SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UKP5

- ATS6_HUMAN

UniProt

Q9UKP5 - ATS6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
A disintegrin and metalloproteinase with thrombospondin motifs 6
Gene
ADAMTS6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi403 – 4031Zinc; catalytic By similarity
Active sitei404 – 4041 By similarity
Metal bindingi407 – 4071Zinc; catalytic By similarity
Metal bindingi413 – 4131Zinc; catalytic By similarity

GO - Molecular functioni

  1. metalloendopeptidase activity Source: InterPro
  2. metallopeptidase activity Source: ProtInc
  3. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_200626. O-glycosylation of TSR domain-containing proteins.

Protein family/group databases

MEROPSiM12.230.

Names & Taxonomyi

Protein namesi
Recommended name:
A disintegrin and metalloproteinase with thrombospondin motifs 6 (EC:3.4.24.-)
Short name:
ADAM-TS 6
Short name:
ADAM-TS6
Short name:
ADAMTS-6
Gene namesi
Name:ADAMTS6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:222. ADAMTS6.

Subcellular locationi

GO - Cellular componenti

  1. proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24550.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121 Reviewed prediction
Add
BLAST
Propeptidei22 – 244223 By similarity
PRO_0000029174Add
BLAST
Chaini245 – 1117873A disintegrin and metalloproteinase with thrombospondin motifs 6
PRO_0000029175Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi99 – 991N-linked (GlcNAc...) Reviewed prediction
Glycosylationi172 – 1721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi222 – 2221N-linked (GlcNAc...) Reviewed prediction
Glycosylationi234 – 2341N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi326 ↔ 387 By similarity
Disulfide bondi362 ↔ 369 By similarity
Disulfide bondi381 ↔ 463 By similarity
Disulfide bondi420 ↔ 447 By similarity
Disulfide bondi490 ↔ 512 By similarity
Disulfide bondi501 ↔ 519 By similarity
Disulfide bondi507 ↔ 542 By similarity
Disulfide bondi532 ↔ 547 By similarity
Disulfide bondi570 ↔ 607 By similarity
Disulfide bondi574 ↔ 612 By similarity
Disulfide bondi585 ↔ 597 By similarity
Glycosylationi724 – 7241N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi911 ↔ 954 By similarity
Disulfide bondi915 ↔ 959 By similarity
Disulfide bondi926 ↔ 943 By similarity
Glycosylationi956 – 9561N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase By similarity.
Glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X(2)-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion By similarity.

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiQ9UKP5.
PRIDEiQ9UKP5.

PTM databases

PhosphoSiteiQ9UKP5.

Expressioni

Tissue specificityi

Expressed at low levels in placenta and barely detectable in a number of other tissues.

Inductioni

Isoform 1 and isoform 2 expressions are up-regulated by TNF in retinal pigment epithelial cells.2 Publications

Gene expression databases

ArrayExpressiQ9UKP5.
BgeeiQ9UKP5.
CleanExiHS_ADAMTS6.
GenevestigatoriQ9UKP5.

Organism-specific databases

HPAiHPA027216.

Interactioni

Protein-protein interaction databases

BioGridi116345. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9UKP5.
SMRiQ9UKP5. Positions 247-729.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini250 – 468219Peptidase M12B
Add
BLAST
Domaini495 – 55763Disintegrin
Add
BLAST
Domaini558 – 61356TSP type-1 1
Add
BLAST
Domaini840 – 90061TSP type-1 2
Add
BLAST
Domaini902 – 96059TSP type-1 3
Add
BLAST
Domaini962 – 100746TSP type-1 4
Add
BLAST
Domaini1018 – 107356TSP type-1 5
Add
BLAST
Domaini1079 – 111739PLAC
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni717 – 843127Spacer
Add
BLAST

Domaini

The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.

Sequence similaritiesi

Contains 1 disintegrin domain.
Contains 1 PLAC domain.
Contains 5 TSP type-1 domains.

