Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor VAV3

Gene

VAV3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

GO - Molecular functioni

GO - Biological processi

  • angiogenesis Source: UniProtKB-KW
  • B cell receptor signaling pathway Source: UniProtKB
  • cellular response to DNA damage stimulus Source: UniProtKB
  • ephrin receptor signaling pathway Source: Reactome
  • Fc-epsilon receptor signaling pathway Source: Reactome
  • Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
  • integrin-mediated signaling pathway Source: Ensembl
  • lamellipodium assembly Source: Ensembl
  • neutrophil chemotaxis Source: Ensembl
  • platelet activation Source: Reactome
  • positive regulation of apoptotic process Source: Reactome
  • positive regulation of B cell proliferation Source: UniProtKB
  • positive regulation of cell adhesion Source: Ensembl
  • positive regulation of phosphatidylinositol 3-kinase activity Source: Ensembl
  • regulation of cell size Source: UniProtKB
  • regulation of GTPase activity Source: UniProtKB
  • regulation of Rho protein signal transduction Source: InterPro
  • regulation of small GTPase mediated signal transduction Source: Reactome
  • response to drug Source: UniProtKB
  • small GTPase mediated signal transduction Source: ProtInc
  • vascular endothelial growth factor receptor signaling pathway Source: Reactome
  • vesicle fusion Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Biological processi

Angiogenesis

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000134215-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-2424491. DAP12 signaling.
R-HSA-2871796. FCERI mediated MAPK activation.
R-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-3928665. EPH-ephrin mediated repulsion of cells.
R-HSA-416482. G alpha (12/13) signalling events.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5218920. VEGFR2 mediated vascular permeability.
SignaLinkiQ9UKW4.
SIGNORiQ9UKW4.

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide exchange factor VAV3
Short name:
VAV-3
Gene namesi
Name:VAV3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:12659. VAV3.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • plasma membrane Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi10451.
OpenTargetsiENSG00000134215.
PharmGKBiPA37282.

Polymorphism and mutation databases

BioMutaiVAV3.
DMDMi12643372.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809861 – 847Guanine nucleotide exchange factor VAV3Add BLAST847

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei141PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated. Phosphorylation can be mediated by ROS1. In osteoclasts, undergoes tyrosine phosphorylation in response to CSF1 (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UKW4.
PaxDbiQ9UKW4.
PeptideAtlasiQ9UKW4.
PRIDEiQ9UKW4.

PTM databases

iPTMnetiQ9UKW4.
PhosphoSitePlusiQ9UKW4.

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.2 Publications

Inductioni

Down-regulated by EGF and TGF-beta.1 Publication

Gene expression databases

BgeeiENSG00000134215.
CleanExiHS_VAV3.
ExpressionAtlasiQ9UKW4. baseline and differential.
GenevisibleiQ9UKW4. HS.

Organism-specific databases

HPAiCAB002012.
HPA028138.

Interactioni

Subunit structurei

Interacts with the PH domain of APS. Interacts (via SH2 domains) with the phosphorylated form of EPHA2. Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
GAB1Q134806EBI-297568,EBI-517684
GRB2P629937EBI-297568,EBI-401755
METP085812EBI-297568,EBI-1039152
PIK3R1P279862EBI-297568,EBI-79464

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi115715. 14 interactors.
IntActiQ9UKW4. 14 interactors.
MINTiMINT-256977.
STRINGi9606.ENSP00000359073.

Structurei

Secondary structure

1847
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 13Combined sources11
Helixi30 – 38Combined sources9
Helixi41 – 50Combined sources10
Helixi57 – 59Combined sources3
Helixi68 – 84Combined sources17
Turni90 – 92Combined sources3
Helixi96 – 100Combined sources5
Helixi106 – 115Combined sources10
Helixi121 – 124Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D86NMR-A1-130[»]
ProteinModelPortaliQ9UKW4.
SMRiQ9UKW4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UKW4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 119CHPROSITE-ProRule annotationAdd BLAST119
Domaini192 – 371DHPROSITE-ProRule annotationAdd BLAST180
Domaini400 – 502PHPROSITE-ProRule annotationAdd BLAST103
Domaini592 – 660SH3 1PROSITE-ProRule annotationAdd BLAST69
Domaini672 – 766SH2PROSITE-ProRule annotationAdd BLAST95
Domaini788 – 847SH3 2PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni560 – 847Sufficient for interaction with ROS11 PublicationAdd BLAST288

Sequence similaritiesi

Contains 1 CH (calponin-homology) domain.PROSITE-ProRule annotation
Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation
Contains 2 SH3 domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri513 – 562Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST50

Keywords - Domaini

Repeat, SH2 domain, SH3 domain, Zinc-finger

Phylogenomic databases

eggNOGiKOG2996. Eukaryota.
ENOG410XPH6. LUCA.
GeneTreeiENSGT00800000124085.
HOGENOMiHOG000234364.
HOVERGENiHBG018066.
InParanoidiQ9UKW4.
KOiK05730.
OMAiGPPLHIQ.
OrthoDBiEOG091G01O3.
PhylomeDBiQ9UKW4.
TreeFamiTF316171.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd00014. CH. 1 hit.
Gene3Di1.10.418.10. 1 hit.
1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR022613. CAMSAP_CH.
IPR001715. CH-domain.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000980. SH2.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR003096. SM22_calponin.
IPR028530. Vav.
[Graphical view]
PANTHERiPTHR22826:SF97. PTHR22826:SF97. 1 hit.
PfamiPF00130. C1_1. 1 hit.
PF11971. CAMSAP_CH. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF00017. SH2. 1 hit.
PF07653. SH3_2. 2 hits.
[Graphical view]
PRINTSiPR00401. SH2DOMAIN.
PR00452. SH3DOMAIN.
PR00888. SM22CALPONIN.
SMARTiSM00109. C1. 1 hit.
SM00033. CH. 1 hit.
SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00252. SH2. 1 hit.
SM00326. SH3. 2 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 2 hits.
SSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 2 hits.
PROSITEiPS50021. CH. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50001. SH2. 1 hit.
PS50002. SH3. 2 hits.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UKW4-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPWKQCAQW LIHCKVLPTN HRVTWDSAQV FDLAQTLRDG VLLCQLLNNL
60 70 80 90 100
RAHSINLKEI NLRPQMSQFL CLKNIRTFLT ACCETFGMRK SELFEAFDLF
110 120 130 140 150
DVRDFGKVIE TLSRLSRTPI ALATGIRPFP TEESINDEDI YKGLPDLIDE
160 170 180 190 200
TLVEDEEDLY DCVYGEDEGG EVYEDLMKAE EAHQPKCPEN DIRSCCLAEI
210 220 230 240 250
KQTEEKYTET LESIEKYFMA PLKRFLTAAE FDSVFINIPE LVKLHRNLMQ
260 270 280 290 300
EIHDSIVNKN DQNLYQVFIN YKERLVIYGQ YCSGVESAIS SLDYISKTKE
310 320 330 340 350
DVKLKLEECS KRANNGKFTL RDLLVVPMQR VLKYHLLLQE LVKHTTDPTE
360 370 380 390 400
KANLKLALDA MKDLAQYVNE VKRDNETLRE IKQFQLSIEN LNQPVLLFGR
410 420 430 440 450
PQGDGEIRIT TLDKHTKQER HIFLFDLAVI VCKRKGDNYE MKEIIDLQQY
460 470 480 490 500
KIANNPTTDK ENKKWSYGFY LIHTQGQNGL EFYCKTKDLK KKWLEQFEMA
510 520 530 540 550
LSNIRPDYAD SNFHDFKMHT FTRVTSCKVC QMLLRGTFYQ GYLCFKCGAR
560 570 580 590 600
AHKECLGRVD NCGRVNSGEQ GTLKLPEKRT NGLRRTPKQV DPGLPKMQVI
610 620 630 640 650
RNYSGTPPPA LHEGPPLQLQ AGDTVELLKG DAHSLFWQGR NLASGEVGFF
660 670 680 690 700
PSDAVKPCPC VPKPVDYSCQ PWYAGAMERL QAETELINRV NSTYLVRHRT
710 720 730 740 750
KESGEYAISI KYNNEAKHIK ILTRDGFFHI AENRKFKSLM ELVEYYKHHS
760 770 780 790 800
LKEGFRTLDT TLQFPYKEPE HSAGQRGNRA GNSLLSPKVL GIAIARYDFC
810 820 830 840
ARDMRELSLL KGDVVKIYTK MSANGWWRGE VNGRVGWFPS TYVEEDE
Length:847
Mass (Da):97,776
Last modified:May 1, 2000 - v1
Checksum:iC1E29F0B094CB721
GO
Isoform 2 (identifier: Q9UKW4-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: MEPWKQCAQW...DLFDVRDFGK → MQLPDCPCRAHLP

