SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UL19

- HRSL4_HUMAN

UniProt

Q9UL19 - HRSL4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Retinoic acid receptor responder protein 3
Gene
RARRES3, RIG1, TIG3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable.1 Publication

Kineticsi

  1. KM=400 µM for dipalmitoyl-PC1 Publication

Vmax=530 nmol/min/mg enzyme with dipalmitoyl-PC as substrate

Vmax=240 nmol/min/mg enzyme with dipalmitoyl-PE as substrate

pH dependencei

Optimum pH is 8.

GO - Molecular functioni

  1. phospholipase A2 activity Source: UniProtKB

GO - Biological processi

  1. lipid catabolic process Source: UniProtKB-KW
  2. negative regulation of cell proliferation Source: ProtInc
  3. phospholipid metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Names & Taxonomyi

Protein namesi
Recommended name:
Retinoic acid receptor responder protein 3 (EC:3.1.1.-)
Alternative name(s):
HRAS-like suppressor 4
Short name:
HRSL4
RAR-responsive protein TIG3
Retinoid-inducible gene 1 protein
Tazarotene-induced gene 3 protein
Gene namesi
Name:RARRES3
Synonyms:RIG1, TIG3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:9869. RARRES3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 133133Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei134 – 15522Helical; Reviewed prediction
Add
BLAST
Topological domaini156 – 1649Lumenal Reviewed prediction

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34230.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 164164Retinoic acid receptor responder protein 3
PRO_0000152490Add
BLAST

Proteomic databases

PaxDbiQ9UL19.
PRIDEiQ9UL19.

PTM databases

PhosphoSiteiQ9UL19.

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Inductioni

By all-trans-retinoic acid and synthetic retinoids.1 Publication

Gene expression databases

ArrayExpressiQ9UL19.
BgeeiQ9UL19.
CleanExiHS_RARRES3.
GenevestigatoriQ9UL19.

Organism-specific databases

HPAiHPA011219.

Interactioni

Protein-protein interaction databases

BioGridi111855. 11 interactions.
STRINGi9606.ENSP00000255688.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi3 – 53
Beta strandi13 – 175
Beta strandi19 – 213
Beta strandi23 – 297
Beta strandi32 – 376
Beta strandi50 – 523
Beta strandi58 – 647
Helixi65 – 695
Beta strandi73 – 764
Helixi79 – 835
Helixi89 – 9911
Helixi109 – 12113

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2LKTNMR-A1-125[»]
ProteinModelPortaliQ9UL19.
SMRiQ9UL19. Positions 1-125.

Family & Domainsi

Sequence similaritiesi

Belongs to the H-rev107 family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG116857.
HOGENOMiHOG000293227.
HOVERGENiHBG028837.
InParanoidiQ9UL19.
OMAiECGCDER.
OrthoDBiEOG7B8S59.
PhylomeDBiQ9UL19.
TreeFamiTF330836.

Family and domain databases

InterProiIPR007053. LRAT-like_dom.
[Graphical view]
PfamiPF04970. LRAT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UL19-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASPHQEPKP GDLIEIFRLG YEHWALYIGD GYVIHLAPPS EYPGAGSSSV    50
FSVLSNSAEV KRERLEDVVG GCCYRVNNSL DHEYQPRPVE VIISSAKEMV 100
GQKMKYSIVS RNCEHFVTQL RYGKSRCKQV EKAKVEVGVA TALGILVVAG 150
CSFAIRRYQK KATA 164
Length:164
Mass (Da):18,179
Last modified:May 1, 2000 - v1
Checksum:i95625B8FD375FD38
GO
Isoform 2 (identifier: Q9UL19-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-164: EKAKVEVGVATALGILVVAGCSFAIRRYQKKATA → RTSLDNPSPSAWGWTHGAVQPGDHCE

Note: No experimental confirmation available.

Show »
Length:156
Mass (Da):17,436
Checksum:iC9DA5B23E1BC9C8A
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691V → L.
Corresponds to variant rs35502888 [ dbSNP | Ensembl ].
VAR_049480
Natural varianti162 – 1621A → V.
Corresponds to variant rs35845275 [ dbSNP | Ensembl ].
VAR_049481

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei131 – 16434EKAKV…KKATA → RTSLDNPSPSAWGWTHGAVQ PGDHCE in isoform 2.
VSP_041496Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti44 – 441G → R in BAG56873. 1 Publication
Sequence conflicti63 – 631E → G in AAC84000. 1 Publication
Sequence conflicti118 – 1181T → A in AAC84000. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF060228 mRNA. Translation: AAC84000.1.
AF092922 mRNA. Translation: AAF02294.1.
AB453252 mRNA. Translation: BAH22446.1.
AB030815 mRNA. Translation: BAB08109.1.
AK293357 mRNA. Translation: BAG56873.1.
AK312110 mRNA. Translation: BAG35046.1.
AP001591 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74156.1.
BC009678 mRNA. Translation: AAH09678.1.
CCDSiCCDS41662.1. [Q9UL19-1]
RefSeqiNP_004576.2. NM_004585.4. [Q9UL19-1]
UniGeneiHs.17466.

