Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone deacetylase 9

Gene

HDAC9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Represses MEF2-dependent transcription.
Isoform 3 lacks active site residues and therefore is catalytically inactive. Represses MEF2-dependent transcription by recruiting HDAC1 and/or HDAC3. Seems to inhibit skeletal myogenesis and to be involved in heart development. Protects neurons from apoptosis, both by inhibiting JUN phosphorylation by MAPK10 and by repressing JUN transcription via HDAC1 recruitment to JUN promoter.

Catalytic activityi

Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.

Enzyme regulationi

Inhibited by Trichostatin A (TSA) and suberoylanilide hydroxamic acid.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi646ZincBy similarity1
Metal bindingi648ZincBy similarity1
Metal bindingi654ZincBy similarity1
Metal bindingi731ZincBy similarity1
Active sitei783By similarity1

GO - Molecular functioni

  • histone deacetylase activity Source: BHF-UCL
  • histone deacetylase binding Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • NAD-dependent histone deacetylase activity (H3-K14 specific) Source: UniProtKB-EC
  • protein deacetylase activity Source: BHF-UCL
  • protein kinase C binding Source: UniProtKB
  • repressing transcription factor binding Source: BHF-UCL
  • transcription corepressor activity Source: BHF-UCL
  • transcription factor binding Source: UniProtKB

GO - Biological processi

  • B cell activation Source: UniProtKB
  • B cell differentiation Source: UniProtKB
  • cellular response to insulin stimulus Source: BHF-UCL
  • heart development Source: BHF-UCL
  • histone deacetylation Source: BHF-UCL
  • histone H3 deacetylation Source: BHF-UCL
  • histone H4 deacetylation Source: BHF-UCL
  • inflammatory response Source: UniProtKB
  • negative regulation of transcription, DNA-templated Source: BHF-UCL
  • negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • neuron differentiation Source: Ensembl
  • peptidyl-lysine deacetylation Source: BHF-UCL
  • positive regulation of cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • regulation of skeletal muscle fiber development Source: UniProtKB
  • regulation of striated muscle cell differentiation Source: UniProtKB
  • response to amphetamine Source: Ensembl
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Hydrolase, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS12110-MONOMER.
BRENDAi3.5.1.98. 2681.
ReactomeiR-HSA-2122947. NOTCH1 Intracellular Domain Regulates Transcription.
R-HSA-2644606. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
R-HSA-2894862. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
SIGNORiQ9UKV0.

Names & Taxonomyi

Protein namesi
Recommended name:
Histone deacetylase 9 (EC:3.5.1.98)
Short name:
HD9
Alternative name(s):
Histone deacetylase 7B
Short name:
HD7
Short name:
HD7b
Histone deacetylase-related protein
MEF2-interacting transcription repressor MITR
Gene namesi
Name:HDAC9
Synonyms:HDAC7, HDAC7B, HDRP, KIAA0744, MITR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:14065. HDAC9.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • histone deacetylase complex Source: UniProtKB
  • histone methyltransferase complex Source: UniProtKB
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
  • transcription factor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving HDAC9 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with TGFB2 resulting in lack of HDAC9 protein.

Organism-specific databases

DisGeNETi9734.
MalaCardsiHDAC9.
OpenTargetsiENSG00000048052.
Orphaneti708. Peters anomaly.
PharmGKBiPA38377.

Chemistry databases

ChEMBLiCHEMBL4145.
DrugBankiDB06603. Panobinostat.
DB00313. Valproic Acid.
GuidetoPHARMACOLOGYi2620.

Polymorphism and mutation databases

BioMutaiHDAC9.
DMDMi19865267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001147101 – 1011Histone deacetylase 9Add BLAST1011

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei22PhosphoserineCombined sources1
Modified residuei220PhosphoserineBy similarity1
Modified residuei240PhosphoserineBy similarity1
Modified residuei451PhosphoserineBy similarity1
Modified residuei554PhosphoserineBy similarity1
Isoform 6 (identifier: Q9UKV0-6)
Modified residuei966Phosphotyrosine ProbableCurated1
Isoform 5 (identifier: Q9UKV0-5)
Modified residuei1007PhosphotyrosineCurated1

Post-translational modificationi

Phosphorylated on Ser-220 and Ser-450; which promotes 14-3-3-binding, impairs interaction with MEF2, and antagonizes antimyogenic activity. Phosphorylated on Ser-240; which impairs nuclear accumulation (By similarity). Isoform 7 is phosphorylated on Tyr-1010. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.By similarity1 Publication
Sumoylated.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ9UKV0.
PeptideAtlasiQ9UKV0.
PRIDEiQ9UKV0.

