Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UL19

- HRSL4_HUMAN

UniProt

Q9UL19 - HRSL4_HUMAN

Protein

Retinoic acid receptor responder protein 3

Gene

RARRES3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable.1 Publication

    Kineticsi

    1. KM=400 µM for dipalmitoyl-PC1 Publication

    Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate1 Publication

    Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate1 Publication

    pH dependencei

    Optimum pH is 8.1 Publication

    GO - Molecular functioni

    1. phospholipase A2 activity Source: UniProtKB
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. lipid catabolic process Source: UniProtKB-KW
    2. negative regulation of cell proliferation Source: ProtInc
    3. phospholipid metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Retinoic acid receptor responder protein 3 (EC:3.1.1.-)
    Alternative name(s):
    HRAS-like suppressor 4
    Short name:
    HRSL4
    RAR-responsive protein TIG3
    Retinoid-inducible gene 1 protein
    Tazarotene-induced gene 3 protein
    Gene namesi
    Name:RARRES3
    Synonyms:RIG1, TIG3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:9869. RARRES3.

    Subcellular locationi

    Membrane By similarity; Single-pass membrane protein By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34230.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 164164Retinoic acid receptor responder protein 3PRO_0000152490Add
    BLAST

    Proteomic databases

    PaxDbiQ9UL19.
    PRIDEiQ9UL19.

    PTM databases

    PhosphoSiteiQ9UL19.

    Expressioni

    Tissue specificityi

    Widely expressed.2 Publications

    Inductioni

    By all-trans-retinoic acid and synthetic retinoids.1 Publication

    Gene expression databases

    ArrayExpressiQ9UL19.
    BgeeiQ9UL19.
    CleanExiHS_RARRES3.
    GenevestigatoriQ9UL19.

    Organism-specific databases

    HPAiHPA011219.

    Interactioni

    Protein-protein interaction databases

    BioGridi111855. 11 interactions.
    STRINGi9606.ENSP00000255688.

    Structurei

    Secondary structure

    1
    164
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi3 – 53
    Beta strandi13 – 175
    Beta strandi19 – 213
    Beta strandi23 – 297
    Beta strandi32 – 376
    Beta strandi50 – 523
    Beta strandi58 – 647
    Helixi65 – 695
    Beta strandi73 – 764
    Helixi79 – 835
    Helixi89 – 9911
    Helixi109 – 12113

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2LKTNMR-A1-125[»]
    ProteinModelPortaliQ9UL19.
    SMRiQ9UL19. Positions 1-125.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 133133CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini156 – 1649LumenalSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei134 – 15522HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the H-rev107 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG116857.
    HOGENOMiHOG000293227.
    HOVERGENiHBG028837.
    InParanoidiQ9UL19.
    OMAiECGCDER.
    OrthoDBiEOG7B8S59.
    PhylomeDBiQ9UL19.
    TreeFamiTF330836.

    Family and domain databases

    InterProiIPR007053. LRAT-like_dom.
    [Graphical view]
    PfamiPF04970. LRAT. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UL19-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASPHQEPKP GDLIEIFRLG YEHWALYIGD GYVIHLAPPS EYPGAGSSSV    50
    FSVLSNSAEV KRERLEDVVG GCCYRVNNSL DHEYQPRPVE VIISSAKEMV 100
    GQKMKYSIVS RNCEHFVTQL RYGKSRCKQV EKAKVEVGVA TALGILVVAG 150
    CSFAIRRYQK KATA 164
    Length:164
    Mass (Da):18,179
    Last modified:May 1, 2000 - v1
    Checksum:i95625B8FD375FD38
    GO
    Isoform 2 (identifier: Q9UL19-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE

    Note: No experimental confirmation available.

    Show »
    Length:156
    Mass (Da):17,436
    Checksum:iC9DA5B23E1BC9C8A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti44 – 441G → R in BAG56873. (PubMed:14702039)Curated
    Sequence conflicti63 – 631E → G in AAC84000. (PubMed:9843971)Curated
    Sequence conflicti118 – 1181T → A in AAC84000. (PubMed:9843971)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti69 – 691V → L.
    Corresponds to variant rs35502888 [ dbSNP | Ensembl ].
    VAR_049480
    Natural varianti162 – 1621A → V.
    Corresponds to variant rs35845275 [ dbSNP | Ensembl ].
    VAR_049481

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei131 – 16434EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2. 1 PublicationVSP_041496Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF060228 mRNA. Translation: AAC84000.1.
    AF092922 mRNA. Translation: AAF02294.1.
    AB453252 mRNA. Translation: BAH22446.1.
    AB030815 mRNA. Translation: BAB08109.1.
    AK293357 mRNA. Translation: BAG56873.1.
    AK312110 mRNA. Translation: BAG35046.1.
    AP001591 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74156.1.
    BC009678 mRNA. Translation: AAH09678.1.
    CCDSiCCDS41662.1. [Q9UL19-1]
    RefSeqiNP_004576.2. NM_004585.4. [Q9UL19-1]
    UniGeneiHs.17466.

