structure databases

ProteinModelPortaliQ9UL58.
SMRiQ9UL58.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 126SCAN boxPROSITE-ProRule annotationAdd BLAST79
Domaini164 – 237KRABPROSITE-ProRule annotationAdd BLAST74

Sequence similaritiesi

Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri379 – 401C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri407 – 429C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri462 – 484C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00680000099963.
HOGENOMiHOG000234619.
HOVERGENiHBG098618.
InParanoidiQ9UL58.
KOiK09229.
OMAiCGRFFNR.
OrthoDBiEOG091G05KE.
PhylomeDBiQ9UL58.
TreeFamiTF350807.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 4 hits.
InterProiIPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 3 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UL58-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQPLSKLMAI SKPRNLSLRE QREVLRADMS WQQETNPVVE THDSEASRQK
60 70 80 90 100
FRHFQYLKVS GPHEALSQLW ELCLQWLRPE IHTKKQIIEL LVLEQFLAIL
110 120 130 140 150
PEEVRTWVNL QHPNNSKDMV TLIEDVIEML EDEDMPCKDS ALQMGSIKEK
160 170 180 190 200
MKAGSRTGKP QEPVTFKDVV VEFSKEEWGQ LDSAVKNLYR NVMLENFRNL
210 220 230 240 250
NSLRKAHLLS KPFESLKLES KKKRWIMEKE IPRKTIFDMK SISGEESSHG
260 270 280 290 300
VIMTRLTESG HPSSDAWKGE NWLYRNQKKW DINLPQEAFI PETIYTEEED
310 320 330 340 350
FECSENKKSF DINSVSSICA IQVGIPSRKG SPKCDKFKTY FKFNLDSVGK
360 370 380 390 400
QHSEYEYGND LSLSTDIRHQ KSHTTMNSYE CYQCGKAFCR SSSLIRHQII
410 420 430 440 450
HTGEKPYKCS ECGRFFNRRT NLTKHQKLHA EAKACTSNKC GKAFSKSEDS
460 470 480 490 500
NNPTLHFGNN FYQCVNCGKS FNRSSSLIRH QMIHTGEKPF KCKECSKAFN
510
RSSNLVKHQK LHTRDKS
Length:517
Mass (Da):60,034
Last modified:May 18, 2010 - v2
Checksum:iB14A6791E763C41E
GO
Isoform 2 (identifier: Q9UL58-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-304: GENWLYRNQKKWDINLPQEAFIPETIYTEEEDFECS → DGVSLLLPRLEYNDAVSAHCNLHLWVQVILLPQPPE
     305-517: Missing.

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):35,298
Checksum:i1BC2E1206713F4C7
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05740536N → S.Corresponds to variant rs11041107dbSNPEnsembl.1
Natural variantiVAR_05740638V → I.Corresponds to variant rs35111903dbSNPEnsembl.1
Natural variantiVAR_024200119M → V.Corresponds to variant rs11041108dbSNPEnsembl.1
Natural variantiVAR_057407263S → F.Corresponds to variant rs11041115dbSNPEnsembl.1
Natural variantiVAR_060423323V → L.1 PublicationCorresponds to variant rs2239730dbSNPEnsembl.1
Natural variantiVAR_021890376M → V.Corresponds to variant rs2239729dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_054156269 – 304GENWL…DFECS → DGVSLLLPRLEYNDAVSAHC NLHLWVQVILLPQPPE in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_054157305 – 517Missing in isoform 2. 1 PublicationAdd BLAST213

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF056618 mRNA. Translation: AAF00005.1.
AC090160 Genomic DNA. No translation available.
AC100875 Genomic DNA. No translation available.
BC014538 mRNA. Translation: AAH14538.1.
CCDSiCCDS7775.1. [Q9UL58-1]
RefSeqiNP_037382.2. NM_013250.2. [Q9UL58-1]
XP_006718374.1. XM_006718311.2. [Q9UL58-1]
UniGeneiHs.523457.

Genome annotation databases

EnsembliENST00000278319; ENSP00000278319; ENSG00000149054. [Q9UL58-1]
ENST00000414517; ENSP00000393202; ENSG00000149054. [Q9UL58-1]
ENST00000529903; ENSP00000432306; ENSG00000149054. [Q9UL58-2]
ENST00000610573; ENSP00000484674; ENSG00000149054. [Q9UL58-2]
GeneIDi7762.
KEGGihsa:7762.
UCSCiuc001mey.4. human. [Q9UL58-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF056618 mRNA. Translation: AAF00005.1.
AC090160 Genomic DNA. No translation available.
AC100875 Genomic DNA. No translation available.
BC014538 mRNA. Translation: AAH14538.1.
CCDSiCCDS7775.1. [Q9UL58-1]
RefSeqiNP_037382.2. NM_013250.2. [Q9UL58-1]
XP_006718374.1. XM_006718311.2. [Q9UL58-1]
UniGeneiHs.523457.

3D structure databases

ProteinModelPortaliQ9UL58.
SMRiQ9UL58.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113545. 3 interactors.
IntActiQ9UL58. 5 interactors.
STRINGi9606.ENSP00000278319.

PTM databases

iPTMnetiQ9UL58.
PhosphoSitePlusiQ9UL58.

Polymorphism and mutation databases

BioMutaiZNF215.
DMDMi296453039.

Proteomic databases

PaxDbiQ9UL58.
PeptideAtlasiQ9UL58.
PRIDEiQ9UL58.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278319; ENSP00000278319; ENSG00000149054. [Q9UL58-1]
ENST00000414517; ENSP00000393202; ENSG00000149054. [Q9UL58-1]
ENST00000529903; ENSP00000432306; ENSG00000149054. [Q9UL58-2]
ENST00000610573; ENSP00000484674; ENSG00000149054. [Q9UL58-2]
GeneIDi7762.
KEGGihsa:7762.
UCSCiuc001mey.4. human. [Q9UL58-1]

Organism-specific databases

CTDi7762.
DisGeNETi7762.
GeneCardsiZNF215.
HGNCiHGNC:13007. ZNF215.
HPAiHPA051010.
MIMi605016. gene.
neXtProtiNX_Q9UL58.
OpenTargetsiENSG00000149054.
PharmGKBiPA37586.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00680000099963.
HOGENOMiHOG000234619.
HOVERGENiHBG098618.
InParanoidiQ9UL58.
KOiK09229.
OMAiCGRFFNR.
OrthoDBiEOG091G05KE.
PhylomeDBiQ9UL58.
TreeFamiTF350807.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000149054-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii7762.
PROiQ9UL58.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000149054.
CleanExiHS_ZNF215.
ExpressionAtlasiQ9UL58. baseline and differential.
GenevisibleiQ9UL58. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 4 hits.
InterProiIPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 3 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN215_HUMAN
AccessioniPrimary (citable) accession number: Q9UL58
Secondary accession number(s): Q96C84
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.