Q9UKW4 (VAV3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Guanine nucleotide exchange factor VAV3 Short name=VAV-3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 847 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly By similarity. May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion By similarity. |
| Subunit structure | Interacts with the PH domain of APS. Interacts (via SH2 domains) with the phosphorylated form of EPHA2. Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation. Ref.7 Ref.8 Ref.9 |
| Tissue specificity | Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable. Ref.1 Ref.7 |
| Induction | Down-regulated by EGF and TGF-beta. Ref.1 |
| Post-translational modification | Phosphorylated. Phosphorylation can be mediated by ROS1. In osteoclasts, undergoes tyrosine phosphorylation in response to CSF1 By similarity. Ref.7 |
| Sequence similarities | Contains 1 CH (calponin-homology) domain. Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 SH2 domain. Contains 2 SH3 domains. |
| Sequence caution | The sequence AAD03799.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GRB2 | P62993 | 5 | EBI-297568,EBI-401755 |
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UKW4-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UKW4-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 1-107: MEPWKQCAQW...DLFDVRDFGK → MQLPDCPCRAHLP | ||||||
| Isoform 3 (identifier: Q9UKW4-3) Also known as: VAV3.1; The sequence of this isoform differs from the canonical sequence as follows: 1-560: Missing. 561-568: NCGRVNSG → MPIFTFLS | ||||||
| Note: May be produced by alternative promoter usage. | ||||||
| Isoform 4 (identifier: Q9UKW4-4) The sequence of this isoform differs from the canonical sequence as follows: 783-784: SL → SSPSLFCGFSFVTPPDYSFVPPSSTPFWSV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 847 | 847 | Guanine nucleotide exchange factor VAV3 | PRO_0000080986 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Domain | 1 – 119 | 119 | CH | ||||||||||||||||||||||||
| Domain | 192 – 371 | 180 | DH | ||||||||||||||||||||||||
| Domain | 400 – 502 | 103 | PH | ||||||||||||||||||||||||
| Domain | 592 – 660 | 69 | SH3 1 | ||||||||||||||||||||||||
| Domain | 672 – 766 | 95 | SH2 | ||||||||||||||||||||||||
| Domain | 788 – 847 | 60 | SH3 2 | ||||||||||||||||||||||||
| Zinc finger | 513 – 562 | 50 | Phorbol-ester/DAG-type | ||||||||||||||||||||||||
| Region | 560 – 847 | 288 | Sufficient for interaction with ROS1 | ||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||
| Modified residue | 141 | 1 | Phosphotyrosine Ref.10 | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 560 | 560 | Missing in isoform 3. | VSP_041360 | |||||||||||||||||||||||
| Alternative sequence | 1 – 107 | 107 | MEPWK…RDFGK → MQLPDCPCRAHLP in isoform 2. | VSP_001820 | |||||||||||||||||||||||
| Alternative sequence | 561 – 568 | 8 | NCGRVNSG → MPIFTFLS in isoform 3. | VSP_041361 | |||||||||||||||||||||||
| Alternative sequence | 783 – 784 | 2 | SL → SSPSLFCGFSFVTPPDYSFV PPSSTPFWSV in isoform 4. | VSP_042359 | |||||||||||||||||||||||
| Natural variant | 139 | 1 | D → N. Corresponds to variant rs34318889 [ dbSNP | Ensembl ]. | VAR_061800 | |||||||||||||||||||||||
| Natural variant | 298 | 1 | T → S. Ref.1 Ref.6 Corresponds to variant rs7528153 [ dbSNP | Ensembl ]. | VAR_033522 | |||||||||||||||||||||||
| Natural variant | 616 | 1 | P → S. Corresponds to variant rs12410676 [ dbSNP | Ensembl ]. | VAR_051998 | |||||||||||||||||||||||
| Natural variant | 618 | 1 | Q → H. Corresponds to variant rs12403266 [ dbSNP | Ensembl ]. | VAR_033523 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Sequence conflict | 107 | 1 | K → E in AAC79695. Ref.1 | ||||||||||||||||||||||||
| Sequence conflict | 217 | 1 | Y → H in AAD20348. Ref.2 | ||||||||||||||||||||||||
| Sequence conflict | 429 | 1 | V → A in AAD20348. Ref.2 | ||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Helix | 3 – 13 | 11 | |||||||||||||||||||||||||
| Helix | 30 – 38 | 9 | |||||||||||||||||||||||||
| Helix | 41 – 50 | 10 | |||||||||||||||||||||||||
| Helix | 57 – 59 | 3 | |||||||||||||||||||||||||
| Helix | 68 – 84 | 17 | |||||||||||||||||||||||||
| Turn | 90 – 92 | 3 | |||||||||||||||||||||||||
| Helix | 96 – 100 | 5 | |||||||||||||||||||||||||
| Helix | 106 – 115 | 10 | |||||||||||||||||||||||||
| Helix | 121 – 124 | 4 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Non-stoichiometric reduced complexity probes for cDNA arrays." Trenkle T., Welsh J., Jung B., Mathieu-Daude F., McClelland M. Nucleic Acids Res. 26:3883-3891(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 1-692 (ISOFORM 3), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY, INDUCTION, VARIANT SER-298. Tissue: Keratinocyte. |
| [2] | "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins." Movilla N., Bustelo X.R. Mol. Cell. Biol. 19:7870-7885(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Trachea. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT SER-298. |
| [7] | "Vav3 mediates receptor protein tyrosine kinase signaling, regulates GTPase activity, modulates cell morphology, and induces cell transformation." Zeng L., Sachdev P., Yan L., Chan J.L., Trenkle T., McClelland M., Welsh J., Wang L.H. Mol. Cell. Biol. 20:9212-9224(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ROS1, PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [8] | "Adaptor protein APS binds the NH2-terminal autoinhibitory domain of guanine nucleotide exchange factor Vav3 and augments its activity." Yabana N., Shibuya M. Oncogene 21:7720-7729(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH APS. |
| [9] | "Essential role of Vav family guanine nucleotide exchange factors in EphA receptor-mediated angiogenesis." Hunter S.G., Zhuang G., Brantley-Sieders D.M., Swat W., Cowan C.W., Chen J. Mol. Cell. Biol. 26:4830-4842(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EPHA2. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-141, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Solution structure of the CH domain from human VAV-3 protein." RIKEN structural genomics initiative (RSGI) Submitted (DEC-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1-134. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF035442 mRNA. Translation: AAD03799.1. Different initiation. AF067817 mRNA. Translation: AAC79695.1. AF118887 mRNA. Translation: AAD20349.1. AF118886 mRNA. Translation: AAD20348.1. AK304088 mRNA. Translation: BAG64994.1. AK316295 mRNA. Translation: BAH14666.1. AL391235 AL591042 Genomic DNA. Translation: CAH72458.1.AL513206 AL591042 Genomic DNA. Translation: CAH73195.1.AL513206, AC114491, AL591042 Genomic DNA. Translation: CAH73196.1. AL591042 AL513206 Genomic DNA. Translation: CAI14457.1.AL591042, AC114491, AL513206 Genomic DNA. Translation: CAI14458.1. AL353892 AL591042 Genomic DNA. Translation: CAI21786.1.CH471156 Genomic DNA. Translation: EAW51252.1. BC143969 mRNA. Translation: AAI43970.1. | ||||||||||||
| IPI | IPI00219689. IPI00299763. IPI00976117. | ||||||||||||
| RefSeq | NP_001073343.1. NM_001079874.1. NP_006104.4. NM_006113.4. | ||||||||||||
| UniGene | Hs.267659. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UKW4. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9UKW4. 3 interactions. | ||||||||||||
| MINT | MINT-256977. | ||||||||||||
| STRING | 9606.ENSP00000359073. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UKW4. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 12643372. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UKW4. | ||||||||||||
| PRIDE | Q9UKW4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 10451. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000370056; ENSP00000359073; ENSG00000134215. ENST00000415432; ENSP00000394897; ENSG00000134215. ENST00000527011; ENSP00000432540; ENSG00000134215. | ||||||||||||
| GeneID | 10451. | ||||||||||||
| KEGG | hsa:10451. | ||||||||||||
| UCSC | uc001dvj.1. human. uc001dvk.1. human. uc010ouw.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10451. | ||||||||||||
| GeneCards | GC01M108113. | ||||||||||||
| HGNC | HGNC:12659. VAV3. | ||||||||||||
| HPA | CAB002012. HPA028138. | ||||||||||||
| MIM | 605541. gene. | ||||||||||||
| neXtProt | NX_Q9UKW4. | ||||||||||||
| PharmGKB | PA37282. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG326494. | ||||||||||||
| HOGENOM | HOG000049191. | ||||||||||||
| HOVERGEN | HBG018066. | ||||||||||||
| InParanoid | Q9UKW4. | ||||||||||||
| KO | K05730. | ||||||||||||
| OMA | EAKHIKI. | ||||||||||||
| OrthoDB | EOG4TB49P. | ||||||||||||
| PhylomeDB | Q9UKW4. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | ar_pathway. Coregulation of Androgen receptor activity. epha_fwdpathway. EPHA forward signaling. epha2_fwdpathway. EPHA2 forward signaling. avb3_integrin_pathway. Integrins in angiogenesis. avb3_opn_pathway. Osteopontin-mediated events. | ||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_604. Hemostasis. REACT_6900. Immune System. | ||||||||||||
| SignaLink | Q9UKW4. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UKW4. | ||||||||||||
| Bgee | Q9UKW4. | ||||||||||||
| CleanEx | HS_VAV3. | ||||||||||||
| Genevestigator | Q9UKW4. | ||||||||||||
| GermOnline | ENSG00000134215. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.418.10. 1 hit. 1.20.900.10. 1 hit. 2.30.29.30. 1 hit. 3.30.505.10. 1 hit. | ||||||||||||
| InterPro | IPR001715. CH-domain. IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000980. SH2. IPR011511. SH3_2. IPR001452. SH3_domain. IPR003096. SM22_calponin. [Graphical view] | ||||||||||||
| Pfam | PF00130. C1_1. 1 hit. PF00307. CH. 1 hit. PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. PF00017. SH2. 1 hit. PF07653. SH3_2. 2 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00401. SH2DOMAIN. PR00452. SH3DOMAIN. PR00888. SM22CALPONIN. | ||||||||||||
| SMART | SM00109. C1. 1 hit. SM00033. CH. 1 hit. SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. SM00252. SH2. 1 hit. SM00326. SH3. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. SSF48065. DH-domain. 1 hit. SSF50044. SH3. 2 hits. | ||||||||||||
| PROSITE | PS50021. CH. 1 hit. PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50001. SH2. 1 hit. PS50002. SH3. 2 hits. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | VAV3. human. | ||||||||||||
| EvolutionaryTrace | Q9UKW4. | ||||||||||||
| GenomeRNAi | 10451. | ||||||||||||
| NextBio | 39617. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | VAV3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UKW4 Secondary accession number(s): B1AMM0 Q9Y5X8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