PTM databases

iPTMnetiQ9UKV0.
PhosphoSitePlusiQ9UKV0.

Expressioni

Tissue specificityi

Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level).4 Publications

Gene expression databases

BgeeiENSG00000048052.
CleanExiHS_HDAC7.
HS_HDAC9.
ExpressionAtlasiQ9UKV0. baseline and differential.
GenevisibleiQ9UKV0. HS.

Organism-specific databases

HPAiHPA028926.

Interactioni

Subunit structurei

Homodimer. Interacts with CTBP1. The phosphorylated form interacts with 14-3-3 (By similarity). Interacts with HDAC1 and HDAC3, and probably with HDAC4 and HDAC5. Interacts with MEF2, MAPK10, ETV6, NCOR1 and BCL6. Interacts with FOXP3 in the absence of T-cell stimulation.By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BCL6P411822EBI-765444,EBI-765407
ETV6P412123EBI-765476,EBI-1372759
Ncor1Q609743EBI-1372717,EBI-349004From a different organism.

GO - Molecular functioni

  • histone deacetylase binding Source: BHF-UCL
  • protein kinase C binding Source: UniProtKB
  • repressing transcription factor binding Source: BHF-UCL
  • transcription factor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi115083. 58 interactors.
DIPiDIP-39904N.
IntActiQ9UKV0. 29 interactors.
MINTiMINT-205121.
STRINGi9606.ENSP00000408617.

Chemistry databases

BindingDBiQ9UKV0.

Structurei

3D structure databases

ProteinModelPortaliQ9UKV0.
SMRiQ9UKV0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni23 – 27Interaction with CTBP1By similarity5
Regioni136 – 154Interaction with MEF2By similarityAdd BLAST19
Regioni175 – 343Interaction with MAPK10By similarityAdd BLAST169
Regioni218 – 261Interaction with ETV61 PublicationAdd BLAST44
Regioni631 – 978Histone deacetylaseAdd BLAST348

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1343. Eukaryota.
COG0123. LUCA.
GeneTreeiENSGT00530000062809.
HOGENOMiHOG000232065.
HOVERGENiHBG057100.
InParanoidiQ9UKV0.
KOiK11409.
OMAiDSSQKFF.
OrthoDBiEOG091G0EQO.
PhylomeDBiQ9UKV0.
TreeFamiTF106174.

Family and domain databases

Gene3Di3.40.800.20. 1 hit.
InterProiIPR000286. His_deacetylse.
IPR023801. His_deacetylse_dom.
IPR024643. Hist_deacetylase_Gln_rich_N.
IPR017320. Histone_deAcase_II_euk.
[Graphical view]
PANTHERiPTHR10625. PTHR10625. 2 hits.
PfamiPF12203. HDAC4_Gln. 1 hit.
PF00850. Hist_deacetyl. 1 hit.
[Graphical view]
PIRSFiPIRSF037911. HDAC_II_euk. 1 hit.
PRINTSiPR01270. HDASUPER.

