Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 11

Gene

FBXW11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of phosphorylated CTNNB1 and participates in Wnt signaling. SCF(FBXW11) mediates the ubiquitination of phosphorylated NFKBIA, which degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. SCF(FBXW11) mediates the ubiquitination of CEP68; this is required for centriole separation during mitosis (PubMed:25503564). Involved in the oxidative stress-induced a ubiquitin-mediated decrease in RCAN1. Mediates the degradation of CDC25A induced by ionizing radiation in cells progressing through S phase and thus may function in the intra-S-phase checkpoint. Has an essential role in the control of the clock-dependent transcription via degradation of phosphorylated PER1 and phosphorylated PER2. SCF(FBXW11) mediates the ubiquitination of CYTH1, and probably CYTH2 (PubMed:29420262).12 Publications
(Microbial infection) Target of human immunodeficiency virus type 1 (HIV-1) protein VPU to polyubiquitinate and deplete BST2 from cells and antagonize its antiviral action.1 Publication

GO - Molecular functioni

GO - Biological processi

  • G2/M transition of mitotic cell cycle Source: Reactome
  • interleukin-1-mediated signaling pathway Source: Reactome
  • negative regulation of NIK/NF-kappaB signaling Source: Ensembl
  • negative regulation of transcription, DNA-templated Source: UniProtKB
  • NIK/NF-kappaB signaling Source: Reactome
  • positive regulation of circadian rhythm Source: UniProtKB
  • positive regulation of proteolysis Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • post-translational protein modification Source: Reactome
  • proteasome-mediated ubiquitin-dependent protein catabolic process Source: UniProtKB
  • protein dephosphorylation Source: UniProtKB
  • protein destabilization Source: UniProtKB
  • protein polyubiquitination Source: UniProtKB
  • protein ubiquitination Source: UniProtKB
  • rhythmic process Source: UniProtKB-KW
  • SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB
  • stress-activated MAPK cascade Source: Reactome
  • Wnt signaling pathway Source: UniProtKB-KW

Keywordsi

Biological processBiological rhythms, Cell cycle, Ubl conjugation pathway, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-1169091 Activation of NF-kappaB in B cells
R-HSA-202424 Downstream TCR signaling
R-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-5607761 Dectin-1 mediated noncanonical NF-kB signaling
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-5676590 NIK-->noncanonical NF-kB signaling
R-HSA-5684264 MAP3K8 (TPL2)-dependent MAPK1/3 activation
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ9UKB1
SIGNORiQ9UKB1

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 11
Alternative name(s):
F-box and WD repeats protein beta-TrCP2
F-box/WD repeat-containing protein 1B
Homologous to Slimb protein
Short name:
HOS
Gene namesi
Name:FBXW11
Synonyms:BTRCP2, FBW1B, FBXW1B, KIAA0696
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000072803.17
HGNCiHGNC:13607 FBXW11
MIMi605651 gene
neXtProtiNX_Q9UKB1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23291
OpenTargetsiENSG00000072803
PharmGKBiPA28050

Polymorphism and mutation databases

BioMutaiFBXW11
DMDMi13124267

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000509811 – 542F-box/WD repeat-containing protein 11Add BLAST542

Proteomic databases

EPDiQ9UKB1
PaxDbiQ9UKB1
PeptideAtlasiQ9UKB1
PRIDEiQ9UKB1

PTM databases

iPTMnetiQ9UKB1
PhosphoSitePlusiQ9UKB1

Expressioni

Inductioni

Expression is negatively regulated by Wnt/beta-catenin pathway.1 Publication

Gene expression databases

BgeeiENSG00000072803
CleanExiHS_FBXW11
ExpressionAtlasiQ9UKB1 baseline and differential
GenevisibleiQ9UKB1 HS

Organism-specific databases

HPAiHPA062578
HPA072204

Interactioni

Subunit structurei

Self-associates. Component of the SCF(FBXW11) complex formed of CUL1, SKP1, RBX1 and a FBXW11 dimer. Interacts with BTRC, BST2, PER1, RCAN1 and USP47. Interacts with phosphorylated ubiquitination substrates CTNNB1, NFKBIA, IFNAR1, PER1 and PER2; the interaction requires the phosphorylation of the two serine residues in the substrates' destruction motif D-S-G-X(2,3,4)-S. Interacts with TRIM21. Interacts with PER3. Interacts with phosphorylated ubiquitination substrate CEP68 (PubMed:25503564). Interacts with INAVA (PubMed:29420262).15 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116887, 414 interactors
CORUMiQ9UKB1
DIPiDIP-27593N
ELMiQ9UKB1
IntActiQ9UKB1, 51 interactors
MINTiQ9UKB1
STRINGi9606.ENSP00000265094

Structurei

3D structure databases

ProteinModelPortaliQ9UKB1
SMRiQ9UKB1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini129 – 167F-boxPROSITE-ProRule annotationAdd BLAST39
Repeati238 – 275WD 1Add BLAST38
Repeati278 – 315WD 2Add BLAST38
Repeati318 – 355WD 3Add BLAST38
Repeati361 – 398WD 4Add BLAST38
Repeati401 – 440WD 5Add BLAST40
Repeati442 – 478WD 6Add BLAST37
Repeati490 – 527WD 7Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni67 – 116Homodimerization domain DBy similarityAdd BLAST50

Domaini

The N-terminal D domain mediates homodimerization.By similarity

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0281 Eukaryota
ENOG410XTA8 LUCA
GeneTreeiENSGT00760000119106
HOGENOMiHOG000006638
HOVERGENiHBG002521
InParanoidiQ9UKB1
KOiK03362
OMAiRLISRMC
OrthoDBiEOG091G0437
PhylomeDBiQ9UKB1
TreeFamiTF105679

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR021977 Beta-TrCP_D
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF12125 Beta-TrCP_D, 1 hit
PF12937 F-box-like, 1 hit
PF00400 WD40, 7 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM01028 Beta-TrCP_D, 1 hit
SM00256 FBOX, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit
PS00678 WD_REPEATS_1, 5 hits
PS50082 WD_REPEATS_2, 7 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform C (identifier: Q9UKB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPDSVIEDK TIELMCSVPR SLWLGCANLV ESMCALSCLQ SMPSVRCLQI
60 70 80 90 100
SNGTSSVIVS RKRPSEGNYQ KEKDLCIKYF DQWSESDQVE FVEHLISRMC
110 120 130 140 150
HYQHGHINSY LKPMLQRDFI TALPEQGLDH IAENILSYLD ARSLCAAELV
160 170 180 190 200
CKEWQRVISE GMLWKKLIER MVRTDPLWKG LSERRGWDQY LFKNRPTDGP
210 220 230 240 250
PNSFYRSLYP KIIQDIETIE SNWRCGRHNL QRIQCRSENS KGVYCLQYDD
260 270 280 290 300
EKIISGLRDN SIKIWDKTSL ECLKVLTGHT GSVLCLQYDE RVIVTGSSDS
310 320 330 340 350
TVRVWDVNTG EVLNTLIHHN EAVLHLRFSN GLMVTCSKDR SIAVWDMASA
360 370 380 390 400
TDITLRRVLV GHRAAVNVVD FDDKYIVSAS GDRTIKVWST STCEFVRTLN
410 420 430 440 450
GHKRGIACLQ YRDRLVVSGS SDNTIRLWDI ECGACLRVLE GHEELVRCIR
460 470 480 490 500
FDNKRIVSGA YDGKIKVWDL QAALDPRAPA STLCLRTLVE HSGRVFRLQF
510 520 530 540
DEFQIISSSH DDTILIWDFL NVPPSAQNET RSPSRTYTYI SR
Length:542
Mass (Da):62,091
Last modified:May 1, 2000 - v1
Checksum:i7CD40087EFAA5C8A
GO
Isoform A (identifier: Q9UKB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-49: Missing.

Show »
Length:508
Mass (Da):58,422
Checksum:i05C691DB32A91B50
GO
Isoform B (identifier: Q9UKB1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-48: CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL → NTSVMEDQNEDESPKKNTLW

Show »
Length:529
Mass (Da):60,898
Checksum:i53D181B789313D0E
GO

Sequence cautioni

The sequence BAA31671 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00676516 – 49Missing in isoform A. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00676616 – 48CSVPR…SVRCL → NTSVMEDQNEDESPKKNTLW in isoform B. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176022 mRNA Translation: AAF04528.1
AB033279 mRNA Translation: BAA92329.1
AB033280 mRNA Translation: BAA92330.1
AB033281 mRNA Translation: BAA92331.1
AB014596 mRNA Translation: BAA31671.1 Different initiation.
AK314999 mRNA Translation: BAG37495.1
BC026213 mRNA Translation: AAH26213.1
CCDSiCCDS34289.1 [Q9UKB1-1]
CCDS47340.1 [Q9UKB1-2]
CCDS47341.1 [Q9UKB1-3]
RefSeqiNP_036432.2, NM_012300.2 [Q9UKB1-1]
NP_387448.2, NM_033644.2 [Q9UKB1-3]
NP_387449.2, NM_033645.2 [Q9UKB1-2]
UniGeneiHs.484138

Genome annotation databases

EnsembliENST00000265094; ENSP00000265094; ENSG00000072803 [Q9UKB1-1]
ENST00000296933; ENSP00000296933; ENSG00000072803 [Q9UKB1-3]
ENST00000393802; ENSP00000377391; ENSG00000072803 [Q9UKB1-2]
GeneIDi23291
KEGGihsa:23291
UCSCiuc003mbl.2 human [Q9UKB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFBW1B_HUMAN
AccessioniPrimary (citable) accession number: Q9UKB1
Secondary accession number(s): B2RC98
, Q9P2S8, Q9P2S9, Q9Y4C6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 2000
Last modified: May 23, 2018
This is version 183 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health