Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 11

Gene

FBXW11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of phosphorylated CTNNB1 and participates in Wnt signaling. SCF(FBXW11) mediates the ubiquitination of phosphorylated NFKBIA, which degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. SCF(FBXW11) mediates the ubiquitination of CEP68; this is required for centriole separation during mitosis (PubMed:25503564). Involved in the oxidative stress-induced a ubiquitin-mediated decrease in RCAN1. Mediates the degradation of CDC25A induced by ionizing radiation in cells progressing through S phase and thus may function in the intra-S-phase checkpoint. Has an essential role in the control of the clock-dependent transcription via degradation of phosphorylated PER1 and phosphorylated PER2. Is target of human immunodeficiency virus type 1 (HIV-1) protein VPU to polyubiquitinate and deplete BST2 from cells and antagonize its antiviral action.12 Publications

GO - Molecular functioni

  • ubiquitin protein ligase activity Source: Ensembl
  • ubiquitin-protein transferase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Biological rhythms, Cell cycle, Ubl conjugation pathway, Wnt signaling pathway

Enzyme and pathway databases

BioCyciZFISH:ENSG00000072803-MONOMER.
ReactomeiR-HSA-1169091. Activation of NF-kappaB in B cells.
R-HSA-202424. Downstream TCR signaling.
R-HSA-2565942. Regulation of PLK1 Activity at G2/M Transition.
R-HSA-2871837. FCERI mediated NF-kB activation.
R-HSA-5607761. Dectin-1 mediated noncanonical NF-kB signaling.
R-HSA-5607764. CLEC7A (Dectin-1) signaling.
R-HSA-5676590. NIK-->noncanonical NF-kB signaling.
R-HSA-5684264. MAP3K8 (TPL2)-dependent MAPK1/3 activation.
R-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9UKB1.
SIGNORiQ9UKB1.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 11
Alternative name(s):
F-box and WD repeats protein beta-TrCP2
F-box/WD repeat-containing protein 1B
Homologous to Slimb protein
Short name:
HOS
Gene namesi
Name:FBXW11
Synonyms:BTRCP2, FBW1B, FBXW1B, KIAA0696
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:13607. FBXW11.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytosol Source: UniProtKB
  • nucleus Source: UniProtKB
  • SCF ubiquitin ligase complex Source: UniProtKB
  • ubiquitin ligase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23291.
OpenTargetsiENSG00000072803.
PharmGKBiPA28050.

Polymorphism and mutation databases

BioMutaiFBXW11.
DMDMi13124267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000509811 – 542F-box/WD repeat-containing protein 11Add BLAST542

Proteomic databases

EPDiQ9UKB1.
PaxDbiQ9UKB1.
PeptideAtlasiQ9UKB1.
PRIDEiQ9UKB1.

PTM databases

iPTMnetiQ9UKB1.
PhosphoSitePlusiQ9UKB1.

Expressioni

Inductioni

Expression is negatively regulated by Wnt/beta-catenin pathway.1 Publication

Gene expression databases

BgeeiENSG00000072803.
CleanExiHS_FBXW11.
ExpressionAtlasiQ9UKB1. baseline and differential.
GenevisibleiQ9UKB1. HS.

Organism-specific databases

HPAiHPA062578.

Interactioni

Subunit structurei

Self-associates. Component of the SCF(FBXW11) complex formed of CUL1, SKP1, RBX1 and a FBXW11 dimer. Interacts with BTRC, BST2, PER1, RCAN1 and USP47. Interacts with phosphorylated ubiquitination substrates CTNNB1, NFKBIA, IFNAR1, PER1 and PER2; the interaction requires the phosphorylation of the two serine residues in the substrates' destruction motif D-S-G-X(2,3,4)-S. Interacts with TRIM21. Interacts with PER3. Interacts with phosphorylated ubiquitination substrate CEP68 (PubMed:25503564).14 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AMER1Q5JTC64EBI-355189,EBI-6169747
AXIN1O151694EBI-355189,EBI-710484
CTNNB1P352224EBI-355189,EBI-491549
CUL1Q136163EBI-355189,EBI-359390
FOXN2P323144EBI-355189,EBI-10706164
IFNAR1P171818EBI-355189,EBI-1547250
MDM2Q009874EBI-355189,EBI-389668
NFKBIAP259632EBI-355189,EBI-307386
NFKBIBQ156532EBI-355189,EBI-352889
SKP1P632087EBI-355189,EBI-307486
WEE1P302913EBI-355189,EBI-914695

Protein-protein interaction databases

BioGridi116887. 406 interactors.
DIPiDIP-27593N.
IntActiQ9UKB1. 48 interactors.
MINTiMINT-120522.
STRINGi9606.ENSP00000265094.

Structurei

3D structure databases

ProteinModelPortaliQ9UKB1.
SMRiQ9UKB1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini129 – 167F-boxPROSITE-ProRule annotationAdd BLAST39
Repeati238 – 275WD 1Add BLAST38
Repeati278 – 315WD 2Add BLAST38
Repeati318 – 355WD 3Add BLAST38
Repeati361 – 398WD 4Add BLAST38
Repeati401 – 440WD 5Add BLAST40
Repeati442 – 478WD 6Add BLAST37
Repeati490 – 527WD 7Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni67 – 116Homodimerization domain DBy similarityAdd BLAST50

Domaini

The N-terminal D domain mediates homodimerization.By similarity

Sequence similaritiesi

Contains 1 F-box domain.PROSITE-ProRule annotation
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0281. Eukaryota.
ENOG410XTA8. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000006638.
HOVERGENiHBG002521.
InParanoidiQ9UKB1.
KOiK03362.
OMAiRLISRMC.
OrthoDBiEOG091G0437.
PhylomeDBiQ9UKB1.
TreeFamiTF105679.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR021977. Beta-TrCP_D.
IPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12125. Beta-TrCP_D. 1 hit.
PF12937. F-box-like. 1 hit.
PF00400. WD40. 7 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM01028. Beta-TrCP_D. 1 hit.
SM00256. FBOX. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
PS00678. WD_REPEATS_1. 5 hits.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform C (identifier: Q9UKB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPDSVIEDK TIELMCSVPR SLWLGCANLV ESMCALSCLQ SMPSVRCLQI
60 70 80 90 100
SNGTSSVIVS RKRPSEGNYQ KEKDLCIKYF DQWSESDQVE FVEHLISRMC
110 120 130 140 150
HYQHGHINSY LKPMLQRDFI TALPEQGLDH IAENILSYLD ARSLCAAELV
160 170 180 190 200
CKEWQRVISE GMLWKKLIER MVRTDPLWKG LSERRGWDQY LFKNRPTDGP
210 220 230 240 250
PNSFYRSLYP KIIQDIETIE SNWRCGRHNL QRIQCRSENS KGVYCLQYDD
260 270 280 290 300
EKIISGLRDN SIKIWDKTSL ECLKVLTGHT GSVLCLQYDE RVIVTGSSDS
310 320 330 340 350
TVRVWDVNTG EVLNTLIHHN EAVLHLRFSN GLMVTCSKDR SIAVWDMASA
360 370 380 390 400
TDITLRRVLV GHRAAVNVVD FDDKYIVSAS GDRTIKVWST STCEFVRTLN
410 420 430 440 450
GHKRGIACLQ YRDRLVVSGS SDNTIRLWDI ECGACLRVLE GHEELVRCIR
460 470 480 490 500
FDNKRIVSGA YDGKIKVWDL QAALDPRAPA STLCLRTLVE HSGRVFRLQF
510 520 530 540
DEFQIISSSH DDTILIWDFL NVPPSAQNET RSPSRTYTYI SR
Length:542
Mass (Da):62,091
Last modified:May 1, 2000 - v1
Checksum:i7CD40087EFAA5C8A
GO
Isoform A (identifier: Q9UKB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-49: Missing.

Show »
Length:508
Mass (Da):58,422
Checksum:i05C691DB32A91B50
GO
Isoform B (identifier: Q9UKB1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-48: CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL → NTSVMEDQNEDESPKKNTLW

Show »
Length:529
Mass (Da):60,898
Checksum:i53D181B789313D0E
GO

Sequence cautioni

The sequence BAA31671 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00676516 – 49Missing in isoform A. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00676616 – 48CSVPR…SVRCL → NTSVMEDQNEDESPKKNTLW in isoform B. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176022 mRNA. Translation: AAF04528.1.
AB033279 mRNA. Translation: BAA92329.1.
AB033280 mRNA. Translation: BAA92330.1.
AB033281 mRNA. Translation: BAA92331.1.
AB014596 mRNA. Translation: BAA31671.1. Different initiation.
AK314999 mRNA. Translation: BAG37495.1.
BC026213 mRNA. Translation: AAH26213.1.
CCDSiCCDS34289.1. [Q9UKB1-1]
CCDS47340.1. [Q9UKB1-2]
CCDS47341.1. [Q9UKB1-3]
RefSeqiNP_036432.2. NM_012300.2. [Q9UKB1-1]
NP_387448.2. NM_033644.2. [Q9UKB1-3]
NP_387449.2. NM_033645.2. [Q9UKB1-2]
UniGeneiHs.484138.

Genome annotation databases

EnsembliENST00000265094; ENSP00000265094; ENSG00000072803. [Q9UKB1-1]
ENST00000296933; ENSP00000296933; ENSG00000072803. [Q9UKB1-3]
ENST00000393802; ENSP00000377391; ENSG00000072803. [Q9UKB1-2]
GeneIDi23291.
KEGGihsa:23291.
UCSCiuc003mbl.2. human. [Q9UKB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176022 mRNA. Translation: AAF04528.1.
AB033279 mRNA. Translation: BAA92329.1.
AB033280 mRNA. Translation: BAA92330.1.
AB033281 mRNA. Translation: BAA92331.1.
AB014596 mRNA. Translation: BAA31671.1. Different initiation.
AK314999 mRNA. Translation: BAG37495.1.
BC026213 mRNA. Translation: AAH26213.1.
CCDSiCCDS34289.1. [Q9UKB1-1]
CCDS47340.1. [Q9UKB1-2]
CCDS47341.1. [Q9UKB1-3]
RefSeqiNP_036432.2. NM_012300.2. [Q9UKB1-1]
NP_387448.2. NM_033644.2. [Q9UKB1-3]
NP_387449.2. NM_033645.2. [Q9UKB1-2]
UniGeneiHs.484138.

3D structure databases

ProteinModelPortaliQ9UKB1.
SMRiQ9UKB1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116887. 406 interactors.
DIPiDIP-27593N.
IntActiQ9UKB1. 48 interactors.
MINTiMINT-120522.
STRINGi9606.ENSP00000265094.

PTM databases

iPTMnetiQ9UKB1.
PhosphoSitePlusiQ9UKB1.

Polymorphism and mutation databases

BioMutaiFBXW11.
DMDMi13124267.

Proteomic databases

EPDiQ9UKB1.
PaxDbiQ9UKB1.
PeptideAtlasiQ9UKB1.
PRIDEiQ9UKB1.

Protocols and materials databases

DNASUi23291.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265094; ENSP00000265094; ENSG00000072803. [Q9UKB1-1]
ENST00000296933; ENSP00000296933; ENSG00000072803. [Q9UKB1-3]
ENST00000393802; ENSP00000377391; ENSG00000072803. [Q9UKB1-2]
GeneIDi23291.
KEGGihsa:23291.
UCSCiuc003mbl.2. human. [Q9UKB1-1]

Organism-specific databases

CTDi23291.
DisGeNETi23291.
GeneCardsiFBXW11.
HGNCiHGNC:13607. FBXW11.
HPAiHPA062578.
MIMi605651. gene.
neXtProtiNX_Q9UKB1.
OpenTargetsiENSG00000072803.
PharmGKBiPA28050.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0281. Eukaryota.
ENOG410XTA8. LUCA.
GeneTreeiENSGT00760000119106.
HOGENOMiHOG000006638.
HOVERGENiHBG002521.
InParanoidiQ9UKB1.
KOiK03362.
OMAiRLISRMC.
OrthoDBiEOG091G0437.
PhylomeDBiQ9UKB1.
TreeFamiTF105679.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000072803-MONOMER.
ReactomeiR-HSA-1169091. Activation of NF-kappaB in B cells.
R-HSA-202424. Downstream TCR signaling.
R-HSA-2565942. Regulation of PLK1 Activity at G2/M Transition.
R-HSA-2871837. FCERI mediated NF-kB activation.
R-HSA-5607761. Dectin-1 mediated noncanonical NF-kB signaling.
R-HSA-5607764. CLEC7A (Dectin-1) signaling.
R-HSA-5676590. NIK-->noncanonical NF-kB signaling.
R-HSA-5684264. MAP3K8 (TPL2)-dependent MAPK1/3 activation.
R-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SignaLinkiQ9UKB1.
SIGNORiQ9UKB1.

Miscellaneous databases

ChiTaRSiFBXW11. human.
GeneWikiiFBXW11.
GenomeRNAii23291.
PROiQ9UKB1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000072803.
CleanExiHS_FBXW11.
ExpressionAtlasiQ9UKB1. baseline and differential.
GenevisibleiQ9UKB1. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR021977. Beta-TrCP_D.
IPR001810. F-box_dom.
IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12125. Beta-TrCP_D. 1 hit.
PF12937. F-box-like. 1 hit.
PF00400. WD40. 7 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM01028. Beta-TrCP_D. 1 hit.
SM00256. FBOX. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
PS00678. WD_REPEATS_1. 5 hits.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFBW1B_HUMAN
AccessioniPrimary (citable) accession number: Q9UKB1
Secondary accession number(s): B2RC98
, Q9P2S8, Q9P2S9, Q9Y4C6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 170 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.