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9UKV0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHSMISSVDV KSEVPVGLEP ISPLDLRTDL RMMMPVVDPV VREKQLQQEL
60 70 80 90 100
LLIQQQQQIQ KQLLIAEFQK QHENLTRQHQ AQLQEHIKEL LAIKQQQELL
110 120 130 140 150
EKEQKLEQQR QEQEVERHRR EQQLPPLRGK DRGRERAVAS TEVKQKLQEF
160 170 180 190 200
LLSKSATKDT PTNGKNHSVS RHPKLWYTAA HHTSLDQSSP PLSGTSPSYK
210 220 230 240 250
YTLPGAQDAK DDFPLRKTAS EPNLKVRSRL KQKVAERRSS PLLRRKDGNV
260 270 280 290 300
VTSFKKRMFE VTESSVSSSS PGSGPSSPNN GPTGSVTENE TSVLPPTPHA
310 320 330 340 350
EQMVSQQRIL IHEDSMNLLS LYTSPSLPNI TLGLPAVPSQ LNASNSLKEK
360 370 380 390 400
QKCETQTLRQ GVPLPGQYGG SIPASSSHPH VTLEGKPPNS SHQALLQHLL
410 420 430 440 450
LKEQMRQQKL LVAGGVPLHP QSPLATKERI SPGIRGTHKL PRHRPLNRTQ
460 470 480 490 500
SAPLPQSTLA QLVIQQQHQQ FLEKQKQYQQ QIHMNKLLSK SIEQLKQPGS
510 520 530 540 550
HLEEAEEELQ GDQAMQEDRA PSSGNSTRSD SSACVDDTLG QVGAVKVKEE
560 570 580 590 600
PVDSDEDAQI QEMESGEQAA FMQQPFLEPT HTRALSVRQA PLAAVGMDGL
610 620 630 640 650
EKHRLVSRTH SSPAASVLPH PAMDRPLQPG SATGIAYDPL MLKHQCVCGN
660 670 680 690 700
STTHPEHAGR IQSIWSRLQE TGLLNKCERI QGRKASLEEI QLVHSEHHSL
710 720 730 740 750
LYGTNPLDGQ KLDPRILLGD DSQKFFSSLP CGGLGVDSDT IWNELHSSGA
760 770 780 790 800
ARMAVGCVIE LASKVASGEL KNGFAVVRPP GHHAEESTAM GFCFFNSVAI
810 820 830 840 850
TAKYLRDQLN ISKILIVDLD VHHGNGTQQA FYADPSILYI SLHRYDEGNF
860 870 880 890 900
FPGSGAPNEV GTGLGEGYNI NIAWTGGLDP PMGDVEYLEA FRTIVKPVAK
910 920 930 940 950
EFDPDMVLVS AGFDALEGHT PPLGGYKVTA KCFGHLTKQL MTLADGRVVL
960 970 980 990 1000
ALEGGHDLTA ICDASEACVN ALLGNELEPL AEDILHQSPN MNAVISLQKI
1010
IEIQSMSLKF S
Length:1,011
Mass (Da):111,297
Last modified:October 18, 2001 - v2
Checksum:i43ED2785E73CD924
GO
Isoform 2 (identifier: Q9UKV0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     487-574: Missing.

Show »
Length:923
Mass (Da):101,805
Checksum:i095F634F623A684F
GO
Isoform 3 (identifier: Q9UKV0-3) [UniParc]FASTAAdd to basket
Also known as: HDRP, MITR

The sequence of this isoform differs from the canonical sequence as follows:
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Note: Major form in most tissues. Inactive due to lack of active site residues.
Show »
Length:590
Mass (Da):65,887
Checksum:i02931057CF0E4C25
GO
Isoform 4 (identifier: Q9UKV0-4) [UniParc]FASTAAdd to basket
Also known as: HDAC9a

The sequence of this isoform differs from the canonical sequence as follows:
     861-879: GTGLGEGYNINIAWTGGLD → RFISLEPHFYLYLSGNCIA
     880-1011: Missing.

Show »
Length:879
Mass (Da):97,471
Checksum:iD3BFC3CE99E817DB
GO
Isoform 5 (identifier: Q9UKV0-5) [UniParc]FASTAAdd to basket
Also known as: HDAC9b, HDAC9fl

The sequence of this isoform differs from the canonical sequence as follows:
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Show »
Length:1,066
Mass (Da):117,208
Checksum:iEE7D908DF45D20CB
GO
Isoform 6 (identifier: Q9UKV0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: K → KLQQ
     218-261: Missing.
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Note: Excluded from the nucleus. Does not interact with ETV6.Curated
Show »
Length:1,025
Mass (Da):112,451
Checksum:i3BEFD662BF24E677
GO
Isoform 7 (identifier: Q9UKV0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: K → KLQQ
     1006-1011: MSLKFS → KYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL

Show »
Length:1,069
Mass (Da):117,577
Checksum:i5DFBB8DD4C6547C5
GO
Isoform 8 (identifier: Q9UKV0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMSSPAQPDLMWNLVPWVLFCGCCRIFPDGVAGREQLLAQQRM
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Note: No experimental confirmation available.
Show »
Length:588
Mass (Da):65,508
Checksum:iE58854328ED1B5BE
GO
Isoform 9 (identifier: Q9UKV0-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:546
Mass (Da):60,761
Checksum:iCFC8BA27CFD1AA31
GO
Isoform 10 (identifier: Q9UKV0-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.
     88-88: K → KLQQ
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:562
Mass (Da):62,852
Checksum:i6557FECB5FFF1A5A
GO
Isoform 11 (identifier: Q9UKV0-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.
     177-178: Missing.
     218-261: Missing.
     575-590: PFLEPTHTRALSVRQA → VIGKDLAPGFVIKVII
     591-1011: Missing.

Show »
Length:513
Mass (Da):57,092
Checksum:i3868A8C73426BCC2
GO

Sequence cautioni

Isoform 6 : The sequence AAI11736 differs from that shown. Reason: Frameshift at position 1021.Curated
The sequence BAA34464 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti16V → A in BAH12570 (PubMed:14702039).Curated1
Sequence conflicti99L → I in AAF04254 (PubMed:10523670).Curated1
Sequence conflicti153S → I in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti315S → F in BAH14176 (PubMed:14702039).Curated1
Sequence conflicti332L → M in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti416V → F in BAH14164 (PubMed:14702039).Curated1
Sequence conflicti437T → P in AAF04254 (PubMed:10523670).Curated1
Sequence conflicti644 – 647HQCV → KPNS in AAF04254 (PubMed:10523670).Curated4
Sequence conflicti746H → R in AAO27363 (PubMed:12590135).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064719921P → T Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0468271 – 31Missing in isoform 10 and isoform 11. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0434281M → MMSSPAQPDLMWNLVPWVLF CGCCRIFPDGVAGREQLLAQ QRM in isoform 8. 1 Publication1
Alternative sequenceiVSP_02376688K → KLQQ in isoform 6, isoform 7 and isoform 10. 3 Publications1
Alternative sequenceiVSP_046828177 – 178Missing in isoform 11. 1 Publication2
Alternative sequenceiVSP_023767218 – 261Missing in isoform 6, isoform 8, isoform 9 and isoform 11. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_002082487 – 574Missing in isoform 2. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_002083575 – 590PFLEP…SVRQA → VIGKDLAPGFVIKVII in isoform 3, isoform 8, isoform 9, isoform 10 and isoform 11. 3 PublicationsAdd BLAST16
Alternative sequenceiVSP_002084591 – 1011Missing in isoform 3, isoform 8, isoform 9, isoform 10 and isoform 11. 3 PublicationsAdd BLAST421
Alternative sequenceiVSP_002085861 – 879GTGLG…TGGLD → RFISLEPHFYLYLSGNCIA in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_002086880 – 1011Missing in isoform 4. 1 PublicationAdd BLAST132
Alternative sequenceiVSP_0237681006 – 1011MSLKFS → KYWKSVRMVAVPRGCALAGA QLQEETETVSALASLTVDVE QPFAQEDSRTAGEPMEEEPA L in isoform 5, isoform 6 and isoform 7. 3 Publications6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY032737 mRNA. Translation: AAK66821.1.
AY032738 mRNA. Translation: AAK66822.1.
AJ459808 mRNA. Translation: CAD30851.1.
AY197371 mRNA. Translation: AAO27363.1.
AB018287 mRNA. Translation: BAA34464.2. Different initiation.
AK297404 mRNA. Translation: BAH12570.1.
AK304298 mRNA. Translation: BAH14153.1.
AK304343 mRNA. Translation: BAH14164.1.
