Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Retinoic acid receptor responder protein 3

Gene

RARRES3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable.1 Publication

Kineticsi

  1. KM=400 µM for dipalmitoyl-PC1 Publication
  1. Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate1 Publication
  2. Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate1 Publication

pH dependencei

Optimum pH is 8.1 Publication

GO - Molecular functioni

  • phospholipase A2 activity Source: UniProtKB
  • transferase activity, transferring acyl groups Source: Reactome

GO - Biological processi

  • lipid catabolic process Source: UniProtKB-KW
  • negative regulation of cell proliferation Source: ProtInc
  • phosphatidylethanolamine acyl-chain remodeling Source: Reactome
  • phospholipid metabolic process Source: UniProtKB

Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-1482839 Acyl chain remodelling of PE

Chemistry databases

SwissLipidsiSLP:000001076

Names & Taxonomyi

Protein namesi
Recommended name:
Retinoic acid receptor responder protein 3 (EC:3.1.1.-)
Alternative name(s):
HRAS-like suppressor 4
Short name:
HRSL4
RAR-responsive protein TIG3
Retinoid-inducible gene 1 protein
Tazarotene-induced gene 3 protein
Gene namesi
Name:RARRES3
Synonyms:RIG1, TIG3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000133321.10
HGNCiHGNC:9869 RARRES3
MIMi605092 gene
neXtProtiNX_Q9UL19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 133CytoplasmicSequence analysisAdd BLAST133
Transmembranei134 – 155HelicalSequence analysisAdd BLAST22
Topological domaini156 – 164LumenalSequence analysis9

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5920
OpenTargetsiENSG00000133321
PharmGKBiPA34230

Polymorphism and mutation databases

BioMutaiRARRES3
DMDMi20140910

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001524901 – 164Retinoic acid receptor responder protein 3Add BLAST164

Proteomic databases

PaxDbiQ9UL19
PeptideAtlasiQ9UL19
PRIDEiQ9UL19

PTM databases

iPTMnetiQ9UL19
PhosphoSitePlusiQ9UL19

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Inductioni

By all-trans-retinoic acid and synthetic retinoids.1 Publication

Gene expression databases

BgeeiENSG00000133321
CleanExiHS_RARRES3
ExpressionAtlasiQ9UL19 baseline and differential
GenevisibleiQ9UL19 HS

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SGTAO437653EBI-10323452,EBI-347996

Protein-protein interaction databases

BioGridi111855, 13 interactors
IntActiQ9UL19, 2 interactors
STRINGi9606.ENSP00000255688

Structurei

Secondary structure

1164
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi3 – 5Combined sources3
Beta strandi13 – 17Combined sources5
Beta strandi19 – 21Combined sources3
Beta strandi23 – 29Combined sources7
Beta strandi32 – 37Combined sources6
Helixi42 – 44Combined sources3
Beta strandi50 – 52Combined sources3
Beta strandi58 – 64Combined sources7
Helixi65 – 69Combined sources5
Beta strandi73 – 76Combined sources4
Helixi79 – 83Combined sources5
Helixi89 – 99Combined sources11
Helixi109 – 121Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LKTNMR-A1-125[»]
2MY9NMR-A1-125[»]
ProteinModelPortaliQ9UL19
SMRiQ9UL19
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the H-rev107 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J5BU Eukaryota
ENOG410Y257 LUCA
GeneTreeiENSGT00390000013327
HOGENOMiHOG000293227
HOVERGENiHBG028837
InParanoidiQ9UL19
OMAiRYGRSHC
PhylomeDBiQ9UL19
TreeFamiTF330836

Family and domain databases

InterProiView protein in InterPro
IPR007053 LRAT-like_dom
IPR033210 RARRES3
PANTHERiPTHR13943:SF36 PTHR13943:SF36, 1 hit
PfamiView protein in Pfam
PF04970 LRAT, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UL19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPHQEPKP GDLIEIFRLG YEHWALYIGD GYVIHLAPPS EYPGAGSSSV
60 70 80 90 100
FSVLSNSAEV KRERLEDVVG GCCYRVNNSL DHEYQPRPVE VIISSAKEMV
110 120 130 140 150
GQKMKYSIVS RNCEHFVTQL RYGKSRCKQV EKAKVEVGVA TALGILVVAG
160
CSFAIRRYQK KATA
Length:164
Mass (Da):18,179
Last modified:May 1, 2000 - v1
Checksum:i95625B8FD375FD38
GO
Isoform 2 (identifier: Q9UL19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE

Note: No experimental confirmation available.
Show »
Length:156
Mass (Da):17,436
Checksum:iC9DA5B23E1BC9C8A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti44G → R in BAG56873 (PubMed:14702039).Curated1
Sequence conflicti63E → G in AAC84000 (PubMed:9843971).Curated1
Sequence conflicti118T → A in AAC84000 (PubMed:9843971).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04948069V → L. Corresponds to variant dbSNP:rs35502888Ensembl.1
Natural variantiVAR_049481162A → V. Corresponds to variant dbSNP:rs35845275Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041496131 – 164EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060228 mRNA Translation: AAC84000.1
AF092922 mRNA Translation: AAF02294.1
AB453252 mRNA Translation: BAH22446.1
AB030815 mRNA Translation: BAB08109.1
AK293357 mRNA Translation: BAG56873.1
AK312110 mRNA Translation: BAG35046.1
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74156.1
BC009678 mRNA Translation: AAH09678.1
CCDSiCCDS41662.1 [Q9UL19-1]
RefSeqiNP_004576.2, NM_004585.4 [Q9UL19-1]
UniGeneiHs.17466

Genome annotation databases

EnsembliENST00000255688; ENSP00000255688; ENSG00000133321 [Q9UL19-1]
ENST00000439013; ENSP00000402943; ENSG00000133321 [Q9UL19-2]
GeneIDi5920
KEGGihsa:5920
UCSCiuc001nxf.5 human [Q9UL19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiHRSL4_HUMAN
AccessioniPrimary (citable) accession number: Q9UL19
Secondary accession number(s): B2R599
, B4DDW2, E7ENZ7, O95200
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 1, 2000
Last modified: May 23, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health