Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UL19 (HRSL4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Retinoic acid receptor responder protein 3

EC=3.1.1.-
Alternative name(s):
HRAS-like suppressor 4
Short name=HRSL4
RAR-responsive protein TIG3
Retinoid-inducible gene 1 protein
Tazarotene-induced gene 3 protein
Gene names
Name:RARRES3
Synonyms:RIG1, TIG3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length164 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable. Ref.3

Subcellular location

Membrane; Single-pass membrane protein By similarity.

Tissue specificity

Widely expressed. Ref.2 Ref.3

Induction

By all-trans-retinoic acid and synthetic retinoids. Ref.2

Sequence similarities

Belongs to the H-rev107 family.

Biophysicochemical properties

Kinetic parameters:

KM=400 µM for dipalmitoyl-PC Ref.3

Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate

Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate

pH dependence:

Optimum pH is 8.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9UL19-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UL19-2)

The sequence of this isoform differs from the canonical sequence as follows:
     131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 164164Retinoic acid receptor responder protein 3
PRO_0000152490

Regions

Topological domain1 – 133133Cytoplasmic Potential
Transmembrane134 – 15522Helical; Potential
Topological domain156 – 1649Lumenal Potential

Natural variations

Alternative sequence131 – 16434EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2.
VSP_041496
Natural variant691V → L.
Corresponds to variant rs35502888 [ dbSNP | Ensembl ].
VAR_049480
Natural variant1621A → V.
Corresponds to variant rs35845275 [ dbSNP | Ensembl ].
VAR_049481

Experimental info

Sequence conflict441G → R in BAG56873. Ref.5
Sequence conflict631E → G in AAC84000. Ref.1
Sequence conflict1181T → A in AAC84000. Ref.1

Secondary structure

........................ 164
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 95625B8FD375FD38

FASTA16418,179
        10         20         30         40         50         60 
MASPHQEPKP GDLIEIFRLG YEHWALYIGD GYVIHLAPPS EYPGAGSSSV FSVLSNSAEV 

        70         80         90        100        110        120 
KRERLEDVVG GCCYRVNNSL DHEYQPRPVE VIISSAKEMV GQKMKYSIVS RNCEHFVTQL 

       130        140        150        160 
RYGKSRCKQV EKAKVEVGVA TALGILVVAG CSFAIRRYQK KATA 

« Hide

Isoform 2 [UniParc].

Checksum: C9DA5B23E1BC9C8A
Show »

FASTA15617,436

References

« Hide 'large scale' references
[1]"Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene."
DiSepio D., Ghosn C., Eckert R.L., Deucher A., Robinson N., Duvic M., Chandraratna R.A.S., Nagpal S.
Proc. Natl. Acad. Sci. U.S.A. 95:14811-14815(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Keratinocyte.
[2]"Cloning and characterization of a novel retinoid-inducible gene 1(RIG1) deriving from human gastric cancer cells."
Huang S.L., Shyu R.Y., Yeh M.Y., Jiang S.Y.
Mol. Cell. Endocrinol. 159:15-24(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION.
Tissue: Stomach cancer.
[3]"Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes."
Uyama T., Jin X.H., Tsuboi K., Tonai T., Ueda N.
Biochim. Biophys. Acta 1791:1114-1124(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES.
Tissue: Testis.
[4]Kato S.
Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Gastric adenocarcinoma.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Spleen and Urinary bladder.
[6]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF060228 mRNA. Translation: AAC84000.1.
AF092922 mRNA. Translation: AAF02294.1.
AB453252 mRNA. Translation: BAH22446.1.
AB030815 mRNA. Translation: BAB08109.1.
AK293357 mRNA. Translation: BAG56873.1.
AK312110 mRNA. Translation: BAG35046.1.
AP001591 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74156.1.
BC009678 mRNA. Translation: AAH09678.1.
RefSeqNP_004576.2. NM_004585.4.
UniGeneHs.17466.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2LKTNMR-A1-125[»]
ProteinModelPortalQ9UL19.
SMRQ9UL19. Positions 1-125.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111855. 11 interactions.
STRING9606.ENSP00000255688.

PTM databases

PhosphoSiteQ9UL19.

Polymorphism databases

DMDM20140910.

Proteomic databases

PaxDbQ9UL19.
PRIDEQ9UL19.

Protocols and materials databases

DNASU5920.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000255688; ENSP00000255688; ENSG00000133321. [Q9UL19-1]
ENST00000439013; ENSP00000402943; ENSG00000133321. [Q9UL19-2]
GeneID5920.
KEGGhsa:5920.
UCSCuc001nxf.4. human. [Q9UL19-1]

Organism-specific databases

CTD5920.
GeneCardsGC11P063304.
H-InvDBHIX0128662.
HGNCHGNC:9869. RARRES3.
HPAHPA011219.
MIM605092. gene.
neXtProtNX_Q9UL19.
PharmGKBPA34230.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG116857.
HOGENOMHOG000293227.
HOVERGENHBG028837.
InParanoidQ9UL19.
OMARCKQVEK.
OrthoDBEOG7B8S59.
PhylomeDBQ9UL19.
TreeFamTF330836.

Gene expression databases

ArrayExpressQ9UL19.
BgeeQ9UL19.
CleanExHS_RARRES3.
GenevestigatorQ9UL19.

Family and domain databases

InterProIPR007053. LRAT-like_dom.
[Graphical view]
PfamPF04970. LRAT. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiRARRES3.
GenomeRNAi5920.
NextBio23052.
PROQ9UL19.
SOURCESearch...

Entry information

Entry nameHRSL4_HUMAN
AccessionPrimary (citable) accession number: Q9UL19
Secondary accession number(s): B2R599 expand/collapse secondary AC list , B4DDW2, E7ENZ7, O95200
Entry history
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 1, 2000
Last modified: March 19, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM