Q9UKB1 (FBW1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: F-box/WD repeat-containing protein 11 Alternative name(s): F-box and WD repeats protein beta-TrCP2 F-box/WD repeat-containing protein 1B Homologous to Slimb protein Short name=HOS | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 542 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(FBXW11) mediates the ubiquitination of phosphorylated NFKBIA, which degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. Targets phosphorylation-dependent degradation of beta-catenin. Involved in the oxidative stress-induced a ubiquitin-mediated decrease in RCAN1. Mediates the degradation of CDC25A induced by ionizing radiation in cells progressing through S phase and thus may function in the intra-S-phase checkpoint. Has an essential role in the control of the clock-dependent transcription via degradation of PER1 and phosphorylated PER2. Is target of human immunodeficiency virus type 1 (HIV-1) protein VPU to polyubiquitinate and deplete BST2 from cells and antagonize its antiviral action. Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 |
| Subunit structure | Self-associates. Component of the SCF(FBXW11) complex formed of CUL1, SKP1, RBX1 and a FBXW11 dimer. Interacts with BTRC, BST2, PER1, RCAN1 and USP47. Interacts with phosphorylated ubiquitination substrate PER2 By similarity. Interacts with phosphorylated ubiquitination substrates CTNNB1, NFKBIA, IFNAR1; the interaction requires the phosphorylation of the two serine residues in the substrates' destruction motif D-S-G-X(2,3,4)-S. Interacts with TRIM21. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 |
| Subcellular location | |
| Induction | Expression is negatively regulated by Wnt/beta-catenin pathway. Ref.13 |
| Domain | The N-terminal D domain mediates homodimerization By similarity. |
| Sequence similarities | Contains 1 F-box domain. Contains 7 WD repeats. |
| Sequence caution | The sequence BAA31671.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AXIN1 | O15169 | 4 | EBI-355189,EBI-710484 | |
| CTNNB1 | P35222 | 2 | EBI-355189,EBI-491549 | |
| MDM2 | Q00987 | 4 | EBI-355189,EBI-389668 | |
| SKP1 | P63208 | 4 | EBI-355189,EBI-307486 | |
| WEE1 | P30291 | 2 | EBI-355189,EBI-914695 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform C (identifier: Q9UKB1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q9UKB1-2) The sequence of this isoform differs from the canonical sequence as follows: 16-49: Missing. | ||||||
| Isoform B (identifier: Q9UKB1-3) The sequence of this isoform differs from the canonical sequence as follows: 16-48: CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL → NTSVMEDQNEDESPKKNTLW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 542 | 542 | F-box/WD repeat-containing protein 11 | PRO_0000050981 | |||||
Regions | |||||||||
| Domain | 129 – 167 | 39 | F-box | ||||||
| Repeat | 238 – 275 | 38 | WD 1 | ||||||
| Repeat | 278 – 315 | 38 | WD 2 | ||||||
| Repeat | 318 – 355 | 38 | WD 3 | ||||||
| Repeat | 361 – 398 | 38 | WD 4 | ||||||
| Repeat | 401 – 440 | 40 | WD 5 | ||||||
| Repeat | 442 – 478 | 37 | WD 6 | ||||||
| Repeat | 490 – 527 | 38 | WD 7 | ||||||
| Region | 67 – 116 | 50 | Homodimerization domain D By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 16 – 49 | 34 | Missing in isoform A. | VSP_006765 | |||||
| Alternative sequence | 16 – 48 | 33 | CSVPR…SVRCL → NTSVMEDQNEDESPKKNTLW in isoform B. | VSP_006766 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a family of human F-box proteins." Cenciarelli C., Chiaur D.S., Guardavaccaro D., Parks W., Vidal M., Pagano M. Curr. Biol. 9:1177-1179(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "Molecular cloning and genomic structure of the betaTRCP2 gene on chromosome 5q35.1." Koike J., Sagara N., Kirikoshi H., Takagi A., Miwa T., Hirai M., Katoh M. Biochem. Biophys. Res. Commun. 269:103-109(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Fetal lung. |