Show »
Length:753
Mass (Da):86,696
Checksum:iA67868CBD2FFD9A7
GO
Isoform 3 (identifier: Q9UKW4-3) [UniParc]FASTAAdd to basket
Also known as: VAV3.1

The sequence of this isoform differs from the canonical sequence as follows:
     1-560: Missing.
     561-568: NCGRVNSG → MPIFTFLS

Note: May be produced by alternative promoter usage.
Show »
Length:287
Mass (Da):32,604
Checksum:iD23C21EBEF7F48CF
GO
Isoform 4 (identifier: Q9UKW4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     783-784: SL → SSPSLFCGFSFVTPPDYSFVPPSSTPFWSV

Note: No experimental confirmation available.
Show »
Length:875
Mass (Da):100,828
Checksum:iAD6B651338EEE812
GO

Sequence cautioni

The sequence AAD03799 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti107K → E in AAC79695 (PubMed:9705494).Curated1
Sequence conflicti217Y → H in AAD20348 (PubMed:10523675).Curated1
Sequence conflicti429V → A in AAD20348 (PubMed:10523675).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061800139D → N.Corresponds to variant rs34318889dbSNPEnsembl.1
Natural variantiVAR_033522298T → S.2 PublicationsCorresponds to variant rs7528153dbSNPEnsembl.1
Natural variantiVAR_051998616P → S.Corresponds to variant rs12410676dbSNPEnsembl.1
Natural variantiVAR_033523618Q → H.Corresponds to variant rs12403266dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0413601 – 560Missing in isoform 3. 2 PublicationsAdd BLAST560
Alternative sequenceiVSP_0018201 – 107MEPWK…RDFGK → MQLPDCPCRAHLP in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_041361561 – 568NCGRVNSG → MPIFTFLS in isoform 3. 2 Publications8
Alternative sequenceiVSP_042359783 – 784SL → SSPSLFCGFSFVTPPDYSFV PPSSTPFWSV in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF035442 mRNA. Translation: AAD03799.1. Different initiation.
AF067817 mRNA. Translation: AAC79695.1.
AF118887 mRNA. Translation: AAD20349.1.
AF118886 mRNA. Translation: AAD20348.1.
AK304088 mRNA. Translation: BAG64994.1.
AK316295 mRNA. Translation: BAH14666.1.
AL391235
, AC114491, AL353892, AL513206, AL591042 Genomic DNA. Translation: CAH72458.1.
AL513206
, AC114491, AL353892, AL391235, AL591042 Genomic DNA. Translation: CAH73195.1.
AL513206, AC114491, AL591042 Genomic DNA. Translation: CAH73196.1.
AL591042
, AC114491, AL353892, AL391235, AL513206 Genomic DNA. Translation: CAI14457.1.
AL591042, AC114491, AL513206 Genomic DNA. Translation: CAI14458.1.
AL353892
, AC114491, AL391235, AL513206, AL591042 Genomic DNA. Translation: CAI21786.1.
CH471156 Genomic DNA. Translation: EAW51252.1.
BC143969 mRNA. Translation: AAI43970.1.
CCDSiCCDS44181.1. [Q9UKW4-3]
CCDS785.1. [Q9UKW4-1]
RefSeqiNP_001073343.1. NM_001079874.1. [Q9UKW4-3]
NP_006104.4. NM_006113.4. [Q9UKW4-1]
XP_005270417.1. XM_005270360.2. [Q9UKW4-2]
UniGeneiHs.267659.

Genome annotation databases

EnsembliENST00000370056; ENSP00000359073; ENSG00000134215. [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215. [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215. [Q9UKW4-4]
GeneIDi10451.
KEGGihsa:10451.
UCSCiuc001dvj.2. human. [Q9UKW4-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF035442 mRNA. Translation: AAD03799.1. Different initiation.
AF067817 mRNA. Translation: AAC79695.1.
AF118887 mRNA. Translation: AAD20349.1.
AF118886 mRNA. Translation: AAD20348.1.
AK304088 mRNA. Translation: BAG64994.1.
AK316295 mRNA. Translation: BAH14666.1.
AL391235
, AC114491, AL353892, AL513206, AL591042 Genomic DNA. Translation: CAH72458.1.
AL513206
, AC114491, AL353892, AL391235, AL591042 Genomic DNA. Translation: CAH73195.1.
AL513206, AC114491, AL591042 Genomic DNA. Translation: CAH73196.1.
AL591042
, AC114491, AL353892, AL391235, AL513206 Genomic DNA. Translation: CAI14457.1.
AL591042, AC114491, AL513206 Genomic DNA. Translation: CAI14458.1.
AL353892
, AC114491, AL391235, AL513206, AL591042 Genomic DNA. Translation: CAI21786.1.
CH471156 Genomic DNA. Translation: EAW51252.1.
BC143969 mRNA. Translation: AAI43970.1.
CCDSiCCDS44181.1. [Q9UKW4-3]
CCDS785.1. [Q9UKW4-1]
RefSeqiNP_001073343.1. NM_001079874.1. [Q9UKW4-3]
NP_006104.4. NM_006113.4. [Q9UKW4-1]
XP_005270417.1. XM_005270360.2. [Q9UKW4-2]
UniGeneiHs.267659.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D86NMR-A1-130[»]
ProteinModelPortaliQ9UKW4.
SMRiQ9UKW4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115715. 14 interactors.
IntActiQ9UKW4. 14 interactors.
MINTiMINT-256977.
STRINGi9606.ENSP00000359073.