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiNOG237764.
HOGENOMiHOG000004800.
HOVERGENiHBG004315.
KOiK08621.
OMAiNLIIMVL.
OrthoDBiEOG78WKQV.
PhylomeDBiQ9UKP5.
TreeFamiTF313537.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
InterProiIPR010294. ADAM_spacer1.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR013273. Peptidase_M12B_ADAM-TS.
IPR002870. Peptidase_M12B_N.
IPR010909. PLAC.
IPR000884. Thrombospondin_1_rpt.
[Graphical view]
PfamiPF05986. ADAM_spacer1. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF08686. PLAC. 1 hit.
PF01421. Reprolysin. 1 hit.
PF00090. TSP_1. 5 hits.
[Graphical view]
PRINTSiPR01857. ADAMTSFAMILY.
SMARTiSM00209. TSP1. 5 hits.
[Graphical view]
SUPFAMiSSF82895. SSF82895. 5 hits.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS50900. PLAC. 1 hit.
PS50092. TSP1. 4 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UKP5-1) [UniParc]FASTAAdd to Basket

Also known as: Variant 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEILWKTLTW ILSLIMASSE FHSDHRLSYS SQEEFLTYLE HYQLTIPIRV     50
DQNGAFLSFT VKNDKHSRRR RSMDPIDPQQ AVSKLFFKLS AYGKHFHLNL 100
TLNTDFVSKH FTVEYWGKDG PQWKHDFLDN CHYTGYLQDQ RSTTKVALSN 150
CVGLHGVIAT EDEEYFIEPL KNTTEDSKHF SYENGHPHVI YKKSALQQRH 200
LYDHSHCGVS DFTRSGKPWW LNDTSTVSYS LPINNTHIHH RQKRSVSIER 250
FVETLVVADK MMVGYHGRKD IEHYILSVMN IVAKLYRDSS LGNVVNIIVA 300
RLIVLTEDQP NLEINHHADK SLDSFCKWQK SILSHQSDGN TIPENGIAHH 350
DNAVLITRYD ICTYKNKPCG TLGLASVAGM CEPERSCSIN EDIGLGSAFT 400
IAHEIGHNFG MNHDGIGNSC GTKGHEAAKL MAAHITANTN PFSWSACSRD 450
YITSFLDSGR GTCLDNEPPK RDFLYPAVAP GQVYDADEQC RFQYGATSRQ 500
CKYGEVCREL WCLSKSNRCV TNSIPAAEGT LCQTGNIEKG WCYQGDCVPF 550
GTWPQSIDGG WGPWSLWGEC SRTCGGGVSS SLRHCDSPAP SGGGKYCLGE 600
RKRYRSCNTD PCPLGSRDFR EKQCADFDNM PFRGKYYNWK PYTGGGVKPC 650
ALNCLAEGYN FYTERAPAVI DGTQCNADSL DICINGECKH VGCDNILGSD 700
AREDRCRVCG GDGSTCDAIE GFFNDSLPRG GYMEVVQIPR GSVHIEVREV 750
AMSKNYIALK SEGDDYYING AWTIDWPRKF DVAGTAFHYK RPTDEPESLE 800
ALGPTSENLI VMVLLQEQNL GIRYKFNVPI TRTGSGDNEV GFTWNHQPWS 850
ECSATCAGGV QRQEVVCKRL DDNSIVQNNY CDPDSKPPEN QRACNTEPCP 900
PEWFIGDWLE CSKTCDGGMR TRAVLCIRKI GPSEEETLDY SGCLTHRPVE 950
KEPCNNQSCP PQWVALDWSE CTPKCGPGFK HRIVLCKSSD LSKTFPAAQC 1000
PEESKPPVRI RCSLGRCPPP RWVTGDWGQC SAQCGLGQQM RTVQCLSYTG 1050
QASSDCLETV RPPSMQQCES KCDSTPISNT EECKDVNKVA YCPLVLKFKF 1100
CSRAYFRQMC CKTCQGH 1117
Length:1,117
Mass (Da):125,273
Last modified:May 5, 2009 - v2
Checksum:i5901E86BC82A9A87
GO
Isoform 2 (identifier: Q9UKP5-2) [UniParc]FASTAAdd to Basket

Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     422-504: TKGHEAAKLM...GATSRQCKYG → RKVMKQQNYGSSHYCEYQSFFLVCLQSRFHHQLFR
     860-908: VQRQEVVCKR...CPPEWFIGDW → KMPTRQPTQR...SCNLAKETLL
     909-1117: Missing.

