Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic phosphatidylinositol transfer protein 1

Gene

PITPNC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro.1 Publication

GO - Molecular functioni

  • lipid binding Source: UniProtKB-KW
  • phosphatidylinositol transporter activity Source: UniProtKB

GO - Biological processi

  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

Lipid-binding

Chemistry

SwissLipidsiSLP:000000413.
SLP:000000992. [Q9UKF7-1]
SLP:000000993. [Q9UKF7-2]

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic phosphatidylinositol transfer protein 1
Alternative name(s):
Mammalian rdgB homolog beta
Short name:
M-rdgB beta
Short name:
MrdgBbeta
Retinal degeneration B homolog beta
Short name:
RdgBbeta
Gene namesi
Name:PITPNC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:21045. PITPNC1.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394642.

Polymorphism and mutation databases

BioMutaiPITPNC1.
DMDMi147720965.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 332332Cytoplasmic phosphatidylinositol transfer protein 1PRO_0000287530Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei119 – 1191PhosphoserineBy similarity
Modified residuei270 – 2701PhosphoserineBy similarity
Modified residuei274 – 2741PhosphoserineBy similarity
Modified residuei278 – 2781PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UKF7.
PaxDbiQ9UKF7.
PeptideAtlasiQ9UKF7.
PRIDEiQ9UKF7.

PTM databases

iPTMnetiQ9UKF7.
PhosphoSiteiQ9UKF7.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiQ9UKF7.
CleanExiHS_PITPNC1.
ExpressionAtlasiQ9UKF7. baseline and differential.
GenevisibleiQ9UKF7. HS.

Organism-specific databases

HPAiHPA026563.
HPA031250.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW136EBI-749241,EBI-741181
CMTM5Q96DZ93EBI-749241,EBI-2548702

Protein-protein interaction databases

BioGridi117607. 4 interactions.
IntActiQ9UKF7. 3 interactions.
STRINGi9606.ENSP00000335618.

Structurei

3D structure databases

ProteinModelPortaliQ9UKF7.
SMRiQ9UKF7. Positions 1-242.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3668. Eukaryota.
COG5083. LUCA.
GeneTreeiENSGT00760000119216.
HOGENOMiHOG000006717.
HOVERGENiHBG058915.
InParanoidiQ9UKF7.
OrthoDBiEOG7NW69J.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR001666. PI_transfer.
IPR023393. START-like_dom.
[Graphical view]
PANTHERiPTHR10658. PTHR10658. 1 hit.
PfamiPF02121. IP_trans. 1 hit.
[Graphical view]
PRINTSiPR00391. PITRANSFER.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UKF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLKEYRICM PLTVDEYKIG QLYMISKHSH EQSDRGEGVE VVQNEPFEDP
60 70 80 90 100
HHGNGQFTEK RVYLNSKLPS WARAVVPKIF YVTEKAWNYY PYTITEYTCS
110 120 130 140 150
FLPKFSIHIE TKYEDNKGSN DTIFDNEAKD VEREVCFIDI ACDEIPERYY
160 170 180 190 200
KESEDPKHFK SEKTGRGQLR EGWRDSHQPI MCSYKLVTVK FEVWGLQTRV
210 220 230 240 250
EQFVHKVVRD ILLIGHRQAF AWVDEWYDMT MDEVREFERA TQEATNKKIG
260 270 280 290 300
IFPPAISISS IPLLPSSVRS APSSAPSTPL STDAPEFLSV PKDRPRKKSA
310 320 330
PETLTLPDPE KKATLNLPGM HSSDKPCRPK SE
Length:332
Mass (Da):38,388
Last modified:April 16, 2014 - v3
Checksum:iD42C8F00FFA54C6A
GO
Isoform 2 (identifier: Q9UKF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-332: FERATQEATN...SDKPCRPKSE → YEKNMHEQTNIKVCNQHSSPVDDIESHAQTST

Note: No experimental confirmation available.
Show »
Length:268
Mass (Da):31,783
Checksum:iC4CA9500EF02BBFF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti18 – 181K → R in BAF83527 (PubMed:14702039).Curated
Sequence conflicti126 – 1261N → S in AAF06148 (PubMed:10531358).Curated
Sequence conflicti191 – 1911F → S in AAF06148 (PubMed:10531358).Curated
Sequence conflicti233 – 2331E → D in BAF83527 (PubMed:14702039).Curated
Sequence conflicti233 – 2331E → D in AAH07905 (PubMed:15489334).Curated
Sequence conflicti233 – 2331E → D in AAH67095 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei237 – 33296FERAT…RPKSE → YEKNMHEQTNIKVCNQHSSP VDDIESHAQTST in isoform 2. 2 PublicationsVSP_025545Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171102 mRNA. Translation: AAF06148.1.
AK290838 mRNA. Translation: BAF83527.1.
AC079331 Genomic DNA. No translation available.
AC110921 Genomic DNA. No translation available.
BC007905 mRNA. Translation: AAH07905.1.
BC067095 mRNA. Translation: AAH67095.1.
CCDSiCCDS58587.1. [Q9UKF7-2]
CCDS58588.1. [Q9UKF7-1]
RefSeqiNP_036549.2. NM_012417.3. [Q9UKF7-1]
NP_858057.1. NM_181671.2.
UniGeneiHs.591185.

Genome annotation databases

EnsembliENST00000581322; ENSP00000464006; ENSG00000154217. [Q9UKF7-1]
GeneIDi26207.
KEGGihsa:26207.
UCSCiuc002jgb.5. human. [Q9UKF7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171102 mRNA. Translation: AAF06148.1.
AK290838 mRNA. Translation: BAF83527.1.
AC079331 Genomic DNA. No translation available.
AC110921 Genomic DNA. No translation available.
BC007905 mRNA. Translation: AAH07905.1.
BC067095 mRNA. Translation: AAH67095.1.
CCDSiCCDS58587.1. [Q9UKF7-2]
CCDS58588.1. [Q9UKF7-1]
RefSeqiNP_036549.2. NM_012417.3. [Q9UKF7-1]
NP_858057.1. NM_181671.2.
UniGeneiHs.591185.

3D structure databases

ProteinModelPortaliQ9UKF7.
SMRiQ9UKF7. Positions 1-242.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117607. 4 interactions.
IntActiQ9UKF7. 3 interactions.
STRINGi9606.ENSP00000335618.

Chemistry

SwissLipidsiSLP:000000413.
SLP:000000992. [Q9UKF7-1]
SLP:000000993. [Q9UKF7-2]

PTM databases

iPTMnetiQ9UKF7.
PhosphoSiteiQ9UKF7.

Polymorphism and mutation databases

BioMutaiPITPNC1.
DMDMi147720965.

Proteomic databases

EPDiQ9UKF7.
PaxDbiQ9UKF7.
PeptideAtlasiQ9UKF7.
PRIDEiQ9UKF7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000581322; ENSP00000464006; ENSG00000154217. [Q9UKF7-1]
GeneIDi26207.
KEGGihsa:26207.
UCSCiuc002jgb.5. human. [Q9UKF7-1]

Organism-specific databases

CTDi26207.
GeneCardsiPITPNC1.
HGNCiHGNC:21045. PITPNC1.
HPAiHPA026563.
HPA031250.
MIMi605134. gene.
neXtProtiNX_Q9UKF7.
PharmGKBiPA128394642.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3668. Eukaryota.
COG5083. LUCA.
GeneTreeiENSGT00760000119216.
HOGENOMiHOG000006717.
HOVERGENiHBG058915.
InParanoidiQ9UKF7.
OrthoDBiEOG7NW69J.

Miscellaneous databases

ChiTaRSiPITPNC1. human.
GenomeRNAii26207.
PROiQ9UKF7.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UKF7.
CleanExiHS_PITPNC1.
ExpressionAtlasiQ9UKF7. baseline and differential.
GenevisibleiQ9UKF7. HS.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR001666. PI_transfer.
IPR023393. START-like_dom.
[Graphical view]
PANTHERiPTHR10658. PTHR10658. 1 hit.
PfamiPF02121. IP_trans. 1 hit.
[Graphical view]
PRINTSiPR00391. PITRANSFER.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human phosphatidylinositol transfer protein, rdgBbeta."
    Fullwood Y., dos Santos M., Hsuan J.J.
    J. Biol. Chem. 274:31553-31558(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Liver.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye and Skin.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiPITC1_HUMAN
AccessioniPrimary (citable) accession number: Q9UKF7
Secondary accession number(s): A8K473, J3QR20, Q96I07
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: April 16, 2014
Last modified: July 6, 2016
This is version 101 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.