Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UL15 (BAG5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
BAG family molecular chaperone regulator 5

Short name=BAG-5
Alternative name(s):
Bcl-2-associated athanogene 5
Gene names
Name:BAG5
Synonyms:KIAA0873
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length447 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Inhibits both auto-ubiquitination of PARK2 and ubiquitination of target proteins by PARK2 By similarity. May function as a nucleotide exchange factor for HSP/HSP70, promoting ADP release, and activating Hsp70-mediated refolding. Ref.7

Subunit structure

Binds to the ATPase domain of HSP/HSC70 chaperones. Binds PARK2. Ref.6 Ref.7

Domain

The fifth BAG domain is responsible for the interaction with HSP70 nucleotide-binding domain. Ref.7

Sequence similarities

Contains 5 BAG domains.

Sequence caution

The sequence BAA74896.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9UL15-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UL15-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRFHWLPTLSEPFDRNQELETCIRPLWTPSGSACETEHNKSM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 447447BAG family molecular chaperone regulator 5
PRO_0000088872

Regions

Domain9 – 8678BAG 1
Domain95 – 16773BAG 2
Domain182 – 26079BAG 3
Domain275 – 35076BAG 4
Domain365 – 44278BAG 5

Natural variations

Alternative sequence11M → MRFHWLPTLSEPFDRNQELE TCIRPLWTPSGSACETEHNK SM in isoform 2.
VSP_037996
Natural variant1571C → W. Ref.4
Corresponds to variant rs17854644 [ dbSNP | Ensembl ].
VAR_058712

Secondary structure

................. 447
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 0D3F7EA6B612C1F5

FASTA44751,200
        10         20         30         40         50         60 
MDMGNQHPSI SRLQEIQKEV KSVEQQVIGF SGLSDDKNYK KLERILTKQL FEIDSVDTEG 

        70         80         90        100        110        120 
KGDIQQARKR AAQETERLLK ELEQNANHPH RIEIQNIFEE AQSLVREKIV PFYNGGNCVT 

       130        140        150        160        170        180 
DEFEEGIQDI ILRLTHVKTG GKISLRKARY HTLTKICAVQ EIIEDCMKKQ PSLPLSEDAH 

       190        200        210        220        230        240 
PSVAKINFVM CEVNKARGVL IALLMGVNNN ETCRHLSCVL SGLIADLDAL DVCGRTEIRN 

       250        260        270        280        290        300 
YRREVVEDIN KLLKYLDLEE EADTTKAFDL RQNHSILKIE KVLKRMREIK NELLQAQNPS 

       310        320        330        340        350        360 
ELYLSSKTEL QGLIGQLDEV SLEKNPCIRE ARRRAVIEVQ TLITYIDLKE ALEKRKLFAC 

       370        380        390        400        410        420 
EEHPSHKAVW NVLGNLSEIQ GEVLSFDGNR TDKNYIRLEE LLTKQLLALD AVDPQGEEKC 

       430        440 
KAARKQAVRL AQNILSYLDL KSDEWEY 

« Hide

Isoform 2 [UniParc].

Checksum: 7A901A14F9B07AC2
Show »

FASTA48856,027

References

« Hide 'large scale' references
[1]"An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators."
Takayama S., Xie Z., Reed J.C.
J. Biol. Chem. 274:781-786(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT TRP-157.
Tissue: Brain.
[5]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[6]"High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy."
Hasson S.A., Kane L.A., Yamano K., Huang C.H., Sliter D.A., Buehler E., Wang C., Heman-Ackah S.M., Hessa T., Guha R., Martin S.E., Youle R.J.
Nature 504:291-295(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PARK2.
[7]"The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange."
Arakawa A., Handa N., Ohsawa N., Shida M., Kigawa T., Hayashi F., Shirouzu M., Yokoyama S.
Structure 18:309-319(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 275-350, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 341-447 IN COMPLEX WITH HSPA1, DOMAIN BAG, FUNCTION, SUBUNIT.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF095195 mRNA. Translation: AAD16124.2.
AB020680 mRNA. Translation: BAA74896.1. Different initiation.
AL139300 Genomic DNA. No translation available.
BC044216 mRNA. Translation: AAH44216.2.
BC050551 mRNA. Translation: AAH50551.1.
CCDSCCDS41995.1. [Q9UL15-2]
CCDS9982.1. [Q9UL15-1]
RefSeqNP_001015048.1. NM_001015048.2. [Q9UL15-1]
NP_001015049.1. NM_001015049.2. [Q9UL15-2]
NP_004864.1. NM_004873.3. [Q9UL15-1]
UniGeneHs.5443.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2D9DNMR-A275-350[»]
3A8YX-ray2.30C/D341-447[»]
ProteinModelPortalQ9UL15.
SMRQ9UL15. Positions 1-89, 276-447.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114905. 16 interactions.
DIPDIP-53428N.
IntActQ9UL15. 8 interactions.
MINTMINT-1147557.
STRING9606.ENSP00000338814.

PTM databases

PhosphoSiteQ9UL15.

Polymorphism databases

DMDM12643895.

Proteomic databases

MaxQBQ9UL15.
PaxDbQ9UL15.
PRIDEQ9UL15.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000299204; ENSP00000299204; ENSG00000166170. [Q9UL15-1]
ENST00000337322; ENSP00000338814; ENSG00000166170. [Q9UL15-2]
ENST00000445922; ENSP00000391713; ENSG00000166170. [Q9UL15-1]
GeneID9529.
KEGGhsa:9529.
UCSCuc001ynh.2. human. [Q9UL15-2]
uc001yni.2. human. [Q9UL15-1]

Organism-specific databases

CTD9529.
GeneCardsGC14M104022.
HGNCHGNC:941. BAG5.
HPAHPA016429.
MIM603885. gene.
neXtProtNX_Q9UL15.
PharmGKBPA25241.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG262724.
HOGENOMHOG000070447.
HOVERGENHBG004810.
InParanoidQ9UL15.
KOK09559.
OMADMGNQHP.
OrthoDBEOG7WX08F.
PhylomeDBQ9UL15.
TreeFamTF102014.

Gene expression databases

ArrayExpressQ9UL15.
BgeeQ9UL15.
CleanExHS_BAG5.
GenevestigatorQ9UL15.

Family and domain databases

Gene3D1.20.58.120. 4 hits.
InterProIPR003103. BAG_domain.
[Graphical view]
PfamPF02179. BAG. 4 hits.
[Graphical view]
SMARTSM00264. BAG. 4 hits.
[Graphical view]
PROSITEPS51035. BAG. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9UL15.
GeneWikiBAG5.
GenomeRNAi9529.
NextBio35720.
PROQ9UL15.
SOURCESearch...

Entry information

Entry nameBAG5_HUMAN
AccessionPrimary (citable) accession number: Q9UL15
Secondary accession number(s): O94950, Q86W59
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM