Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UKU0

- ACSL6_HUMAN

UniProt

Q9UKU0 - ACSL6_HUMAN

Protein

Long-chain-fatty-acid--CoA ligase 6

Gene

ACSL6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 4 (06 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.

    Catalytic activityi

    ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA.

    Cofactori

    Magnesium.

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. enzyme binding Source: UniProtKB
    3. long-chain fatty acid-CoA ligase activity Source: UniProtKB
    4. protein homodimerization activity Source: UniProtKB

    GO - Biological processi

    1. acyl-CoA metabolic process Source: UniProtKB
    2. cellular lipid metabolic process Source: Reactome
    3. cellular response to insulin stimulus Source: Ensembl
    4. fatty acid transport Source: Ensembl
    5. long-chain fatty acid metabolic process Source: UniProtKB
    6. long-chain fatty-acyl-CoA biosynthetic process Source: Reactome
    7. neuroblast proliferation Source: Ensembl
    8. neuron development Source: Ensembl
    9. phospholipid biosynthetic process Source: Ensembl
    10. positive regulation of neuron projection development Source: Ensembl
    11. positive regulation of plasma membrane long-chain fatty acid transport Source: Ensembl
    12. positive regulation of triglyceride biosynthetic process Source: Ensembl
    13. response to gravity Source: Ensembl
    14. response to hypoxia Source: Ensembl
    15. response to nutrient Source: Ensembl
    16. response to steroid hormone Source: Ensembl
    17. small molecule metabolic process Source: Reactome
    18. triglyceride biosynthetic process Source: Reactome

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Fatty acid metabolism, Lipid metabolism

    Keywords - Ligandi

    ATP-binding, Magnesium, Nucleotide-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS15193-MONOMER.
    BRENDAi6.2.1.3. 2681.
    ReactomeiREACT_380. Synthesis of very long-chain fatty acyl-CoAs.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Long-chain-fatty-acid--CoA ligase 6 (EC:6.2.1.3)
    Alternative name(s):
    Long-chain acyl-CoA synthetase 6
    Short name:
    LACS 6
    Gene namesi
    Name:ACSL6
    Synonyms:ACS2, FACL6, KIAA0837, LACS5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:16496. ACSL6.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW
    3. membrane Source: UniProtKB
    4. mitochondrial outer membrane Source: UniProtKB-SubCell
    5. nucleus Source: Ensembl
    6. peroxisomal membrane Source: UniProtKB-SubCell
    7. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome, Mitochondrion, Mitochondrion outer membrane, Peroxisome

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving ACSL6 may be a cause of myelodysplastic syndrome with basophilia. Translocation t(5;12)(q31;p13) with ETV6.
    A chromosomal aberration involving ACSL6 may be a cause of acute myelogenous leukemia with eosinophilia. Translocation t(5;12)(q31;p13) with ETV6.
    A chromosomal aberration involving ACSL6 may be a cause of acute eosinophilic leukemia (AEL). Translocation t(5;12)(q31;p13) with ETV6.

    Organism-specific databases

    PharmGKBiPA27970.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 697697Long-chain-fatty-acid--CoA ligase 6PRO_0000193115Add
    BLAST

    Proteomic databases

    MaxQBiQ9UKU0.
    PaxDbiQ9UKU0.
    PRIDEiQ9UKU0.

    PTM databases

    PhosphoSiteiQ9UKU0.

    Expressioni

    Tissue specificityi

    Expressed predominantly in erythrocyte precursors, in particular in reticulocytes, fetal blood cells derived from fetal liver, hemopoietic stem cells from cord blood, bone marrow and brain.1 Publication

    Developmental stagei

    Expression is low at earlier stages of erythroid development but is very high in reticulocytes.

    Gene expression databases

    ArrayExpressiQ9UKU0.
    BgeeiQ9UKU0.
    CleanExiHS_ACSL6.
    GenevestigatoriQ9UKU0.

    Organism-specific databases

    HPAiHPA040470.

    Interactioni

    Protein-protein interaction databases

    BioGridi116897. 1 interaction.
    IntActiQ9UKU0. 1 interaction.
    STRINGi9606.ENSP00000296869.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UKU0.
    SMRiQ9UKU0. Positions 222-605.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini46 – 697652CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei25 – 4521Helical; Signal-anchor for type III membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1022.
    HOGENOMiHOG000159459.
    HOVERGENiHBG050452.
    KOiK01897.
    OMAiMFERMVQ.
    OrthoDBiEOG71CFKN.
    PhylomeDBiQ9UKU0.
    TreeFamiTF313877.

    Family and domain databases

    InterProiIPR020845. AMP-binding_CS.
    IPR000873. AMP-dep_Synth/Lig.
    [Graphical view]
    PfamiPF00501. AMP-binding. 1 hit.
    [Graphical view]
    PROSITEiPS00455. AMP_BINDING. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 4 (identifier: Q9UKU0-4) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQTQEILRIL RLPELGDLGQ FFRSLSATTL VSMGALAAIL AYWFTHRPKA    50
    LQPPCNLLMQ SEEVEDSGGA RRSVIGSGPQ LLTHYYDDAR TMYQVFRRGL 100
    SISGNGPCLG FRKPKQPYQW LSYQEVADRA EFLGSGLLQH NCKACTDQFI 150
    GVFAQNRPEW IIVELACYTY SMVVVPLYDT LGPGAIRYII NTADISTVIV 200
    DKPQKAVLLL EHVERKETPG LKLIILMDPF EEALKERGQK CGVVIKSMQA 250
    VEDCGQENHQ APVPPQPDDL SIVCFTSGTT GNPKGAMLTH GNVVADFSGF 300
    LKVTEKVIFP RQDDVLISFL PLAHMFERVI QSVVYCHGGR VGFFQGDIRL 350
    LSDDMKALCP TIFPVVPRLL NRMYDKIFSQ ANTPLKRWLL EFAAKRKQAE 400
    VRSGIIRNDS IWDELFFNKI QASLGGCVRM IVTGAAPASP TVLGFLRAAL 450
    GCQVYEGYGQ TECTAGCTFT TPGDWTSGHV GAPLPCNHIK LVDVEELNYW 500
    ACKGEGEICV RGPNVFKGYL KDPDRTKEAL DSDGWLHTGD IGKWLPAGTL 550
    KIIDRKKHIF KLAQGEYVAP EKIENIYIRS QPVAQIYVHG DSLKAFLVGI 600
    VVPDPEVMPS WAQKRGIEGT YADLCTNKDL KKAILEDMVR LGKESGLHSF 650
    EQVKAIHIHS DMFSVQNGLL TPTLKAKRPE LREYFKKQIE ELYSISM 697
    Length:697
    Mass (Da):77,752
    Last modified:March 6, 2007 - v4
    Checksum:iAC566177B47D0975
    GO
    Isoform 1 (identifier: Q9UKU0-1) [UniParc]FASTAAdd to Basket

    Also known as: Long, v2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLTFFLVSGGSLWLFVEFVLSLLEKM

    Show »
    Length:722
    Mass (Da):80,610
    Checksum:i2B7D408F2F77C1FB
    GO
    Isoform 2 (identifier: Q9UKU0-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV
         653-697: VKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM → DLPQCLIQIKVFSKY

    Note: No experimental confirmation available.

    Show »
    Length:667
    Mass (Da):74,175
    Checksum:iE57CDD86836E7D64
    GO
    Isoform 3 (identifier: Q9UKU0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV

    Note: No experimental confirmation available.

    Show »
    Length:697
    Mass (Da):77,671
    Checksum:iF70642502C212FA7
    GO
    Isoform 5 (identifier: Q9UKU0-5) [UniParc]FASTAAdd to Basket

    Also known as: v4

    The sequence of this isoform differs from the canonical sequence as follows:
         306-312: Missing.

    Show »
    Length:690
    Mass (Da):76,883
    Checksum:i3D96A1B1433CF6F9
    GO
    Isoform 6 (identifier: Q9UKU0-6) [UniParc]FASTAAdd to Basket

    Also known as: v5

    The sequence of this isoform differs from the canonical sequence as follows:
         192-192: T → TGLSCQEGASATASTQ

    Show »
    Length:712
    Mass (Da):79,144
    Checksum:i1BC1636243762146
    GO
    Isoform 7 (identifier: Q9UKU0-7) [UniParc]FASTAAdd to Basket

    Also known as: v3

    The sequence of this isoform differs from the canonical sequence as follows:
         31-65: Missing.
         306-345: Missing.