| [3] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Hippocampus. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Lymph. |
| [6] | "IkappaBalpha ubiquitination is catalyzed by an SCF-like complex containing Skp1, cullin-1, and two F-box/WD40-repeat proteins, betaTrCP1 and betaTrCP2." Suzuki H., Chiba T., Kobayashi M., Takeuchi M., Suzuki T., Ichiyama A., Ikenoue T., Omata M., Furuichi K., Tanaka K. Biochem. Biophys. Res. Commun. 256:127-132(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE SCF(FBXW11) COMPLEX. |
| [7] | "HOS, a human homolog of Slimb, forms an SCF complex with Skp1 and Cullin1 and targets the phosphorylation-dependent degradation of IkappaB and beta-catenin." Fuchs S.Y., Chen A., Xiong Y., Pan Z.Q., Ronai Z. Oncogene 18:2039-2046(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NFKBIA AND CTNNB1, FUNCTION IN UBIQUITINATION OF NFKBIA AND CTNNB1. |
| [8] | "Homodimer of two F-box proteins betaTrCP1 or betaTrCP2 binds to IkappaBalpha for signal-dependent ubiquitination." Suzuki H., Chiba T., Suzuki T., Fujita T., Ikenoue T., Omata M., Furuichi K., Shikama H., Tanaka K. J. Biol. Chem. 275:2877-2884(2000) [PubMed] [Europe PMC] [Abstract] Cited for: SELF-ASSOCIATION, INTERACTION WITH BTRC AND NFKBIA, FUNCTION IN UBIQUITINATION OF NFKBIA. |
| [9] | "SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor." Kumar K.G., Tang W., Ravindranath A.K., Clark W.A., Croze E., Fuchs S.Y. EMBO J. 22:5480-5490(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PHOSPHORYLATED IFNAR1, FUNCTION IN IFNAR1 UBIQUITINATION. |
| [10] | "A complex containing betaTrCP recruits Cdc34 to catalyse ubiquitination of IkappaBalpha." Vuillard L., Nicholson J., Hay R.T. FEBS Lett. 455:311-314(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE SCF(FBXW11) COMPLEX, INTERACTION WITH NFKBIA, FUNCTION IN UBIQUITINATION OF NFKBIA. |
| [11] | "Regulation of p27 degradation and S-phase progression by Ro52 RING finger protein." Sabile A., Meyer A.M., Wirbelauer C., Hess D., Kogel U., Scheffner M., Krek W. Mol. Cell. Biol. 26:5994-6004(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRIM21. |
| [12] | "The SCF(HOS/beta-TRCP)-ROC1 E3 ubiquitin ligase utilizes two distinct domains within CUL1 for substrate targeting and ubiquitin ligation." Wu K., Fuchs S.Y., Chen A., Tan P., Gomez C., Ronai Z., Pan Z.Q. Mol. Cell. Biol. 20:1382-1393(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION OF THE SCF(FBXW11) COMPLEX. |
| [13] | "Inhibition of HOS expression and activities by Wnt pathway." Spiegelman V.S., Tang W., Katoh M., Slaga T.J., Fuchs S.Y. Oncogene 21:856-860(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [14] | "Degradation of Cdc25A by beta-TrCP during S phase and in response to DNA damage." Busino L., Donzelli M., Chiesa M., Guardavaccaro D., Ganoth D., Dorrello N.V., Hershko A., Pagano M., Draetta G.F. Nature 426:87-91(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDC25A. |
| [15] | "SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein." Shirogane T., Jin J., Ang X.L., Harper J.W. J. Biol. Chem. 280:26863-26872(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PER1. |
| [16] | "Oxidative stress-induced ubiquitination of RCAN1 mediated by SCFbeta-TrCP ubiquitin ligase." Asada S., Ikeda A., Nagao R., Hama H., Sudo T., Fukamizu A., Kasuya Y., Kishi T. Int. J. Mol. Med. 22:95-104(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RCAN1. |
| [17] | "HIV-1 Vpu neutralizes the antiviral factor Tetherin/BST-2 by binding it and directing its beta-TrCP2-dependent degradation." Mangeat B., Gers-Huber G., Lehmann M., Zufferey M., Luban J., Piguet V. PLoS Pathog. 5:E1000574-E1000574(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BST2. |