Genome annotation databases

EnsembliENST00000255688; ENSP00000255688; ENSG00000133321. [Q9UL19-1]
ENST00000439013; ENSP00000402943; ENSG00000133321. [Q9UL19-2]
GeneIDi5920.
KEGGihsa:5920.
UCSCiuc001nxf.4. human. [Q9UL19-1]

Polymorphism databases

DMDMi20140910.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF060228 mRNA. Translation: AAC84000.1 .
AF092922 mRNA. Translation: AAF02294.1 .
AB453252 mRNA. Translation: BAH22446.1 .
AB030815 mRNA. Translation: BAB08109.1 .
AK293357 mRNA. Translation: BAG56873.1 .
AK312110 mRNA. Translation: BAG35046.1 .
AP001591 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74156.1 .
BC009678 mRNA. Translation: AAH09678.1 .
CCDSi CCDS41662.1. [Q9UL19-1 ]
RefSeqi NP_004576.2. NM_004585.4. [Q9UL19-1 ]
UniGenei Hs.17466.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2LKT NMR - A 1-125 [» ]
ProteinModelPortali Q9UL19.
SMRi Q9UL19. Positions 1-125.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111855. 11 interactions.
STRINGi 9606.ENSP00000255688.

PTM databases

PhosphoSitei Q9UL19.

Polymorphism databases

DMDMi 20140910.

Proteomic databases

PaxDbi Q9UL19.
PRIDEi Q9UL19.

Protocols and materials databases

DNASUi 5920.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000255688 ; ENSP00000255688 ; ENSG00000133321 . [Q9UL19-1 ]
ENST00000439013 ; ENSP00000402943 ; ENSG00000133321 . [Q9UL19-2 ]
GeneIDi 5920.
KEGGi hsa:5920.
UCSCi uc001nxf.4. human. [Q9UL19-1 ]

Organism-specific databases

CTDi 5920.
GeneCardsi GC11P063304.
H-InvDB HIX0128662.
HGNCi HGNC:9869. RARRES3.
HPAi HPA011219.
MIMi 605092. gene.
neXtProti NX_Q9UL19.
PharmGKBi PA34230.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG116857.
HOGENOMi HOG000293227.
HOVERGENi HBG028837.
InParanoidi Q9UL19.
OMAi ECGCDER.
OrthoDBi EOG7B8S59.
PhylomeDBi Q9UL19.
TreeFami TF330836.

Miscellaneous databases

GeneWikii RARRES3.
GenomeRNAii 5920.
NextBioi 23052.
PROi Q9UL19.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UL19.
Bgeei Q9UL19.
CleanExi HS_RARRES3.
Genevestigatori Q9UL19.

Family and domain databases

InterProi IPR007053. LRAT-like_dom.
[Graphical view ]
Pfami PF04970. LRAT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene."
    DiSepio D., Ghosn C., Eckert R.L., Deucher A., Robinson N., Duvic M., Chandraratna R.A.S., Nagpal S.
    Proc. Natl. Acad. Sci. U.S.A. 95:14811-14815(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Keratinocyte.
  2. "Cloning and characterization of a novel retinoid-inducible gene 1(RIG1) deriving from human gastric cancer cells."
    Huang S.L., Shyu R.Y., Yeh M.Y., Jiang S.Y.
    Mol. Cell. Endocrinol. 159:15-24(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION.
    Tissue: Stomach cancer.
  3. "Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes."
    Uyama T., Jin X.H., Tsuboi K., Tonai T., Ueda N.
    Biochim. Biophys. Acta 1791:1114-1124(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES.
    Tissue: Testis.
  4. Kato S.
    Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Gastric adenocarcinoma.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Spleen and Urinary bladder.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.

Entry informationi

Entry nameiHRSL4_HUMAN
AccessioniPrimary (citable) accession number: Q9UL19
Secondary accession number(s): B2R599
, B4DDW2, E7ENZ7, O95200
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi