Q9UL15 (BAG5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BAG family molecular chaperone regulator 5 Short name=BAG-5 Alternative name(s): Bcl-2-associated athanogene 5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 447 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits both auto-ubiquitination of PARK2 and ubiquitination of target proteins by PARK2 By similarity. May function as a nucleotide exchange factor for HSP/HSP70, promoting ADP release, and activating Hsp70-mediated refolding. Ref.7 |
| Subunit structure | Binds to the ATPase domain of HSP/HSC70 chaperones. Binds PARK2 By similarity. Ref.7 |
| Domain | The fifth BAG domain is responsible for the interaction with HSP70 nucleotide-binding domain. Ref.7 |
| Sequence similarities | Contains 5 BAG domains. |
| Sequence caution | The sequence BAA74896.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UL15-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UL15-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRFHWLPTLSEPFDRNQELETCIRPLWTPSGSACETEHNKSM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 447 | 447 | BAG family molecular chaperone regulator 5 | PRO_0000088872 | ||||||||||||||
Regions | ||||||||||||||||||
| Domain | 9 – 86 | 78 | BAG 1 | |||||||||||||||
| Domain | 95 – 167 | 73 | BAG 2 | |||||||||||||||
| Domain | 182 – 260 | 79 | BAG 3 | |||||||||||||||
| Domain | 275 – 350 | 76 | BAG 4 | |||||||||||||||
| Domain | 365 – 442 | 78 | BAG 5 | |||||||||||||||
Amino acid modifications | ||||||||||||||||||
| Modified residue | 278 | 1 | N6-acetyllysine Ref.5 | |||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MRFHWLPTLSEPFDRNQELE TCIRPLWTPSGSACETEHNK SM in isoform 2. | VSP_037996 | ||||||||||||||
| Natural variant | 157 | 1 | C → W. Ref.4 Corresponds to variant rs17854644 [ dbSNP | Ensembl ]. | VAR_058712 | ||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Helix | 277 – 295 | 19 | ||||||||||||||||
| Turn | 299 – 301 | 3 | ||||||||||||||||
| Helix | 302 – 310 | 9 | ||||||||||||||||
| Helix | 317 – 320 | 4 | ||||||||||||||||
| Helix | 326 – 350 | 25 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators." Takayama S., Xie Z., Reed J.C. J. Biol. Chem. 274:781-786(1999) [PubMed: 9873016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT TRP-157. Tissue: Brain. |
| [5] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-278, MASS SPECTROMETRY. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange." Arakawa A., Handa N., Ohsawa N., Shida M., Kigawa T., Hayashi F., Shirouzu M., Yokoyama S. Structure 18:309-319(2010) [PubMed: 20223214] [Abstract] Cited for: STRUCTURE BY NMR OF 275-350, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 341-447 IN COMPLEX WITH HSPA1, DOMAIN BAG, FUNCTION, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF095195 mRNA. Translation: AAD16124.2. AB020680 mRNA. Translation: BAA74896.1. Different initiation. AL139300 Genomic DNA. No translation available. BC044216 mRNA. Translation: AAH44216.2. BC050551 mRNA. Translation: AAH50551.1. | ||||||||||||||||||
| IPI | IPI00007731. IPI00556027. | ||||||||||||||||||
| RefSeq | NP_001015048.1. NM_001015048.2. NP_001015049.1. NM_001015049.2. NP_004864.1. NM_004873.3. | ||||||||||||||||||
| UniGene | Hs.5443. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9UL15. | ||||||||||||||||||
| SMR | Q9UL15. Positions 1-89, 178-259, 276-447. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-53428N. | ||||||||||||||||||
| IntAct | Q9UL15. 5 interactions. | ||||||||||||||||||
| MINT | MINT-1147557. | ||||||||||||||||||
| STRING | Q9UL15. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9UL15. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 12643895. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q9UL15. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000299204; ENSP00000299204; ENSG00000166170. ENST00000337322; ENSP00000338814; ENSG00000166170. ENST00000445922; ENSP00000391713; ENSG00000166170. | ||||||||||||||||||
| GeneID | 9529. | ||||||||||||||||||
| KEGG | hsa:9529. | ||||||||||||||||||
| UCSC | uc001ynh.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9529. | ||||||||||||||||||
| GeneCards | GC14M104022. | ||||||||||||||||||
| H-InvDB | HIX0012003. | ||||||||||||||||||
| HGNC | HGNC:941. BAG5. | ||||||||||||||||||
| HPA | HPA016429. | ||||||||||||||||||
| MIM | 603885. gene. | ||||||||||||||||||
| neXtProt | NX_Q9UL15. | ||||||||||||||||||
| PharmGKB | PA25241. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG13028. | ||||||||||||||||||
| GeneTree | ENSGT00530000063256. | ||||||||||||||||||
| HOGENOM | HBG713028. | ||||||||||||||||||
| HOVERGEN | HBG004810. | ||||||||||||||||||
| InParanoid | Q9UL15. | ||||||||||||||||||
| OMA | YIRLEEL. | ||||||||||||||||||
| OrthoDB | EOG46T31D. | ||||||||||||||||||
| PhylomeDB | Q9UL15. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9UL15. | ||||||||||||||||||
| Bgee | Q9UL15. | ||||||||||||||||||
| CleanEx | HS_BAG5. | ||||||||||||||||||
| Genevestigator | Q9UL15. | ||||||||||||||||||
| GermOnline | ENSG00000166170. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003103. BAG_domain. [Graphical view] | ||||||||||||||||||
| KO | K09559. | ||||||||||||||||||
| Pfam | PF02179. BAG. 4 hits. [Graphical view] | ||||||||||||||||||
| SMART | SM00264. BAG. 4 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS51035. BAG. 4 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 35720. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BAG5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UL15 Secondary accession number(s): O94950, Q86W59 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with