    Show »
    Length:622
    Mass (Da):69,222
    Checksum:iE5BE0D13E92599ED
    GO
    Isoform 8 (identifier: Q9UKU0-8) [UniParc]FASTAAdd to Basket

    Also known as: v1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLTFFLVSGGSLWLFVEFVLSLLEKM
         306-330: KVIFPRQDDVLISFLPLAHMFERVI → SQWAPTCADVHISYLPLAHMFERMV

    Note: No experimental confirmation available.

    Show »
    Length:722
    Mass (Da):80,529
    Checksum:i702D63A8B72BE729
    GO
    Isoform 9 (identifier: Q9UKU0-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPEFVLSLLEKM

    Note: No experimental confirmation available.

    Show »
    Length:708
    Mass (Da):79,040
    Checksum:iDD0FE6A5EDA476D0
    GO

    Sequence cautioni

    The sequence BAA74860.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAH26161.1 differs from that shown. Reason: Erroneous termination at position 72. Translated as Arg.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti19 – 191G → E in AAD47199. (PubMed:10548543)Curated
    Sequence conflicti46 – 461H → Q in AAD47199. (PubMed:10548543)Curated
    Sequence conflicti257 – 2571E → A in AAH47453. (PubMed:15489334)Curated
    Sequence conflicti260 – 2601Q → L in AAH26161. (PubMed:15489334)Curated
    Sequence conflicti356 – 3561K → R in AAZ30714. (PubMed:16834775)Curated
    Sequence conflicti696 – 6961S → P in AAD47199. (PubMed:10548543)Curated
    Sequence conflicti696 – 6961S → P in AAZ30714. (PubMed:16834775)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLTFFLVSGGSLWLFVEFVL SLLEKM in isoform 1 and isoform 8. 1 PublicationVSP_037819
    Alternative sequencei1 – 11M → MPEFVLSLLEKM in isoform 9. 1 PublicationVSP_046954
    Alternative sequencei31 – 6535Missing in isoform 7. 1 PublicationVSP_037820Add
    BLAST
    Alternative sequencei192 – 1921T → TGLSCQEGASATASTQ in isoform 6. 1 PublicationVSP_037821
    Alternative sequencei306 – 34540Missing in isoform 7. 1 PublicationVSP_037822Add
    BLAST
    Alternative sequencei306 – 33025KVIFP…FERVI → SQWAPTCADVHISYLPLAHM FERMV in isoform 3, isoform 2 and isoform 8. 2 PublicationsVSP_021024Add
    BLAST
    Alternative sequencei306 – 3127Missing in isoform 5. 1 PublicationVSP_037823
    Alternative sequencei653 – 69745VKAIH…YSISM → DLPQCLIQIKVFSKY in isoform 2. 1 PublicationVSP_000241Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF129166 mRNA. Translation: AAD47199.1.
    AF099740 mRNA. Translation: AAD17853.1.
    DQ083030 mRNA. Translation: AAZ30713.1.
    DQ083031 mRNA. Translation: AAZ30714.1.
    AB020644 mRNA. Translation: BAA74860.1. Different initiation.
    CR606980 mRNA. No translation available.
    AC025772 Genomic DNA. No translation available.
    AC026398 Genomic DNA. No translation available.
    AC034228 Genomic DNA. No translation available.
    BC026161 mRNA. Translation: AAH26161.1. Sequence problems.
    BC047453 mRNA. Translation: AAH47453.1.
    CCDSiCCDS34228.1. [Q9UKU0-8]
    CCDS34229.1. [Q9UKU0-1]
    CCDS56381.1. [Q9UKU0-3]
    CCDS56382.1. [Q9UKU0-7]
    CCDS56383.1. [Q9UKU0-9]
    RefSeqiNP_001009185.1. NM_001009185.2. [Q9UKU0-1]
    NP_001192176.1. NM_001205247.1.
    NP_001192177.1. NM_001205248.1. [Q9UKU0-3]
    NP_001192179.1. NM_001205250.1. [Q9UKU0-9]
    NP_001192180.1. NM_001205251.1. [Q9UKU0-7]
    NP_056071.2. NM_015256.3. [Q9UKU0-8]
    XP_006714642.1. XM_006714579.1. [Q9UKU0-4]
    XP_006714643.1. XM_006714580.1. [Q9UKU0-4]
    UniGeneiHs.14945.

