Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 222

Gene

ZNF222

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri145 – 167C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri173 – 195C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri201 – 223C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri229 – 251C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri257 – 279C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 6; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 335C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri341 – 363C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri369 – 391C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri397 – 419C2H2-type 10; degeneratePROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000159885-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 222
Gene namesi
Name:ZNF222
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:13015. ZNF222.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000159885.
PharmGKBiPA37594.

Polymorphism and mutation databases

BioMutaiZNF222.
DMDMi116242857.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000474631 – 451Zinc finger protein 222Add BLAST451

Proteomic databases

PeptideAtlasiQ9UK12.
PRIDEiQ9UK12.

PTM databases

iPTMnetiQ9UK12.
PhosphoSitePlusiQ9UK12.

Expressioni

Gene expression databases

BgeeiENSG00000159885.
CleanExiHS_ZNF222.
ExpressionAtlasiQ9UK12. baseline and differential.
GenevisibleiQ9UK12. HS.

Organism-specific databases

HPAiHPA004086.

Structurei

3D structure databases

ProteinModelPortaliQ9UK12.
SMRiQ9UK12.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 85KRABPROSITE-ProRule annotationAdd BLAST78

Sequence similaritiesi

Contains 10 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri145 – 167C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri173 – 195C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri201 – 223C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri229 – 251C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri257 – 279C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 6; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 335C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri341 – 363C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri369 – 391C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri397 – 419C2H2-type 10; degeneratePROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00840000129740.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9UK12.
KOiK09228.
OMAiCKLHMRE.
OrthoDBiEOG091G02KC.
PhylomeDBiQ9UK12.
TreeFamiTF341885.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 11 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 8 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 10 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UK12-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKLYEAVTF KDVAVIFTEE ELGLLDPAQR KLYRDVMLEN FRNLLSVGGK
60 70 80 90 100
IQTEMETVPE AGTHEEFSCK QIWEQIASDL TRSQDTTISN SQLFEQDDNP
110 120 130 140 150
SQIKARLSTV HTREKPFQGE NCKQFFSDVS FFDLPQQLYS GEKSHTCDEC
160 170 180 190 200
GKSFCYISAL HIHQRVHMGV KCYKCDVCGK EFSQSSRLQT HQRVHTGEKP
210 220 230 240 250
FKCEQCGKGF RCRSALKVHC KLHMREKPYN CEKCGKAFMH NFQLQKHHRI
260 270 280 290 300
HTGEKPFKCE ICGKSFCLRS SLNRHCMVHT AEKLYKSEKY GRGFIDRLDL
310 320 330 340 350
HKHQMIHMGQ KPYNCKECGK SFKWSSYLLV HQRVHTGEKP YKCEECGKGY
360 370 380 390 400
ISKSGLDFHH RTHTGERSYN CDNCGKSFRH ASSILNHKKL HCQRKPLKCE
410 420 430 440 450
DCGKRLVCRS YCKDQQRDHS GENPSKCEDC GKRYKRRLNL DIILSLFLND

I
Length:451
Mass (Da):52,484
Last modified:October 17, 2006 - v2
Checksum:iA54C0DC566138098
GO
Isoform 2 (identifier: Q9UK12-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MAKLY → MIDSGEKKPGRRAE
     47-47: V → VGHQPFHGDTFHFLREEKFWVMGTTSQREGNL

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):57,105
Checksum:iF686CA63BCC25C00
GO

Sequence cautioni

The sequence AAH30261 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05279650K → E.Corresponds to variant rs11880330dbSNPEnsembl.1
Natural variantiVAR_05279758V → F.1 PublicationCorresponds to variant rs7258517dbSNPEnsembl.1
Natural variantiVAR_06194082R → G.Corresponds to variant rs59926292dbSNPEnsembl.1
Natural variantiVAR_052798263G → D.Corresponds to variant rs8112679dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0469511 – 5MAKLY → MIDSGEKKPGRRAE in isoform 2. 1 Publication5
Alternative sequenceiVSP_04695247V → VGHQPFHGDTFHFLREEKFW VMGTTSQREGNL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF187988 mRNA. Translation: AAF04104.1.
AC067968 Genomic DNA. Translation: AAF66075.1.
CH471126 Genomic DNA. Translation: EAW57242.1.
BC030261 mRNA. Translation: AAH30261.1. Different initiation.
CCDSiCCDS33045.1. [Q9UK12-1]
CCDS46098.1. [Q9UK12-2]
PIRiB42177.
RefSeqiNP_001123468.1. NM_001129996.1. [Q9UK12-2]
NP_037492.2. NM_013360.2. [Q9UK12-1]
UniGeneiHs.279840.

Genome annotation databases

EnsembliENST00000187879; ENSP00000187879; ENSG00000159885. [Q9UK12-1]
ENST00000391960; ENSP00000375822; ENSG00000159885. [Q9UK12-2]
GeneIDi7673.
KEGGihsa:7673.
UCSCiuc002oyc.4. human. [Q9UK12-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF187988 mRNA. Translation: AAF04104.1.
AC067968 Genomic DNA. Translation: AAF66075.1.
CH471126 Genomic DNA. Translation: EAW57242.1.
BC030261 mRNA. Translation: AAH30261.1. Different initiation.
CCDSiCCDS33045.1. [Q9UK12-1]
CCDS46098.1. [Q9UK12-2]
PIRiB42177.
RefSeqiNP_001123468.1. NM_001129996.1. [Q9UK12-2]
NP_037492.2. NM_013360.2. [Q9UK12-1]
UniGeneiHs.279840.

3D structure databases

ProteinModelPortaliQ9UK12.
SMRiQ9UK12.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ9UK12.
PhosphoSitePlusiQ9UK12.

Polymorphism and mutation databases

BioMutaiZNF222.
DMDMi116242857.

Proteomic databases

PeptideAtlasiQ9UK12.
PRIDEiQ9UK12.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000187879; ENSP00000187879; ENSG00000159885. [Q9UK12-1]
ENST00000391960; ENSP00000375822; ENSG00000159885. [Q9UK12-2]
GeneIDi7673.
KEGGihsa:7673.
UCSCiuc002oyc.4. human. [Q9UK12-1]

Organism-specific databases

CTDi7673.
GeneCardsiZNF222.
HGNCiHGNC:13015. ZNF222.
HPAiHPA004086.
neXtProtiNX_Q9UK12.
OpenTargetsiENSG00000159885.
PharmGKBiPA37594.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00840000129740.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9UK12.
KOiK09228.
OMAiCKLHMRE.
OrthoDBiEOG091G02KC.
PhylomeDBiQ9UK12.
TreeFamiTF341885.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000159885-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii7673.
PROiQ9UK12.

Gene expression databases

BgeeiENSG00000159885.
CleanExiHS_ZNF222.
ExpressionAtlasiQ9UK12. baseline and differential.
GenevisibleiQ9UK12. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 11 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 8 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 10 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN222_HUMAN
AccessioniPrimary (citable) accession number: Q9UK12
Secondary accession number(s): G5E9B9, Q8N6G7, Q9P1U5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.