Reviewed,
UniProtKB/Swiss-Prot Q9UKB1 (FBW1B_HUMAN)
Last modified
January 19, 2010.
Version 98.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: F-box/WD repeat-containing protein 11 Alternative name(s): F-box/WD repeat-containing protein 1B F-box and WD repeats protein beta-TrCP2 Homologous to Slimb protein Short name=HOS | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 542 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(FBXW11) mediates the ubiquitination of NFKBIA, the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. Ref.7 Ref.8 Ref.9 |
| Subunit structure | Self-associates. Component of the SCF(FBXW11) complex formed of CUL1, SKP1A, RBX1 and a FBXW11 dimer. Interacts with BTRC. Interacts with phosphorylated ubiquitination substrates CTNNB1, NFKBIA, IFNAR1; the interaction requires the phosphorylation of the two serine residues in the destruction motif D-S-G-X(2,3)-S. Ref.7 Ref.8 Ref.9 |
| Subcellular location | Cytoplasm Potential. |
| Sequence similarities | Contains 1 F-box domain. Contains 7 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway Wnt signaling pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat WD repeat |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | Wnt receptor signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW modification-dependent protein catabolic processInferred from electronic annotation. Source: UniProtKB-KW protein ubiquitination Ref.1Non-traceable author statement. Source: UniProtKB |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell ubiquitin ligase complex Ref.1Non-traceable author statement. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct ubiquitin-protein ligase activity Ref.1Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| RPRM | Q9NS64 | 1 | EBI-355189,EBI-1052363 | |
| WEE1 | P30291 | 1 | EBI-355189,EBI-914695 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform C (identifier: Q9UKB1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q9UKB1-2) The sequence of this isoform differs from the canonical sequence as follows: 16-49: Missing. | ||||||
| Isoform B (identifier: Q9UKB1-3) The sequence of this isoform differs from the canonical sequence as follows: 16-48: CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL → NTSVMEDQNEDESPKKNTLW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 542 | 542 | F-box/WD repeat-containing protein 11 | PRO_0000050981 | |||||
Regions | |||||||||
| Domain | 129 – 167 | 39 | F-box | ||||||
| Repeat | 238 – 275 | 38 | WD 1 | ||||||
| Repeat | 278 – 315 | 38 | WD 2 | ||||||
| Repeat | 318 – 355 | 38 | WD 3 | ||||||
| Repeat | 361 – 398 | 38 | WD 4 | ||||||
| Repeat | 401 – 440 | 40 | WD 5 | ||||||
| Repeat | 442 – 478 | 37 | WD 6 | ||||||
| Repeat | 490 – 527 | 38 | WD 7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 16 – 49 | 34 | Missing in isoform A. | VSP_006765 | |||||
| Alternative sequence | 16 – 48 | 33 | CSVPR…SVRCL → NTSVMEDQNEDESPKKNTLW in isoform B. | VSP_006766 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a family of human F-box proteins." Cenciarelli C., Chiaur D.S., Guardavaccaro D., Parks W., Vidal M., Pagano M. Curr. Biol. 9:1177-1179(1999) [PubMed: 10531035] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "Molecular cloning and genomic structure of the betaTRCP2 gene on chromosome 5q35.1." Koike J., Sagara N., Kirikoshi H., Takagi A., Miwa T., Hirai M., Katoh M. Biochem. Biophys. Res. Commun. 269:103-109(2000) [PubMed: 10694485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Fetal lung. |
| [3] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed: 9734811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Hippocampus. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Lymph. |
| [6] | "IkappaBalpha ubiquitination is catalyzed by an SCF-like complex containing Skp1, cullin-1, and two F-box/WD40-repeat proteins, betaTrCP1 and betaTrCP2." Suzuki H., Chiba T., Kobayashi M., Takeuchi M., Suzuki T., Ichiyama A., Ikenoue T., Omata M., Furuichi K., Tanaka K. Biochem. Biophys. Res. Commun. 256:127-132(1999) [PubMed: 10066435] [Abstract] Cited for: IDENTIFICATION IN THE SCF(FBXW11) COMPLEX. |