PTM databases

iPTMnetiQ9UKW4.
PhosphoSitePlusiQ9UKW4.

Polymorphism and mutation databases

BioMutaiVAV3.
DMDMi12643372.

Proteomic databases

EPDiQ9UKW4.
PaxDbiQ9UKW4.
PeptideAtlasiQ9UKW4.
PRIDEiQ9UKW4.

Protocols and materials databases

DNASUi10451.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370056; ENSP00000359073; ENSG00000134215. [Q9UKW4-1]
ENST00000415432; ENSP00000394897; ENSG00000134215. [Q9UKW4-3]
ENST00000527011; ENSP00000432540; ENSG00000134215. [Q9UKW4-4]
GeneIDi10451.
KEGGihsa:10451.
UCSCiuc001dvj.2. human. [Q9UKW4-1]

Organism-specific databases

CTDi10451.
DisGeNETi10451.
GeneCardsiVAV3.
HGNCiHGNC:12659. VAV3.
HPAiCAB002012.
HPA028138.
MIMi605541. gene.
neXtProtiNX_Q9UKW4.
OpenTargetsiENSG00000134215.
PharmGKBiPA37282.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2996. Eukaryota.
ENOG410XPH6. LUCA.
GeneTreeiENSGT00800000124085.
HOGENOMiHOG000234364.
HOVERGENiHBG018066.
InParanoidiQ9UKW4.
KOiK05730.
OMAiGPPLHIQ.
OrthoDBiEOG091G01O3.
PhylomeDBiQ9UKW4.
TreeFamiTF316171.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000134215-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-2424491. DAP12 signaling.
R-HSA-2871796. FCERI mediated MAPK activation.
R-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-3928665. EPH-ephrin mediated repulsion of cells.
R-HSA-416482. G alpha (12/13) signalling events.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5218920. VEGFR2 mediated vascular permeability.
SignaLinkiQ9UKW4.
SIGNORiQ9UKW4.

Miscellaneous databases

ChiTaRSiVAV3. human.
EvolutionaryTraceiQ9UKW4.
GeneWikiiVAV3.
GenomeRNAii10451.
PROiQ9UKW4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134215.
CleanExiHS_VAV3.
ExpressionAtlasiQ9UKW4. baseline and differential.
GenevisibleiQ9UKW4. HS.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd00014. CH. 1 hit.
Gene3Di1.10.418.10. 1 hit.
1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR022613. CAMSAP_CH.
IPR001715. CH-domain.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000980. SH2.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR003096. SM22_calponin.
IPR028530. Vav.
[Graphical view]
PANTHERiPTHR22826:SF97. PTHR22826:SF97. 1 hit.
PfamiPF00130. C1_1. 1 hit.
PF11971. CAMSAP_CH. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF00017. SH2. 1 hit.
PF07653. SH3_2. 2 hits.
[Graphical view]
PRINTSiPR00401. SH2DOMAIN.
PR00452. SH3DOMAIN.
PR00888. SM22CALPONIN.
SMARTiSM00109. C1. 1 hit.
SM00033. CH. 1 hit.
SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00252. SH2. 1 hit.
SM00326. SH3. 2 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 2 hits.
SSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 2 hits.
PROSITEiPS50021. CH. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50001. SH2. 1 hit.
PS50002. SH3. 2 hits.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVAV3_HUMAN
AccessioniPrimary (citable) accession number: Q9UKW4
Secondary accession number(s): B1AMM0
, B1APV5, B4E232, B7ZLR1, E9PQ97, O60498, O95230, Q9Y5X8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 169 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.