    Genome annotation databases

    EnsembliENST00000255688; ENSP00000255688; ENSG00000133321. [Q9UL19-1]
    ENST00000439013; ENSP00000402943; ENSG00000133321. [Q9UL19-2]
    GeneIDi5920.
    KEGGihsa:5920.
    UCSCiuc001nxf.4. human. [Q9UL19-1]

    Polymorphism databases

    DMDMi20140910.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF060228 mRNA. Translation: AAC84000.1 .
    AF092922 mRNA. Translation: AAF02294.1 .
    AB453252 mRNA. Translation: BAH22446.1 .
    AB030815 mRNA. Translation: BAB08109.1 .
    AK293357 mRNA. Translation: BAG56873.1 .
    AK312110 mRNA. Translation: BAG35046.1 .
    AP001591 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74156.1 .
    BC009678 mRNA. Translation: AAH09678.1 .
    CCDSi CCDS41662.1. [Q9UL19-1 ]
    RefSeqi NP_004576.2. NM_004585.4. [Q9UL19-1 ]
    UniGenei Hs.17466.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2LKT NMR - A 1-125 [» ]
    ProteinModelPortali Q9UL19.
    SMRi Q9UL19. Positions 1-125.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111855. 11 interactions.
    STRINGi 9606.ENSP00000255688.

    PTM databases

    PhosphoSitei Q9UL19.

    Polymorphism databases

    DMDMi 20140910.

    Proteomic databases

    PaxDbi Q9UL19.
    PRIDEi Q9UL19.

    Protocols and materials databases

    DNASUi 5920.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000255688 ; ENSP00000255688 ; ENSG00000133321 . [Q9UL19-1 ]
    ENST00000439013 ; ENSP00000402943 ; ENSG00000133321 . [Q9UL19-2 ]
    GeneIDi 5920.
    KEGGi hsa:5920.
    UCSCi uc001nxf.4. human. [Q9UL19-1 ]

    Organism-specific databases

    CTDi 5920.
    GeneCardsi GC11P063304.
    H-InvDB HIX0128662.
    HGNCi HGNC:9869. RARRES3.
    HPAi HPA011219.
    MIMi 605092. gene.
    neXtProti NX_Q9UL19.
    PharmGKBi PA34230.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG116857.
    HOGENOMi HOG000293227.
    HOVERGENi HBG028837.
    InParanoidi Q9UL19.
    OMAi ECGCDER.
    OrthoDBi EOG7B8S59.
    PhylomeDBi Q9UL19.
    TreeFami TF330836.

    Miscellaneous databases

    GeneWikii RARRES3.
    GenomeRNAii 5920.
    NextBioi 23052.
    PROi Q9UL19.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UL19.
    Bgeei Q9UL19.
    CleanExi HS_RARRES3.
    Genevestigatori Q9UL19.

    Family and domain databases

    InterProi IPR007053. LRAT-like_dom.
    [Graphical view ]
    Pfami PF04970. LRAT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene."
      DiSepio D., Ghosn C., Eckert R.L., Deucher A., Robinson N., Duvic M., Chandraratna R.A.S., Nagpal S.
      Proc. Natl. Acad. Sci. U.S.A. 95:14811-14815(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Keratinocyte.
    2. "Cloning and characterization of a novel retinoid-inducible gene 1(RIG1) deriving from human gastric cancer cells."
      Huang S.L., Shyu R.Y., Yeh M.Y., Jiang S.Y.
      Mol. Cell. Endocrinol. 159:15-24(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION.
      Tissue: Stomach cancer.
    3. "Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes."
      Uyama T., Jin X.H., Tsuboi K., Tonai T., Ueda N.
      Biochim. Biophys. Acta 1791:1114-1124(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES.
      Tissue: Testis.
    4. Kato S.
      Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Gastric adenocarcinoma.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Spleen and Urinary bladder.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.

    Entry informationi

    Entry nameiHRSL4_HUMAN
    AccessioniPrimary (citable) accession number: Q9UL19
    Secondary accession number(s): B2R599
    , B4DDW2, E7ENZ7, O95200
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 31, 2002
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 100 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3