Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic phosphatidylinositol transfer protein 1

Gene

PITPNC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro.1 Publication

GO - Molecular functioni

  • phosphatidic acid binding Source: BHF-UCL
  • phosphatidylglycerol binding Source: BHF-UCL
  • phosphatidylinositol binding Source: BHF-UCL
  • phosphatidylinositol transporter activity Source: BHF-UCL

GO - Biological processi

  • phospholipid transport Source: BHF-UCL
  • signal transduction Source: UniProtKB

Keywordsi

Biological processLipid transport, Transport
LigandLipid-binding

Chemistry databases

SwissLipidsiSLP:000000413.
SLP:000000992. [Q9UKF7-1]
SLP:000000993. [Q9UKF7-2]

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic phosphatidylinositol transfer protein 1
Alternative name(s):
Mammalian rdgB homolog beta
Short name:
M-rdgB beta
Short name:
MrdgBbeta
Retinal degeneration B homolog beta
Short name:
RdgBbeta
Gene namesi
Name:PITPNC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000154217.14.
HGNCiHGNC:21045. PITPNC1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi26207.
OpenTargetsiENSG00000154217.
PharmGKBiPA128394642.

Polymorphism and mutation databases

BioMutaiPITPNC1.
DMDMi147720965.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002875301 – 332Cytoplasmic phosphatidylinositol transfer protein 1Add BLAST332

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei119PhosphoserineBy similarity1
Modified residuei270PhosphoserineBy similarity1
Modified residuei274PhosphoserineBy similarity1
Modified residuei278PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UKF7.
PaxDbiQ9UKF7.
PeptideAtlasiQ9UKF7.
PRIDEiQ9UKF7.

PTM databases

iPTMnetiQ9UKF7.
PhosphoSitePlusiQ9UKF7.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000154217.
CleanExiHS_PITPNC1.
ExpressionAtlasiQ9UKF7. baseline and differential.
GenevisibleiQ9UKF7. HS.

Organism-specific databases

HPAiHPA026563.
HPA031250.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi117607. 4 interactors.
IntActiQ9UKF7. 15 interactors.
STRINGi9606.ENSP00000335618.

Structurei

3D structure databases

ProteinModelPortaliQ9UKF7.
SMRiQ9UKF7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3668. Eukaryota.
COG5083. LUCA.
GeneTreeiENSGT00760000119216.
HOGENOMiHOG000006717.
HOVERGENiHBG058915.
InParanoidiQ9UKF7.
OrthoDBiEOG091G0CQQ.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiView protein in InterPro
IPR001666. PI_transfer.
IPR023393. START-like_dom.
PANTHERiPTHR10658. PTHR10658. 1 hit.
PfamiView protein in Pfam
PF02121. IP_trans. 1 hit.
PRINTSiPR00391. PITRANSFER.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UKF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLKEYRICM PLTVDEYKIG QLYMISKHSH EQSDRGEGVE VVQNEPFEDP
60 70 80 90 100
HHGNGQFTEK RVYLNSKLPS WARAVVPKIF YVTEKAWNYY PYTITEYTCS
110 120 130 140 150
FLPKFSIHIE TKYEDNKGSN DTIFDNEAKD VEREVCFIDI ACDEIPERYY
160 170 180 190 200
KESEDPKHFK SEKTGRGQLR EGWRDSHQPI MCSYKLVTVK FEVWGLQTRV
210 220 230 240 250
EQFVHKVVRD ILLIGHRQAF AWVDEWYDMT MDEVREFERA TQEATNKKIG
260 270 280 290 300
IFPPAISISS IPLLPSSVRS APSSAPSTPL STDAPEFLSV PKDRPRKKSA
310 320 330
PETLTLPDPE KKATLNLPGM HSSDKPCRPK SE
Length:332
Mass (Da):38,388
Last modified:April 16, 2014 - v3
Checksum:iD42C8F00FFA54C6A
GO
Isoform 2 (identifier: Q9UKF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-332: FERATQEATN...SDKPCRPKSE → YEKNMHEQTNIKVCNQHSSPVDDIESHAQTST

Note: No experimental confirmation available.
Show »
Length:268
Mass (Da):31,783
Checksum:iC4CA9500EF02BBFF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti18K → R in BAF83527 (PubMed:14702039).Curated1
Sequence conflicti126N → S in AAF06148 (PubMed:10531358).Curated1
Sequence conflicti191F → S in AAF06148 (PubMed:10531358).Curated1
Sequence conflicti233E → D in BAF83527 (PubMed:14702039).Curated1
Sequence conflicti233E → D in AAH07905 (PubMed:15489334).Curated1
Sequence conflicti233E → D in AAH67095 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025545237 – 332FERAT…RPKSE → YEKNMHEQTNIKVCNQHSSP VDDIESHAQTST in isoform 2. 2 PublicationsAdd BLAST96

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171102 mRNA. Translation: AAF06148.1.
AK290838 mRNA. Translation: BAF83527.1.
AC079331 Genomic DNA. No translation available.
AC110921 Genomic DNA. No translation available.
BC007905 mRNA. Translation: AAH07905.1.
BC067095 mRNA. Translation: AAH67095.1.
CCDSiCCDS58587.1. [Q9UKF7-2]
CCDS58588.1. [Q9UKF7-1]
RefSeqiNP_036549.2. NM_012417.3. [Q9UKF7-1]
NP_858057.1. NM_181671.2.
UniGeneiHs.591185.

Genome annotation databases

EnsembliENST00000581322; ENSP00000464006; ENSG00000154217. [Q9UKF7-1]
GeneIDi26207.
KEGGihsa:26207.
UCSCiuc002jgb.5. human. [Q9UKF7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPITC1_HUMAN
AccessioniPrimary (citable) accession number: Q9UKF7
Secondary accession number(s): A8K473, J3QR20, Q96I07
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: April 16, 2014
Last modified: September 27, 2017
This is version 109 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families