| [7] | "HOS, a human homolog of Slimb, forms an SCF complex with Skp1 and Cullin1 and targets the phosphorylation-dependent degradation of IkappaB and beta-catenin." Fuchs S.Y., Chen A., Xiong Y., Pan Z.Q., Ronai Z. Oncogene 18:2039-2046(1999) [PubMed: 10321728] [Abstract] Cited for: INTERACTION WITH NFKBIA AND CTNNB1, FUNCTION IN UBIQUITINATION OF NFKBIA AND CTNNB1. |
| [8] | "Homodimer of two F-box proteins betaTrCP1 or betaTrCP2 binds to IkappaBalpha for signal-dependent ubiquitination." Suzuki H., Chiba T., Suzuki T., Fujita T., Ikenoue T., Omata M., Furuichi K., Shikama H., Tanaka K. J. Biol. Chem. 275:2877-2884(2000) [PubMed: 10644755] [Abstract] Cited for: SELF-ASSOCIATION, INTERACTION WITH BTRC AND NFKBIA, FUNCTION IN UBIQUITINATION OF NFKBIA. |
| [9] | "SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor." Kumar K.G., Tang W., Ravindranath A.K., Clark W.A., Croze E., Fuchs S.Y. EMBO J. 22:5480-5490(2003) [PubMed: 14532120] [Abstract] Cited for: INTERACTION WITH PHOSPHORYLATED IFNAR1, FUNCTION IN IFNAR1 UBIQUITINATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF176022 mRNA. Translation: AAF04528.1. AB033279 mRNA. Translation: BAA92329.1. AB033280 mRNA. Translation: BAA92330.1. AB033281 mRNA. Translation: BAA92331.1. AB014596 mRNA. Translation: BAA31671.1. Different initiation. AK314999 mRNA. Translation: BAG37495.1. BC026213 mRNA. Translation: AAH26213.1. |
| IPI | IPI00301283. IPI00306671. IPI00328796. |
| RefSeq | NP_036432.2. NP_387448.2. NP_387449.2. |
| UniGene | Hs.484138 |
3D structure databases | |
| SMR | Q9UKB1. Positions 67-116, 114-518. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-27593N. |
| IntAct | Q9UKB1. 10 interactions. |
| STRING | Q9UKB1. |
PTM databases | |
| PhosphoSite | Q9UKB1. |
Proteomic databases | |
| PRIDE | Q9UKB1. |
Genome annotation databases | |
| Ensembl | ENST00000265094; ENSP00000265094; ENSG00000072803; Homo sapiens. [Genome view] |
| GeneID | 23291. |
| KEGG | hsa:23291. |
| UCSC | uc003mbl.1. human. uc003mbm.1. human. uc003mbn.1. human. |
Organism-specific databases | |
| CTD | 23291. |
| GeneCards | GC05M171221. |
| H-InvDB | HIX0005413. |
| HGNC | HGNC:13607. FBXW11. |
| MIM | 605651. gene. |
| PharmGKB | PA28050. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05164. |
| HOGENOM | HBG379811. |
| HOVERGEN | Q9UKB1. |
| InParanoid | Q9UKB1. |
| OMA | MEPEMED. |
| OrthoDB | EOG94TRVB. |
| PhylomeDB | Q9UKB1. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | nfkappabalternativepathway. Alternative NF-kappaB pathway. nfkappabatypicalpathway. Atypical NF-kappaB pathway. nfkappabcanonicalpathway. Canonical NF-kappaB pathway. wnt_canonical_pathway. Canonical Wnt signaling pathway. hedgehog_glipathway. Hedgehog signaling events mediated by Gli proteins. ps1pathway. Presenilin action in Notch and Wnt signaling. hdac_classi_pathway. Signaling events mediated by HDAC Class I. |
Gene expression databases | |
| ArrayExpress | Q9UKB1. |
| Bgee | Q9UKB1. |
| CleanEx | HS_FBXW11. |
| Genevestigator | Q9UKB1. |
| GermOnline | ENSG00000072803. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001810. F-box. IPR020472. G-protein_beta_WD-40_rep_reg. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR019782. WD40_repeat_2. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. IPR019781. WD40_repeat_sg. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF00646. F-box. 1 hit. PF00400. WD40. 7 hits. [Graphical view] |
| PRINTS | PR00320. GPROTEINBRPT. |
| SMART | SM00256. FBOX. 1 hit. SM00320. WD40. 7 hits. [Graphical view] |
| PROSITE | PS50181. FBOX. 1 hit. PS00678. WD_REPEATS_1. 5 hits. PS50082. WD_REPEATS_2. 7 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 45108. |
| SOURCE | Search... |
Entry information
| Entry name | FBW1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UKB1 Secondary accession number(s): B2RC98 Q9Y4C6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