AK304410 mRNA. Translation: BAH14176.1.
AC002088 Genomic DNA. No translation available.
AC002124 Genomic DNA. No translation available.
AC002410 Genomic DNA. No translation available.
AC002433 Genomic DNA. No translation available.
AC004744 Genomic DNA. No translation available.
AC004994 Genomic DNA. No translation available.
AC005249 Genomic DNA. No translation available.
AC010082 Genomic DNA. No translation available.
AC074193 Genomic DNA. No translation available.
AC091697 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW93702.1.
CH471073 Genomic DNA. Translation: EAW93703.1.
BC111735 mRNA. Translation: AAI11736.1. Frameshift.
BC150328 mRNA. Translation: AAI50329.1.
BC152405 mRNA. Translation: AAI52406.1.
AF124924 mRNA. Translation: AAF04254.1.
CCDSiCCDS47553.1. [Q9UKV0-7]
CCDS47554.1. [Q9UKV0-5]
CCDS47555.1. [Q9UKV0-1]
CCDS47557.1. [Q9UKV0-3]
CCDS56465.1. [Q9UKV0-8]
CCDS56466.1. [Q9UKV0-9]
CCDS56467.1. [Q9UKV0-10]
CCDS56468.1. [Q9UKV0-11]
CCDS83163.1. [Q9UKV0-6]
RefSeqiNP_001191073.1. NM_001204144.2. [Q9UKV0-8]
NP_001191074.1. NM_001204145.2. [Q9UKV0-9]
NP_001191075.1. NM_001204146.2.
NP_001191076.1. NM_001204147.2. [Q9UKV0-11]
NP_001191077.1. NM_001204148.2. [Q9UKV0-10]
NP_001308797.1. NM_001321868.1.
NP_001308798.1. NM_001321869.1.
NP_001308799.1. NM_001321870.1.
NP_001308800.1. NM_001321871.1.
NP_001308801.1. NM_001321872.1.
NP_001308802.1. NM_001321873.1.
NP_001308803.1. NM_001321874.1.
NP_001308804.1. NM_001321875.1.
NP_001308805.1. NM_001321876.1.
NP_001308806.1. NM_001321877.1. [Q9UKV0-6]
NP_001308807.1. NM_001321878.1.
NP_001308808.1. NM_001321879.1.
NP_001308813.1. NM_001321884.1.
NP_001308814.1. NM_001321885.1.
NP_001308815.1. NM_001321886.1.
NP_001308816.1. NM_001321887.1.
NP_001308817.1. NM_001321888.1.
NP_001308818.1. NM_001321889.1.
NP_001308819.1. NM_001321890.1.
NP_001308820.1. NM_001321891.1. [Q9UKV0-9]
NP_001308822.1. NM_001321893.1. [Q9UKV0-9]
NP_001308823.1. NM_001321894.1.
NP_001308824.1. NM_001321895.1.
NP_001308825.1. NM_001321896.1. [Q9UKV0-10]
NP_001308826.1. NM_001321897.1. [Q9UKV0-6]
NP_001308827.1. NM_001321898.1.
NP_001308828.1. NM_001321899.1.
NP_001308829.1. NM_001321900.1. [Q9UKV0-3]
NP_001308830.1. NM_001321901.1.
NP_001308831.1. NM_001321902.1.
NP_055522.1. NM_014707.3. [Q9UKV0-3]
NP_478056.1. NM_058176.2. [Q9UKV0-1]
NP_848510.1. NM_178423.2. [Q9UKV0-5]
NP_848512.1. NM_178425.3. [Q9UKV0-7]
XP_011513940.1. XM_011515638.2. [Q9UKV0-7]
XP_011513941.1. XM_011515639.2. [Q9UKV0-7]
XP_016868315.1. XM_017012826.1. [Q9UKV0-5]
XP_016868317.1. XM_017012828.1. [Q9UKV0-6]
UniGeneiHs.196054.
Hs.444785.

