Q9UL19 (HRSL4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Retinoic acid receptor responder protein 3 EC=3.1.1.- Alternative name(s): HRAS-like suppressor 4 Short name=HRSL4 RAR-responsive protein TIG3 Retinoid-inducible gene 1 protein Tazarotene-induced gene 3 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 164 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable. Ref.3 |
| Subcellular location | Membrane; Single-pass membrane protein By similarity. |
| Tissue specificity | |
| Induction | By all-trans-retinoic acid and synthetic retinoids. Ref.2 |
| Sequence similarities | Belongs to the H-rev107 family. |
| Biophysicochemical properties | Kinetic parameters: KM=400 µM for dipalmitoyl-PC Ref.3 Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate pH dependence: Optimum pH is 8. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation Lipid metabolism |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Hydrolase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | lipid catabolic process Inferred from electronic annotation. Source: UniProtKB-KW negative regulation of cell proliferationTraceable author statement Ref.1. Source: ProtInc phospholipid metabolic processInferred from direct assay PubMed 20100577. Source: UniProtKB |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | phospholipase A2 activity Inferred from direct assay PubMed 20100577. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UL19-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UL19-2) The sequence of this isoform differs from the canonical sequence as follows: 131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 164 | 164 | Retinoic acid receptor responder protein 3 | PRO_0000152490 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Topological domain | 1 – 133 | 133 | Cytoplasmic Potential | |||||||||||||||||||||||||||||
| Transmembrane | 134 – 155 | 22 | Helical; Potential | |||||||||||||||||||||||||||||
| Topological domain | 156 – 164 | 9 | Lumenal Potential | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 131 – 164 | 34 | EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2. | VSP_041496 | ||||||||||||||||||||||||||||
| Natural variant | 69 | 1 | V → L. Corresponds to variant rs35502888 [ dbSNP | Ensembl ]. | VAR_049480 | ||||||||||||||||||||||||||||
| Natural variant | 162 | 1 | A → V. Corresponds to variant rs35845275 [ dbSNP | Ensembl ]. | VAR_049481 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Sequence conflict | 44 | 1 | G → R in BAG56873. Ref.5 | |||||||||||||||||||||||||||||
| Sequence conflict | 63 | 1 | E → G in AAC84000. Ref.1 | |||||||||||||||||||||||||||||
| Sequence conflict | 118 | 1 | T → A in AAC84000. Ref.1 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 3 – 5 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 13 – 17 | 5 | ||||||||||||||||||||||||||||||
| Beta strand | 19 – 21 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 23 – 29 | 7 | ||||||||||||||||||||||||||||||
| Beta strand | 32 – 37 | 6 | ||||||||||||||||||||||||||||||
| Beta strand | 50 – 52 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 58 – 64 | 7 | ||||||||||||||||||||||||||||||
| Helix | 65 – 69 | 5 | ||||||||||||||||||||||||||||||
| Beta strand | 73 – 76 | 4 | ||||||||||||||||||||||||||||||
| Helix | 79 – 83 | 5 | ||||||||||||||||||||||||||||||
| Helix | 89 – 99 | 11 | ||||||||||||||||||||||||||||||
| Helix | 109 – 121 | 13 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene." DiSepio D., Ghosn C., Eckert R.L., Deucher A., Robinson N., Duvic M., Chandraratna R.A.S., Nagpal S. Proc. Natl. Acad. Sci. U.S.A. 95:14811-14815(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Keratinocyte. |
| [2] | "Cloning and characterization of a novel retinoid-inducible gene 1(RIG1) deriving from human gastric cancer cells." Huang S.L., Shyu R.Y., Yeh M.Y., Jiang S.Y. Mol. Cell. Endocrinol. 159:15-24(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION. Tissue: Stomach cancer. |
| [3] | "Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes." Uyama T., Jin X.H., Tsuboi K., Tonai T., Ueda N. Biochim. Biophys. Acta 1791:1114-1124(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES. Tissue: Testis. |
| [4] | Kato S. Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Gastric adenocarcinoma. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Spleen and Urinary bladder. |
| [6] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF060228 mRNA. Translation: AAC84000.1. AF092922 mRNA. Translation: AAF02294.1. AB453252 mRNA. Translation: BAH22446.1. AB030815 mRNA. Translation: BAB08109.1. AK293357 mRNA. Translation: BAG56873.1. AK312110 mRNA. Translation: BAG35046.1. AP001591 Genomic DNA. No translation available. CH471076 Genomic DNA. Translation: EAW74156.1. BC009678 mRNA. Translation: AAH09678.1. | ||||||||||||
| IPI | IPI00296991. IPI00909431. | ||||||||||||
| RefSeq | NP_004576.2. NM_004585.3. | ||||||||||||
| UniGene | Hs.17466. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UL19. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000255688. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UL19. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 20140910. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UL19. | ||||||||||||
| PRIDE | Q9UL19. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5920. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000255688; ENSP00000255688; ENSG00000133321. ENST00000439013; ENSP00000402943; ENSG00000133321. | ||||||||||||
| GeneID | 5920. | ||||||||||||
| KEGG | hsa:5920. | ||||||||||||
| UCSC | uc001nxf.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5920. | ||||||||||||
| GeneCards | GC11P063304. | ||||||||||||
| H-InvDB | HIX0128662. | ||||||||||||
| HGNC | HGNC:9869. RARRES3. | ||||||||||||
| HPA | HPA011219. | ||||||||||||
| MIM | 605092. gene. | ||||||||||||
| neXtProt | NX_Q9UL19. | ||||||||||||
| PharmGKB | PA34230. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG116857. | ||||||||||||
| HOGENOM | HOG000293227. | ||||||||||||
| HOVERGEN | HBG028837. | ||||||||||||
| InParanoid | Q9UL19. | ||||||||||||
| OMA | RCKQVEK. | ||||||||||||
| OrthoDB | EOG4WSWBT. | ||||||||||||
| PhylomeDB | Q9UL19. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UL19. | ||||||||||||
| Bgee | Q9UL19. | ||||||||||||
| CleanEx | HS_RARRES3. | ||||||||||||
| Genevestigator | Q9UL19. | ||||||||||||
| GermOnline | ENSG00000133321. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR007053. LRAT-like_dom. [Graphical view] | ||||||||||||
| Pfam | PF04970. LRAT. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| GenomeRNAi | 5920. | ||||||||||||
| NextBio | 23052. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | HRSL4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UL19 Secondary accession number(s): B2R599 O95200 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