| [18] | "Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate." Wu K., Kovacev J., Pan Z.Q. Mol. Cell 37:784-796(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION OF THE SCF(FBXW11) COMPLEX, INTERACTION WITH NFKBIA. |
| [19] | "The ubiquitin-specific protease USP47 is a novel beta-TRCP interactor regulating cell survival." Peschiaroli A., Skaar J.R., Pagano M., Melino G. Oncogene 29:1384-1393(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH USP47. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF176022 mRNA. Translation: AAF04528.1. AB033279 mRNA. Translation: BAA92329.1. AB033280 mRNA. Translation: BAA92330.1. AB033281 mRNA. Translation: BAA92331.1. AB014596 mRNA. Translation: BAA31671.1. Different initiation. AK314999 mRNA. Translation: BAG37495.1. BC026213 mRNA. Translation: AAH26213.1. |
| IPI | IPI00301283. IPI00306671. IPI00328796. |
| RefSeq | NP_036432.2. NM_012300.2. NP_387448.2. NM_033644.2. NP_387449.2. NM_033645.2. |
| UniGene | Hs.484138. |
3D structure databases | |
| ProteinModelPortal | Q9UKB1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-27593N. |
| IntAct | Q9UKB1. 30 interactions. |
| MINT | MINT-120522. |
| STRING | 9606.ENSP00000265094. |
PTM databases | |
| PhosphoSite | Q9UKB1. |
Polymorphism databases | |
| DMDM | 13124267. |
Proteomic databases | |
| PaxDb | Q9UKB1. |
| PRIDE | Q9UKB1. |
Protocols and materials databases | |
| DNASU | 23291. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265094; ENSP00000265094; ENSG00000072803. ENST00000296933; ENSP00000296933; ENSG00000072803. ENST00000393802; ENSP00000377391; ENSG00000072803. |
| GeneID | 23291. |
| KEGG | hsa:23291. |
| UCSC | uc003mbl.1. human. uc003mbm.1. human. uc003mbn.1. human. |
Organism-specific databases | |
| CTD | 23291. |
| GeneCards | GC05M171288. |
| HGNC | HGNC:13607. FBXW11. |
| MIM | 605651. gene. |
| neXtProt | NX_Q9UKB1. |
| PharmGKB | PA28050. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2319. |
| HOGENOM | HOG000006638. |
| HOVERGEN | HBG002521. |
| InParanoid | Q9UKB1. |
| KO | K03362. |
| OMA | FDQWSEA. |
| OrthoDB | EOG4F1X2M. |
| PhylomeDB | Q9UKB1. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | nfkappabalternativepathway. Alternative NF-kappaB pathway. nfkappabatypicalpathway. Atypical NF-kappaB pathway. nfkappabcanonicalpathway. Canonical NF-kappaB pathway. wnt_canonical_pathway. Canonical Wnt signaling pathway. hedgehog_glipathway. Hedgehog signaling events mediated by Gli proteins. ps1pathway. Presenilin action in Notch and Wnt signaling. hdac_classi_pathway. Signaling events mediated by HDAC Class I. |
| Reactome | REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q9UKB1. |
| Bgee | Q9UKB1. |
| CleanEx | HS_FBXW11. |
| Genevestigator | Q9UKB1. |
| GermOnline | ENSG00000072803. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 2 hits. |
| InterPro | IPR021977. Beta-TrCP_D. IPR001810. F-box_dom_cyclin-like. IPR020472. G-protein_beta_WD-40_rep. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF12125. Beta-TrCP_D. 1 hit. PF00400. WD40. 7 hits. [Graphical view] |
| PRINTS | PR00320. GPROTEINBRPT. |
| SMART | SM01028. Beta-TrCP_D. 1 hit. SM00256. FBOX. 1 hit. SM00320. WD40. 7 hits. [Graphical view] |
| SUPFAM | SSF81383. F-box_dom_Skp2-like. 1 hit. SSF50978. WD40_like. 1 hit. |
| PROSITE | PS50181. FBOX. 1 hit. PS00678. WD_REPEATS_1. 5 hits. PS50082. WD_REPEATS_2. 7 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23291. |
| NextBio | 45108. |
| SOURCE | Search... |
Entry information
| Entry name | FBW1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UKB1 Secondary accession number(s): B2RC98 Q9Y4C6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