    Genome annotation databases

    EnsembliENST00000296869; ENSP00000296869; ENSG00000164398. [Q9UKU0-8]
    ENST00000357096; ENSP00000349608; ENSG00000164398. [Q9UKU0-7]
    ENST00000379240; ENSP00000368542; ENSG00000164398. [Q9UKU0-4]
    ENST00000379244; ENSP00000368546; ENSG00000164398. [Q9UKU0-3]
    ENST00000379246; ENSP00000368548; ENSG00000164398. [Q9UKU0-9]
    ENST00000379255; ENSP00000368557; ENSG00000164398. [Q9UKU0-7]
    ENST00000379264; ENSP00000368566; ENSG00000164398. [Q9UKU0-1]
    ENST00000413683; ENSP00000415140; ENSG00000164398. [Q9UKU0-2]
    ENST00000543479; ENSP00000442124; ENSG00000164398. [Q9UKU0-3]
    GeneIDi23305.
    KEGGihsa:23305.
    UCSCiuc003kvx.2. human. [Q9UKU0-8]
    uc003kvy.2. human. [Q9UKU0-1]
    uc003kvz.2. human. [Q9UKU0-7]
    uc010jdn.2. human. [Q9UKU0-6]
    uc010jdo.2. human. [Q9UKU0-3]

    Polymorphism databases

    DMDMi146322303.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF129166 mRNA. Translation: AAD47199.1 .
    AF099740 mRNA. Translation: AAD17853.1 .
    DQ083030 mRNA. Translation: AAZ30713.1 .
    DQ083031 mRNA. Translation: AAZ30714.1 .
    AB020644 mRNA. Translation: BAA74860.1 . Different initiation.
    CR606980 mRNA. No translation available.
    AC025772 Genomic DNA. No translation available.
    AC026398 Genomic DNA. No translation available.
    AC034228 Genomic DNA. No translation available.
    BC026161 mRNA. Translation: AAH26161.1 . Sequence problems.
    BC047453 mRNA. Translation: AAH47453.1 .
    CCDSi CCDS34228.1. [Q9UKU0-8 ]
    CCDS34229.1. [Q9UKU0-1 ]
    CCDS56381.1. [Q9UKU0-3 ]
    CCDS56382.1. [Q9UKU0-7 ]
    CCDS56383.1. [Q9UKU0-9 ]
    RefSeqi NP_001009185.1. NM_001009185.2. [Q9UKU0-1 ]
    NP_001192176.1. NM_001205247.1.
    NP_001192177.1. NM_001205248.1. [Q9UKU0-3 ]
    NP_001192179.1. NM_001205250.1. [Q9UKU0-9 ]
    NP_001192180.1. NM_001205251.1. [Q9UKU0-7 ]
    NP_056071.2. NM_015256.3. [Q9UKU0-8 ]
    XP_006714642.1. XM_006714579.1. [Q9UKU0-4 ]
    XP_006714643.1. XM_006714580.1. [Q9UKU0-4 ]
    UniGenei Hs.14945.

    3D structure databases

    ProteinModelPortali Q9UKU0.
    SMRi Q9UKU0. Positions 222-605.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116897. 1 interaction.
    IntActi Q9UKU0. 1 interaction.
    STRINGi 9606.ENSP00000296869.

    PTM databases

    PhosphoSitei Q9UKU0.

    Polymorphism databases

    DMDMi 146322303.

    Proteomic databases

    MaxQBi Q9UKU0.
    PaxDbi Q9UKU0.
    PRIDEi Q9UKU0.

