Q9UJX3 (APC7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Anaphase-promoting complex subunit 7 Short name=APC7 Alternative name(s): Cyclosome subunit 7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 599 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Ref.4 |
| Pathway | |
| Subunit structure | Homodimer. The APC/C is composed of at least 12 subunits. Ref.1 Ref.7 |
| Sequence similarities | Belongs to the APC7 family. Contains 7 TPR repeats. |
| Caution | It is uncertain whether Met-1 or Met-35 is the initiator. |
| Sequence caution | The sequence AAH17316.2 differs from that shown. Reason: Erroneous translation. Wrong choice of frame. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UJX3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UJX3-2) The sequence of this isoform differs from the canonical sequence as follows: 537-599: SLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ → R |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 599 | 599 | Anaphase-promoting complex subunit 7 | PRO_0000106261 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Repeat | 77 – 110 | 34 | TPR 1 | ||||||||||||||||||||||
| Repeat | 169 – 202 | 34 | TPR 2 | ||||||||||||||||||||||
| Repeat | 271 – 304 | 34 | TPR 3 | ||||||||||||||||||||||
| Repeat | 373 – 406 | 34 | TPR 4 | ||||||||||||||||||||||
| Repeat | 441 – 475 | 35 | TPR 5 | ||||||||||||||||||||||
| Repeat | 476 – 508 | 33 | TPR 6 | ||||||||||||||||||||||
| Repeat | 509 – 542 | 34 | TPR 7 | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 537 – 599 | 63 | SLDPN…WFGMQ → R in isoform 2. | VSP_039043 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 56 | 1 | L → R: Loss of homodimerization; when associated with K-60. Ref.7 | ||||||||||||||||||||||
| Mutagenesis | 60 | 1 | L → K: Loss of homodimerization; when associated with R-56. Ref.7 | ||||||||||||||||||||||
| Sequence conflict | 184 | 1 | Q → R in AAF05754. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 302 | 1 | P → L in AAF05754. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 537 | 1 | S → R in CAB70828. Ref.3 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 37 – 46 | 10 | |||||||||||||||||||||||
| Helix | 50 – 66 | 17 | |||||||||||||||||||||||
| Helix | 73 – 89 | 17 | |||||||||||||||||||||||
| Helix | 93 – 108 | 16 | |||||||||||||||||||||||
| Helix | 135 – 148 | 14 | |||||||||||||||||||||||
| Helix | 152 – 159 | 8 | |||||||||||||||||||||||
| Helix | 164 – 166 | 3 | |||||||||||||||||||||||
| Helix | 169 – 178 | 10 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a cullin homology region in a subunit of the anaphase-promoting complex." Yu H., Peters J.-M., King R.W., Page A.M., Hieter P., Kirschner M.W. Science 279:1219-1222(1998) [PubMed: 9469815] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 34-599 (ISOFORM 1), SUBUNIT. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 144-599 (ISOFORM 1). Tissue: Ovary and Skin. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 316-599 (ISOFORM 2). Tissue: Testis. |
| [4] | "Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex." Jin L., Williamson A., Banerjee S., Philipp I., Rape M. Cell 133:653-665(2008) [PubMed: 18485873] [Abstract] Cited for: FUNCTION OF THE APC/C. |
| [5] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [6] | "Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C." Dube P., Herzog F., Gieffers C., Sander B., Riedel D., Mueller S.A., Engel A., Peters J.-M., Stark H. Mol. Cell 20:867-879(2005) [PubMed: 16364912] [Abstract] Cited for: ELECTRON MICROSCOPY OF THE APC/C. |
| [7] | "Crystal structure of the N-terminal domain of anaphase-promoting complex subunit 7." Han D., Kim K., Kim Y., Kang Y., Lee J.Y., Kim Y. J. Biol. Chem. 284:15137-15146(2009) [PubMed: 19091741] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 35-181, HOMODIMERIZATION, MUTAGENESIS OF LEU-56 AND LEU-60. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF191340 mRNA. Translation: AAF05754.1. BC002941 mRNA. Translation: AAH02941.2. BC009498 mRNA. Translation: AAH09498.2. BC017316 mRNA. Translation: AAH17316.2. Sequence problems. AL137586 mRNA. Translation: CAB70828.1. | ||||||||||||
| IPI | IPI00008248. IPI00915282. | ||||||||||||
| PIR | T46297. | ||||||||||||
| RefSeq | NP_001131136.1. NM_001137664.1. NP_057322.2. NM_016238.2. | ||||||||||||
| UniGene | Hs.719935. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UJX3. | ||||||||||||
| SMR | Q9UJX3. Positions 35-180, 244-558. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-39765N. | ||||||||||||
| IntAct | Q9UJX3. 20 interactions. | ||||||||||||
| STRING | Q9UJX3. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UJX3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 294862527. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | Q9UJX3. | ||||||||||||
| PRIDE | Q9UJX3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000354390; ENSP00000346363; ENSG00000196510. ENST00000455511; ENSP00000394394; ENSG00000196510. | ||||||||||||
| GeneID | 51434. | ||||||||||||
| KEGG | hsa:51434. | ||||||||||||
| NMPDR | fig|9606.3.peg.8242. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 51434. | ||||||||||||
| GeneCards | GC12M110810. | ||||||||||||
| H-InvDB | HIX0019976. | ||||||||||||
| HGNC | HGNC:17380. ANAPC7. | ||||||||||||
| HPA | CAB009567. | ||||||||||||
| MIM | 606949. gene. | ||||||||||||
| neXtProt | NX_Q9UJX3. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000005482. | ||||||||||||
| HOGENOM | HBG505401. | ||||||||||||
| HOVERGEN | HBG050529. | ||||||||||||
| InParanoid | Q9UJX3. | ||||||||||||
| OMA | QSIPNLD. | ||||||||||||
| OrthoDB | EOG4FR0RB. | ||||||||||||
| PhylomeDB | Q9UJX3. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. REACT_1538. Cell Cycle Checkpoints. REACT_6850. Cdc20:Phospho-APC/C mediated degradation of Cyclin A. REACT_6900. Immune System. REACT_8017. APC-Cdc20 mediated degradation of Nek2A. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UJX3. | ||||||||||||
| Bgee | Q9UJX3. | ||||||||||||
| CleanEx | HS_ANAPC7. | ||||||||||||
| Genevestigator | Q9UJX3. | ||||||||||||
| GermOnline | ENSG00000196510. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013026. TPR-contain. IPR011990. TPR-like_helical. IPR013105. TPR_2. IPR019734. TPR_repeat. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.25.40.10. TPR-like_helical. 3 hits. | ||||||||||||
| KO | K03354. | ||||||||||||
| Pfam | PF07719. TPR_2. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00028. TPR. 4 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50005. TPR. 5 hits. PS50293. TPR_REGION. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 55005. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | APC7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UJX3 Secondary accession number(s): Q96AC4 Q9NT16 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with