Genome annotation databases

EnsembliENST00000401921; ENSP00000383912; ENSG00000048052. [Q9UKV0-6]
ENST00000405010; ENSP00000384382; ENSG00000048052. [Q9UKV0-3]
ENST00000406451; ENSP00000384657; ENSG00000048052. [Q9UKV0-5]
ENST00000417496; ENSP00000401669; ENSG00000048052. [Q9UKV0-8]
ENST00000428307; ENSP00000395655; ENSG00000048052. [Q9UKV0-9]
ENST00000432645; ENSP00000410337; ENSG00000048052. [Q9UKV0-1]
ENST00000441542; ENSP00000408617; ENSG00000048052. [Q9UKV0-7]
ENST00000456174; ENSP00000388568; ENSG00000048052. [Q9UKV0-10]
ENST00000524023; ENSP00000430036; ENSG00000048052. [Q9UKV0-11]
GeneIDi9734.
KEGGihsa:9734.
UCSCiuc003sud.2. human. [Q9UKV0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY032737 mRNA. Translation: AAK66821.1.
AY032738 mRNA. Translation: AAK66822.1.
AJ459808 mRNA. Translation: CAD30851.1.
AY197371 mRNA. Translation: AAO27363.1.
AB018287 mRNA. Translation: BAA34464.2. Different initiation.
AK297404 mRNA. Translation: BAH12570.1.
AK304298 mRNA. Translation: BAH14153.1.
AK304343 mRNA. Translation: BAH14164.1.
AK304410 mRNA. Translation: BAH14176.1.
AC002088 Genomic DNA. No translation available.
AC002124 Genomic DNA. No translation available.
AC002410 Genomic DNA. No translation available.
AC002433 Genomic DNA. No translation available.
AC004744 Genomic DNA. No translation available.
AC004994 Genomic DNA. No translation available.
AC005249 Genomic DNA. No translation available.
AC010082 Genomic DNA. No translation available.
AC074193 Genomic DNA. No translation available.
AC091697 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW93702.1.
CH471073 Genomic DNA. Translation: EAW93703.1.
BC111735 mRNA. Translation: AAI11736.1. Frameshift.
BC150328 mRNA. Translation: AAI50329.1.
BC152405 mRNA. Translation: AAI52406.1.
AF124924 mRNA. Translation: AAF04254.1.
CCDSiCCDS47553.1. [Q9UKV0-7]
CCDS47554.1. [Q9UKV0-5]
CCDS47555.1. [Q9UKV0-1]
CCDS47557.1. [Q9UKV0-3]
CCDS56465.1. [Q9UKV0-8]
CCDS56466.1. [Q9UKV0-9]
CCDS56467.1. [Q9UKV0-10]
CCDS56468.1. [Q9UKV0-11]
CCDS83163.1. [Q9UKV0-6]
RefSeqiNP_001191073.1. NM_001204144.2. [Q9UKV0-8]
NP_001191074.1. NM_001204145.2. [Q9UKV0-9]
NP_001191075.1. NM_001204146.2.
NP_001191076.1. NM_001204147.2. [Q9UKV0-11]
NP_001191077.1. NM_001204148.2. [Q9UKV0-10]
NP_001308797.1. NM_001321868.1.
NP_001308798.1. NM_001321869.1.
NP_001308799.1. NM_001321870.1.
NP_001308800.1. NM_001321871.1.
NP_001308801.1. NM_001321872.1.
NP_001308802.1. NM_001321873.1.
NP_001308803.1. NM_001321874.1.
NP_001308804.1. NM_001321875.1.
NP_001308805.1. NM_001321876.1.
NP_001308806.1. NM_001321877.1. [Q9UKV0-6]
NP_001308807.1. NM_001321878.1.
NP_001308808.1. NM_001321879.1.
NP_001308813.1. NM_001321884.1.
NP_001308814.1. NM_001321885.1.
NP_001308815.1. NM_001321886.1.
NP_001308816.1. NM_001321887.1.
NP_001308817.1. NM_001321888.1.
NP_001308818.1. NM_001321889.1.
NP_001308819.1. NM_001321890.1.
NP_001308820.1. NM_001321891.1. [Q9UKV0-9]
NP_001308822.1. NM_001321893.1. [Q9UKV0-9]
NP_001308823.1. NM_001321894.1.
NP_001308824.1. NM_001321895.1.
NP_001308825.1. NM_001321896.1. [Q9UKV0-10]
NP_001308826.1. NM_001321897.1. [Q9UKV0-6]
NP_001308827.1. NM_001321898.1.
NP_001308828.1. NM_001321899.1.
NP_001308829.1. NM_001321900.1. [Q9UKV0-3]
NP_001308830.1. NM_001321901.1.
NP_001308831.1. NM_001321902.1.
NP_055522.1. NM_014707.3. [Q9UKV0-3]
NP_478056.1. NM_058176.2. [Q9UKV0-1]
NP_848510.1. NM_178423.2. [Q9UKV0-5]
NP_848512.1. NM_178425.3. [Q9UKV0-7]
XP_011513940.1. XM_011515638.2. [Q9UKV0-7]
XP_011513941.1. XM_011515639.2. [Q9UKV0-7]
XP_016868315.1. XM_017012826.1. [Q9UKV0-5]
XP_016868317.1. XM_017012828.1. [Q9UKV0-6]
UniGeneiHs.196054.
Hs.444785.

3D structure databases

ProteinModelPortaliQ9UKV0.
SMRiQ9UKV0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115083. 58 interactors.
DIPiDIP-39904N.
IntActiQ9UKV0. 29 interactors.
MINTiMINT-205121.
STRINGi9606.ENSP00000408617.

Chemistry databases

BindingDBiQ9UKV0.
ChEMBLiCHEMBL4145.
DrugBankiDB06603. Panobinostat.
DB00313. Valproic Acid.
GuidetoPHARMACOLOGYi2620.

PTM databases

iPTMnetiQ9UKV0.
PhosphoSitePlusiQ9UKV0.

Polymorphism and mutation databases

BioMutaiHDAC9.
DMDMi19865267.

Proteomic databases

PaxDbiQ9UKV0.
PeptideAtlasiQ9UKV0.
PRIDEiQ9UKV0.

Protocols and materials databases

DNASUi9734.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000401921; ENSP00000383912; ENSG00000048052. [Q9UKV0-6]
ENST00000405010; ENSP00000384382; ENSG00000048052. [Q9UKV0-3]
ENST00000406451; ENSP00000384657; ENSG00000048052. [Q9UKV0-5]
ENST00000417496; ENSP00000401669; ENSG00000048052. [Q9UKV0-8]
ENST00000428307; ENSP00000395655; ENSG00000048052. [Q9UKV0-9]
ENST00000432645; ENSP00000410337; ENSG00000048052. [Q9UKV0-1]
ENST00000441542; ENSP00000408617; ENSG00000048052. [Q9UKV0-7]
ENST00000456174; ENSP00000388568; ENSG00000048052. [Q9UKV0-10]
ENST00000524023; ENSP00000430036; ENSG00000048052. [Q9UKV0-11]
GeneIDi9734.
KEGGihsa:9734.
UCSCiuc003sud.2. human. [Q9UKV0-1]

Organism-specific databases

CTDi9734.
DisGeNETi9734.
GeneCardsiHDAC9.
HGNCiHGNC:14065. HDAC9.
HPAiHPA028926.
MalaCardsiHDAC9.
MIMi606543. gene.
neXtProtiNX_Q9UKV0.
OpenTargetsiENSG00000048052.
Orphaneti708. Peters anomaly.
PharmGKBiPA38377.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1343. Eukaryota.
COG0123. LUCA.
GeneTreeiENSGT00530000062809.
HOGENOMiHOG000232065.
HOVERGENiHBG057100.
InParanoidiQ9UKV0.
KOiK11409.
OMAiDSSQKFF.
OrthoDBiEOG091G0EQO.
PhylomeDBiQ9UKV0.
TreeFamiTF106174.

Enzyme and pathway databases

BioCyciZFISH:HS12110-MONOMER.
BRENDAi3.5.1.98. 2681.
ReactomeiR-HSA-2122947. NOTCH1 Intracellular Domain Regulates Transcription.
R-HSA-2644606. Constitutive Signaling by NOTCH1 PEST Domain Mutants.
R-HSA-2894862. Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
SIGNORiQ9UKV0.

Miscellaneous databases

ChiTaRSiHDAC9. human.
GeneWikiiHDAC9.
GenomeRNAii9734.
PROiQ9UKV0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000048052.
CleanExiHS_HDAC7.
HS_HDAC9.
ExpressionAtlasiQ9UKV0. baseline and differential.
GenevisibleiQ9UKV0. HS.

Family and domain databases

Gene3Di3.40.800.20. 1 hit.
InterProiIPR000286. His_deacetylse.
IPR023801. His_deacetylse_dom.
IPR024643. Hist_deacetylase_Gln_rich_N.
IPR017320. Histone_deAcase_II_euk.
[Graphical view]
PANTHERiPTHR10625. PTHR10625. 2 hits.
PfamiPF12203. HDAC4_Gln. 1 hit.
PF00850. Hist_deacetyl. 1 hit.
[Graphical view]
PIRSFiPIRSF037911. HDAC_II_euk. 1 hit.
PRINTSiPR01270. HDASUPER.
ProtoNetiSearch...

Entry informationi

Entry nameiHDAC9_HUMAN
AccessioniPrimary (citable) accession number: Q9UKV0
Secondary accession number(s): A7E2F3
, B7Z4I4, B7Z917, B7Z928, B7Z940, C9JS87, E7EX34, F8W9E0, O94845, O95028, Q2M2R6, Q86SL1, Q86US3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 18, 2001
Last modified: November 2, 2016
This is version 168 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.