Note: Contains critical point mutations in the region encoding the catalytic domain as well as 2 point mutations compared with genomic sequence. May either be a rare polymorphism or may have arisen through a combination of aberrant RNA editing and point mutation/sequencing error.

Show »
Length:860
Mass (Da):97,152
Checksum:iEA137275B9A465C2
GO
Isoform 3 (identifier: Q9UKP5-3) [UniParc]FASTAAdd to Basket

Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     457-468: DSGRGTCLDNEP → EFLKLGDSISGS
     469-1117: Missing.

Show »
Length:468
Mass (Da):53,165
Checksum:iE8D2E75EF8A1C468
GO
Isoform 4 (identifier: Q9UKP5-4) [UniParc]FASTAAdd to Basket

Also known as: Variant 4

The sequence of this isoform differs from the canonical sequence as follows:
     283-292: AKLYRDSSLG → RLPNFTVIPA
     293-1117: Missing.

Show »
Length:292
Mass (Da):34,189
Checksum:i01A54680DCEFABD7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei283 – 29210AKLYRDSSLG → RLPNFTVIPA in isoform 4.
VSP_037093
Alternative sequencei293 – 1117825Missing in isoform 4.
VSP_037094Add
BLAST
Alternative sequencei422 – 50483TKGHE…QCKYG → RKVMKQQNYGSSHYCEYQSF FLVCLQSRFHHQLFR in isoform 2.
VSP_037095Add
BLAST
Alternative sequencei457 – 46812DSGRG…LDNEP → EFLKLGDSISGS in isoform 3.
VSP_037096Add
BLAST
Alternative sequencei469 – 1117649Missing in isoform 3.
VSP_037097Add
BLAST
Alternative sequencei860 – 90849VQRQE…FIGDW → KMPTRQPTQRARWRTKHILS YALCLLKKLIGNISCRFASS CNLAKETLL in isoform 2.
VSP_037098Add
BLAST
Alternative sequencei909 – 1117209Missing in isoform 2.
VSP_037099Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti4 – 41L → S in AAW47399. 1 Publication
Sequence conflicti24 – 241D → G in AAW47398. 1 Publication
Sequence conflicti83 – 831S → P in AAW47398. 1 Publication
Sequence conflicti229 – 2291Y → H in AAW47397. 1 Publication
Sequence conflicti406 – 4061G → V in AAD56357. 1 Publication
Sequence conflicti426 – 4261E → G in AAD56357. 1 Publication
Sequence conflicti426 – 4261E → G in AAW47397. 1 Publication
Sequence conflicti588 – 5892PA → LK in BAD92922. 1 Publication
Sequence conflicti712 – 7121D → G in AAD56357. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF140674 mRNA. Translation: AAD56357.1.
AY692424 mRNA. Translation: AAW47397.1.
AY692425 mRNA. Translation: AAW47398.1.
AY692426 mRNA. Translation: AAW47399.1.
AC008847 Genomic DNA. No translation available.
AC008868 Genomic DNA. No translation available.
AC025176 Genomic DNA. No translation available.
AC025186 Genomic DNA. No translation available.
AC099505 Genomic DNA. No translation available.
AB209685 mRNA. Translation: BAD92922.1.
CR749356 mRNA. Translation: CAH18209.1.
CCDSiCCDS3983.2. [Q9UKP5-1]
RefSeqiNP_922932.2. NM_197941.2. [Q9UKP5-1]
UniGeneiHs.482291.

Genome annotation databases

EnsembliENST00000381052; ENSP00000424377; ENSG00000049192. [Q9UKP5-4]
ENST00000381055; ENSP00000370443; ENSG00000049192. [Q9UKP5-1]
ENST00000536360; ENSP00000440995; ENSG00000049192. [Q9UKP5-3]
GeneIDi11174.
KEGGihsa:11174.
UCSCiuc003jto.4. human. [Q9UKP5-1]

Polymorphism databases

DMDMi229462816.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF140674 mRNA. Translation: AAD56357.1 .
AY692424 mRNA. Translation: AAW47397.1 .
AY692425 mRNA. Translation: AAW47398.1 .
AY692426 mRNA. Translation: AAW47399.1 .
AC008847 Genomic DNA. No translation available.
AC008868 Genomic DNA. No translation available.
AC025176 Genomic DNA. No translation available.
AC025186 Genomic DNA. No translation available.
AC099505 Genomic DNA. No translation available.
AB209685 mRNA. Translation: BAD92922.1 .
CR749356 mRNA. Translation: CAH18209.1 .
CCDSi CCDS3983.2. [Q9UKP5-1 ]
RefSeqi NP_922932.2. NM_197941.2. [Q9UKP5-1 ]
UniGenei Hs.482291.