    Protocols and materials databases

    DNASUi 23305.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000296869 ; ENSP00000296869 ; ENSG00000164398 . [Q9UKU0-8 ]
    ENST00000357096 ; ENSP00000349608 ; ENSG00000164398 . [Q9UKU0-7 ]
    ENST00000379240 ; ENSP00000368542 ; ENSG00000164398 . [Q9UKU0-4 ]
    ENST00000379244 ; ENSP00000368546 ; ENSG00000164398 . [Q9UKU0-3 ]
    ENST00000379246 ; ENSP00000368548 ; ENSG00000164398 . [Q9UKU0-9 ]
    ENST00000379255 ; ENSP00000368557 ; ENSG00000164398 . [Q9UKU0-7 ]
    ENST00000379264 ; ENSP00000368566 ; ENSG00000164398 . [Q9UKU0-1 ]
    ENST00000413683 ; ENSP00000415140 ; ENSG00000164398 . [Q9UKU0-2 ]
    ENST00000543479 ; ENSP00000442124 ; ENSG00000164398 . [Q9UKU0-3 ]
    GeneIDi 23305.
    KEGGi hsa:23305.
    UCSCi uc003kvx.2. human. [Q9UKU0-8 ]
    uc003kvy.2. human. [Q9UKU0-1 ]
    uc003kvz.2. human. [Q9UKU0-7 ]
    uc010jdn.2. human. [Q9UKU0-6 ]
    uc010jdo.2. human. [Q9UKU0-3 ]

    Organism-specific databases

    CTDi 23305.
    GeneCardsi GC05M131147.
    HGNCi HGNC:16496. ACSL6.
    HPAi HPA040470.
    MIMi 604443. gene.
    neXtProti NX_Q9UKU0.
    PharmGKBi PA27970.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1022.
    HOGENOMi HOG000159459.
    HOVERGENi HBG050452.
    KOi K01897.
    OMAi MFERMVQ.
    OrthoDBi EOG71CFKN.
    PhylomeDBi Q9UKU0.
    TreeFami TF313877.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS15193-MONOMER.
    BRENDAi 6.2.1.3. 2681.
    Reactomei REACT_380. Synthesis of very long-chain fatty acyl-CoAs.

    Miscellaneous databases

    GeneWikii ACSL6.
    GenomeRNAii 23305.
    NextBioi 13615790.
    PROi Q9UKU0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UKU0.
    Bgeei Q9UKU0.
    CleanExi HS_ACSL6.
    Genevestigatori Q9UKU0.

    Family and domain databases

    InterProi IPR020845. AMP-binding_CS.
    IPR000873. AMP-dep_Synth/Lig.
    [Graphical view ]
    Pfami PF00501. AMP-binding. 1 hit.
    [Graphical view ]
    PROSITEi PS00455. AMP_BINDING. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and molecular characterization of acyl-CoA synthetase in human red cells and erythroid precursor."
      Malhotra K.T., Malhotra K., Lubin B.H., Kuypers F.A.
      Biochem. J. 344:135-143(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    2. "Fusion of TEL/ETV6 to a novel ACS2 in myelodysplastic syndrome and acute myelogenous leukemia with t(5;12)(q31;p13)."
      Yagasaki F., Jinnai I., Yoshida S., Yokoyama Y., Matsuda A., Kusumoto S., Kobayashi H., Terasaki H., Ohyashiki K., Asou N., Murohashi I., Bessho M., Hirashima K.
      Genes Chromosomes Cancer 26:192-202(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHROMOSOMAL TRANSLOCATION WITH ETV6.
      Tissue: Bone marrow.
    3. "Multiple erythroid isoforms of human long-chain acyl-CoA synthetases are produced by switch of the fatty acid gate domains."
      Soupene E., Kuypers F.A.
      BMC Mol. Biol. 7:21-21(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] OF 253-374 (ISOFORM 5), ALTERNATIVE SPLICING (ISOFORM 8).
    4. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "Full-length cDNA libraries and normalization."
      Li W.B., Gruber C., Jessee J., Polayes D.
      Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    6. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 8).
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 9).
      Tissue: Testis.

    Entry informationi

    Entry nameiACSL6_HUMAN
    AccessioniPrimary (citable) accession number: Q9UKU0
    Secondary accession number(s): J3KPG3
    , O94924, O95829, Q108M9, Q108N0, Q4G191, Q86TN7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 27, 2001
    Last sequence update: March 6, 2007
    Last modified: October 1, 2014
    This is version 137 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3