3D structure databases

ProteinModelPortali Q9UKP5.
SMRi Q9UKP5. Positions 247-729.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116345. 2 interactions.

Protein family/group databases

MEROPSi M12.230.

PTM databases

PhosphoSitei Q9UKP5.

Polymorphism databases

DMDMi 229462816.

Proteomic databases

PaxDbi Q9UKP5.
PRIDEi Q9UKP5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000381052 ; ENSP00000424377 ; ENSG00000049192 . [Q9UKP5-4 ]
ENST00000381055 ; ENSP00000370443 ; ENSG00000049192 . [Q9UKP5-1 ]
ENST00000536360 ; ENSP00000440995 ; ENSG00000049192 . [Q9UKP5-3 ]
GeneIDi 11174.
KEGGi hsa:11174.
UCSCi uc003jto.4. human. [Q9UKP5-1 ]

Organism-specific databases

CTDi 11174.
GeneCardsi GC05M064526.
HGNCi HGNC:222. ADAMTS6.
HPAi HPA027216.
MIMi 605008. gene.
neXtProti NX_Q9UKP5.
PharmGKBi PA24550.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG237764.
HOGENOMi HOG000004800.
HOVERGENi HBG004315.
KOi K08621.
OMAi NLIIMVL.
OrthoDBi EOG78WKQV.
PhylomeDBi Q9UKP5.
TreeFami TF313537.

Enzyme and pathway databases

Reactomei REACT_200626. O-glycosylation of TSR domain-containing proteins.

Miscellaneous databases

GenomeRNAii 11174.
NextBioi 42521.
PROi Q9UKP5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UKP5.
Bgeei Q9UKP5.
CleanExi HS_ADAMTS6.
Genevestigatori Q9UKP5.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
InterProi IPR010294. ADAM_spacer1.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR013273. Peptidase_M12B_ADAM-TS.
IPR002870. Peptidase_M12B_N.
IPR010909. PLAC.
IPR000884. Thrombospondin_1_rpt.
[Graphical view ]
Pfami PF05986. ADAM_spacer1. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF08686. PLAC. 1 hit.
PF01421. Reprolysin. 1 hit.
PF00090. TSP_1. 5 hits.
[Graphical view ]
PRINTSi PR01857. ADAMTSFAMILY.
SMARTi SM00209. TSP1. 5 hits.
[Graphical view ]
SUPFAMi SSF82895. SSF82895. 5 hits.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS50900. PLAC. 1 hit.
PS50092. TSP1. 4 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "ADAM-TS5, ADAM-TS6, and ADAM-TS7, novel members of a new family of zinc metalloproteases."
    Hurskainen T.L., Hirohata S., Seldin M.F., Apte S.S.
    J. Biol. Chem. 274:25555-25563(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Analysis of full length ADAMTS6 transcript reveals alternative splicing and a role for the 5' untranslated region in translational control."
    Bevitt D.J., Li Z., Lindrop J.L., Barker M.D., Clarke M.P., McKie N.
    Gene 359:99-110(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), INDUCTION.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-1117 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 804-1117 (ISOFORM 1).
    Tissue: Uterus.
  6. "Expression of ADAMTS metalloproteinases in the retinal pigment epithelium derived cell line ARPE-19: transcriptional regulation by TNFalpha."
    Bevitt D.J., Mohamed J., Catterall J.B., Li Z., Arris C.E., Hiscott P., Sheridan C., Langton K.P., Barker M.D., Clarke M.P., McKie N.
    Biochim. Biophys. Acta 1626:83-91(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiATS6_HUMAN
AccessioniPrimary (citable) accession number: Q9UKP5
Secondary accession number(s): Q59EX6
, Q5IR87, Q5IR88, Q5IR89, Q68DL1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 5, 2009
Last modified: September 3, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi