Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UJU2

- LEF1_HUMAN

UniProt

Q9UJU2 - LEF1_HUMAN

Protein

Lymphoid enhancer-binding factor 1

Gene

LEF1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Participates in the Wnt signaling pathway. Activates transcription of target genes in the presence of CTNNB1 and EP300. May play a role in hair cell differentiation and follicle morphogenesis. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Regulates T-cell receptor alpha enhancer function. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 By similarity. Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.By similarity3 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi299 – 36769HMG boxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. armadillo repeat domain binding Source: BHF-UCL
    2. beta-catenin binding Source: UniProtKB
    3. C2H2 zinc finger domain binding Source: UniProtKB
    4. chromatin binding Source: RefGenome
    5. cysteine-type endopeptidase inhibitor activity involved in apoptotic process Source: UniProtKB
    6. DNA binding Source: UniProtKB
    7. DNA binding, bending Source: UniProtKB
    8. enhancer binding Source: UniProtKB
    9. estrogen receptor activity Source: UniProtKB
    10. estrogen receptor binding Source: UniProtKB
    11. gamma-catenin binding Source: BHF-UCL
    12. histone binding Source: UniProtKB
    13. protein binding Source: UniProtKB
    14. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: RefGenome
    15. RNA polymerase II regulatory region sequence-specific DNA binding Source: BHF-UCL
    16. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
    17. sequence-specific DNA binding Source: UniProtKB
    18. sequence-specific DNA binding transcription factor activity Source: BHF-UCL
    19. transcription regulatory region DNA binding Source: UniProtKB

    GO - Biological processi

    1. alpha-beta T cell differentiation Source: RefGenome
    2. anatomical structure regression Source: Ensembl
    3. apoptotic process involved in morphogenesis Source: RefGenome
    4. apoptotic process involved in patterning of blood vessels Source: Ensembl
    5. B cell proliferation Source: RefGenome
    6. BMP signaling pathway Source: RefGenome
    7. canonical Wnt signaling pathway Source: UniProtKB
    8. cell chemotaxis Source: UniProtKB
    9. cellular response to cytokine stimulus Source: BHF-UCL
    10. cellular response to interleukin-4 Source: UniProtKB
    11. chorio-allantoic fusion Source: RefGenome
    12. dentate gyrus development Source: RefGenome
    13. embryonic limb morphogenesis Source: RefGenome
    14. epithelial to mesenchymal transition Source: BHF-UCL
    15. eye pigmentation Source: RefGenome
    16. face morphogenesis Source: RefGenome
    17. forebrain neuroblast division Source: RefGenome
    18. forebrain neuron differentiation Source: RefGenome
    19. forebrain radial glial cell differentiation Source: RefGenome
    20. formation of radial glial scaffolds Source: RefGenome
    21. histone H3 acetylation Source: UniProtKB
    22. histone H4 acetylation Source: UniProtKB
    23. hypothalamus development Source: RefGenome
    24. mammary gland development Source: RefGenome
    25. muscle fiber development Source: RefGenome
    26. negative regulation of apoptotic process Source: UniProtKB
    27. negative regulation of apoptotic process in bone marrow Source: UniProtKB
    28. negative regulation of canonical Wnt signaling pathway Source: UniProtKB
    29. negative regulation of cell-cell adhesion Source: UniProtKB
    30. negative regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
    31. negative regulation of DNA binding Source: UniProtKB
    32. negative regulation of estrogen receptor binding Source: UniProtKB
    33. negative regulation of interleukin-13 production Source: UniProtKB
    34. negative regulation of interleukin-4 production Source: UniProtKB
    35. negative regulation of interleukin-5 production Source: UniProtKB
    36. negative regulation of striated muscle tissue development Source: Ensembl
    37. negative regulation of transcription, DNA-templated Source: UniProtKB
    38. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    39. neural crest cell migration Source: RefGenome
    40. neutrophil differentiation Source: UniProtKB
    41. odontoblast differentiation Source: RefGenome
    42. odontogenesis of dentin-containing tooth Source: Ensembl
    43. osteoblast differentiation Source: UniProtKB
    44. palate development Source: BHF-UCL
    45. paraxial mesoderm formation Source: RefGenome
    46. patterning of blood vessels Source: RefGenome
    47. positive regulation by host of viral transcription Source: UniProtKB
    48. positive regulation of cell-cell adhesion Source: UniProtKB
    49. positive regulation of cell cycle process Source: UniProtKB
    50. positive regulation of cell growth Source: UniProtKB
    51. positive regulation of cell migration Source: UniProtKB
    52. positive regulation of cell proliferation Source: UniProtKB
    53. positive regulation of cell proliferation in bone marrow Source: UniProtKB
    54. positive regulation of epithelial to mesenchymal transition Source: UniProtKB
    55. positive regulation of gene expression Source: AgBase
    56. positive regulation of granulocyte differentiation Source: UniProtKB
    57. positive regulation of transcription, DNA-templated Source: UniProtKB
    58. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    59. regulation of cell-cell adhesion Source: Ensembl
    60. regulation of striated muscle tissue development Source: RefGenome
    61. sensory perception of taste Source: Ensembl
    62. somitogenesis Source: RefGenome
    63. sprouting angiogenesis Source: RefGenome
    64. steroid hormone mediated signaling pathway Source: GOC
    65. T cell receptor V(D)J recombination Source: Ensembl
    66. T-helper 1 cell differentiation Source: UniProtKB
    67. tongue development Source: Ensembl
    68. trachea gland development Source: RefGenome
    69. transcription from RNA polymerase II promoter Source: BHF-UCL
    70. Wnt signaling pathway Source: BHF-UCL

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation, Wnt signaling pathway

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_172761. Ca2+ pathway.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    REACT_200799. binding of TCF/LEF:CTNNB1 to target gene promoters.
    SignaLinkiQ9UJU2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Lymphoid enhancer-binding factor 1
    Short name:
    LEF-1
    Alternative name(s):
    T cell-specific transcription factor 1-alpha
    Short name:
    TCF1-alpha
    Gene namesi
    Name:LEF1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:6551. LEF1.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation
    Note: Found in nuclear bodies upon PIASG binding.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. nucleoplasm Source: Reactome
    3. nucleus Source: UniProtKB
    4. protein-DNA complex Source: BHF-UCL
    5. transcription factor complex Source: BHF-UCL

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi155 – 1551T → A: Reduced phosphorylation by NLK; when associated with A-166. 1 Publication
    Mutagenesisi166 – 1661S → A: Reduced phosphorylation by NLK; when associated with A-155. 1 Publication

    Organism-specific databases

    PharmGKBiPA30331.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 399399Lymphoid enhancer-binding factor 1PRO_0000048595Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki27 – 27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
    Modified residuei132 – 1321Phosphoserine1 Publication
    Modified residuei155 – 1551Phosphothreonine; by NLK1 Publication
    Modified residuei166 – 1661Phosphoserine; by NLK1 Publication
    Cross-linki269 – 269Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity

    Post-translational modificationi

    Phosphorylated at Thr-155 and/or Ser-166 by NLK. Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway.2 Publications

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9UJU2.
    PaxDbiQ9UJU2.
    PRIDEiQ9UJU2.

    PTM databases

    PhosphoSiteiQ9UJU2.

    Expressioni

    Tissue specificityi

    Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are detected in several pancreatic cell lines.1 Publication

    Gene expression databases

    ArrayExpressiQ9UJU2.
    BgeeiQ9UJU2.
    CleanExiHS_LEF1.
    GenevestigatoriQ9UJU2.

    Organism-specific databases

    HPAiCAB019405.
    HPA002087.

    Interactioni

    Subunit structurei

    Binds the armadillo repeat of CTNNB1 and forms a stable complex. Interacts with EP300, TLE1 and PIASG By similarity. Binds ALYREF/THOC4, MDFI and MDFIC. Interacts with NLK.By similarity5 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CTNNB1P352225EBI-926131,EBI-491549
    IGF1RP080695EBI-926131,EBI-475981

    Protein-protein interaction databases

    BioGridi119354. 34 interactions.
    DIPiDIP-29946N.
    IntActiQ9UJU2. 8 interactions.
    MINTiMINT-8329835.
    STRINGi9606.ENSP00000265165.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UJU2.
    SMRiQ9UJU2. Positions 13-62, 298-373.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 6262CTNNB1-bindingBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi6 – 138Poly-Gly
    Compositional biasi14 – 5239Asp/Glu-rich (acidic)Add
    BLAST
    Compositional biasi77 – 273197Pro-richAdd
    BLAST
    Compositional biasi374 – 3796Poly-Lys

    Domaini

    Proline-rich and acidic regions are implicated in the activation functions of RNA polymerase II transcription factors.

    Sequence similaritiesi

    Belongs to the TCF/LEF family.Curated
    Contains 1 HMG box DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG299161.
    HOGENOMiHOG000116032.
    HOVERGENiHBG000419.
    InParanoidiQ9UJU2.
    KOiK04492.
    OMAiGYSGYIM.
    OrthoDBiEOG7QNVMG.
    PhylomeDBiQ9UJU2.
    TreeFamiTF318448.

    Family and domain databases

    Gene3Di1.10.30.10. 1 hit.
    4.10.900.10. 1 hit.
    InterProiIPR027397. Catenin_binding_dom.
    IPR013558. CTNNB1-bd_N.
    IPR009071. HMG_box_dom.
    IPR028769. LEF1.
    IPR024940. TCF/LEF.
    [Graphical view]
    PANTHERiPTHR10373. PTHR10373. 1 hit.
    PTHR10373:SF11. PTHR10373:SF11. 1 hit.
    PfamiPF08347. CTNNB1_binding. 1 hit.
    PF00505. HMG_box. 1 hit.
    [Graphical view]
    SMARTiSM00398. HMG. 1 hit.
    [Graphical view]
    SUPFAMiSSF47095. SSF47095. 1 hit.
    PROSITEiPS50118. HMG_BOX_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9UJU2-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPQLSGGGGG GGGDPELCAT DEMIPFKDEG DPQKEKIFAE ISHPEEEGDL    50
    ADIKSSLVNE SEIIPASNGH EVARQAQTSQ EPYHDKAREH PDDGKHPDGG 100
    LYNKGPSYSS YSGYIMMPNM NNDPYMSNGS LSPPIPRTSN KVPVVQPSHA 150
    VHPLTPLITY SDEHFSPGSH PSHIPSDVNS KQGMSRHPPA PDIPTFYPLS 200
    PGGVGQITPP LGWQGQPVYP ITGGFRQPYP SSLSVDTSMS RFSHHMIPGP 250
    PGPHTTGIPH PAIVTPQVKQ EHPHTDSDLM HVKPQHEQRK EQEPKRPHIK 300
    KPLNAFMLYM KEMRANVVAE CTLKESAAIN QILGRRWHAL SREEQAKYYE 350
    LARKERQLHM QLYPGWSARD NYGKKKKRKR EKLQESASGT GPRMTAAYI 399

    Note: Produced by alternative promoter usage.

    Length:399
    Mass (Da):44,201
    Last modified:May 1, 2000 - v1
    Checksum:iD480D440698EEFE3
    GO
    Isoform 2 (identifier: Q9UJU2-2) [UniParc]FASTAAdd to Basket

    Also known as: B, 8A

    The sequence of this isoform differs from the canonical sequence as follows:
         283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL

    Note: Produced by alternative splicing of isoform 1. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:329
    Mass (Da):35,672
    Checksum:i3632325D440CA5DD
    GO
    Isoform 3 (identifier: Q9UJU2-3) [UniParc]FASTAAdd to Basket

    Also known as: LEF-1-DN

    The sequence of this isoform differs from the canonical sequence as follows:
         1-115: Missing.

    Note: Produced by alternative promoter usage. Acts as dominant negative mutant.

    Show »
    Length:284
    Mass (Da):31,919
    Checksum:i22320A1A195401ED
    GO
    Isoform 4 (identifier: Q9UJU2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-115: Missing.
         283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL

    Note: Produced by alternative splicing of isoform 3.

    Show »
    Length:214
    Mass (Da):23,390
    Checksum:iDDBF9358A5E8944C
    GO
    Isoform 5 (identifier: Q9UJU2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         214-241: Missing.

    Note: Produced by alternative splicing of isoform 1.

    Show »
    Length:371
    Mass (Da):41,162
    Checksum:iF929C8679F4EC1A3
    GO
    Isoform 6 (identifier: Q9UJU2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         214-241: Missing.
         390-399: TGPRMTAAYI → GKRSSFPTCKAKAATPGPLLEMEAC

    Note: Produced by alternative splicing of isoform 1. No experimental confirmation available.

    Show »
    Length:386
    Mass (Da):42,676
    Checksum:i918B4201D718A485
    GO
    Isoform 7 (identifier: Q9UJU2-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH → MA
         214-241: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:303
    Mass (Da):34,103
    Checksum:i38F7331074A62A79
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti146 – 1461Q → R in BAH13928. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti113 – 1131G → R in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_035935

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 115115Missing in isoform 3 and isoform 4. 1 PublicationVSP_007022Add
    BLAST
    Alternative sequencei1 – 7070MPQLS…ASNGH → MA in isoform 7. 1 PublicationVSP_044877Add
    BLAST
    Alternative sequencei214 – 24128Missing in isoform 5, isoform 6 and isoform 7. 3 PublicationsVSP_040068Add
    BLAST
    Alternative sequencei283 – 399117KPQHE…TAAYI → CSAFLLPHPFLIPSTPSPNH HHHHLLGSLSMNRERSRSQK DLTLRSL in isoform 2 and isoform 4. 1 PublicationVSP_002188Add
    BLAST
    Alternative sequencei390 – 39910TGPRMTAAYI → GKRSSFPTCKAKAATPGPLL EMEAC in isoform 6. 1 PublicationVSP_040069

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF288571 mRNA. Translation: AAG01022.1.
    AF198532 mRNA. Translation: AAF13268.1.
    AF294627 mRNA. Translation: AAG26886.1.
    AK294395 mRNA. Translation: BAG57649.1.
    AK303272 mRNA. Translation: BAH13928.1.
    AC092539 Genomic DNA. No translation available.
    AC097067 Genomic DNA. No translation available.
    AC118062 Genomic DNA. No translation available.
    AC123576 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06223.1.
    CH471057 Genomic DNA. Translation: EAX06225.1.
    BC040559 mRNA. Translation: AAH40559.1.
    BC050632 mRNA. Translation: AAH50632.1.
    CCDSiCCDS3679.1. [Q9UJU2-1]
    CCDS47122.1. [Q9UJU2-6]
    CCDS47123.1. [Q9UJU2-5]
    CCDS54791.1. [Q9UJU2-7]
    PIRiA39625.
    RefSeqiNP_001124185.1. NM_001130713.2. [Q9UJU2-5]
    NP_001124186.1. NM_001130714.2. [Q9UJU2-6]
    NP_001159591.1. NM_001166119.1. [Q9UJU2-7]
    NP_057353.1. NM_016269.4. [Q9UJU2-1]
    UniGeneiHs.743478.

    Genome annotation databases

    EnsembliENST00000265165; ENSP00000265165; ENSG00000138795. [Q9UJU2-1]
    ENST00000379951; ENSP00000369284; ENSG00000138795. [Q9UJU2-6]
    ENST00000438313; ENSP00000406176; ENSG00000138795. [Q9UJU2-5]
    ENST00000506680; ENSP00000422334; ENSG00000138795. [Q9UJU2-2]
    ENST00000510624; ENSP00000422840; ENSG00000138795. [Q9UJU2-7]
    GeneIDi51176.
    KEGGihsa:51176.
    UCSCiuc003hyt.2. human. [Q9UJU2-1]
    uc003hyu.2. human. [Q9UJU2-5]
    uc003hyv.2. human. [Q9UJU2-6]

    Polymorphism databases

    DMDMi8928194.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF288571 mRNA. Translation: AAG01022.1 .
    AF198532 mRNA. Translation: AAF13268.1 .
    AF294627 mRNA. Translation: AAG26886.1 .
    AK294395 mRNA. Translation: BAG57649.1 .
    AK303272 mRNA. Translation: BAH13928.1 .
    AC092539 Genomic DNA. No translation available.
    AC097067 Genomic DNA. No translation available.
    AC118062 Genomic DNA. No translation available.
    AC123576 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06223.1 .
    CH471057 Genomic DNA. Translation: EAX06225.1 .
    BC040559 mRNA. Translation: AAH40559.1 .
    BC050632 mRNA. Translation: AAH50632.1 .
    CCDSi CCDS3679.1. [Q9UJU2-1 ]
    CCDS47122.1. [Q9UJU2-6 ]
    CCDS47123.1. [Q9UJU2-5 ]
    CCDS54791.1. [Q9UJU2-7 ]
    PIRi A39625.
    RefSeqi NP_001124185.1. NM_001130713.2. [Q9UJU2-5 ]
    NP_001124186.1. NM_001130714.2. [Q9UJU2-6 ]
    NP_001159591.1. NM_001166119.1. [Q9UJU2-7 ]
    NP_057353.1. NM_016269.4. [Q9UJU2-1 ]
    UniGenei Hs.743478.

    3D structure databases

    ProteinModelPortali Q9UJU2.
    SMRi Q9UJU2. Positions 13-62, 298-373.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119354. 34 interactions.
    DIPi DIP-29946N.
    IntActi Q9UJU2. 8 interactions.
    MINTi MINT-8329835.
    STRINGi 9606.ENSP00000265165.

    PTM databases

    PhosphoSitei Q9UJU2.

    Polymorphism databases

    DMDMi 8928194.

    Proteomic databases

    MaxQBi Q9UJU2.
    PaxDbi Q9UJU2.
    PRIDEi Q9UJU2.

    Protocols and materials databases

    DNASUi 51176.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265165 ; ENSP00000265165 ; ENSG00000138795 . [Q9UJU2-1 ]
    ENST00000379951 ; ENSP00000369284 ; ENSG00000138795 . [Q9UJU2-6 ]
    ENST00000438313 ; ENSP00000406176 ; ENSG00000138795 . [Q9UJU2-5 ]
    ENST00000506680 ; ENSP00000422334 ; ENSG00000138795 . [Q9UJU2-2 ]
    ENST00000510624 ; ENSP00000422840 ; ENSG00000138795 . [Q9UJU2-7 ]
    GeneIDi 51176.
    KEGGi hsa:51176.
    UCSCi uc003hyt.2. human. [Q9UJU2-1 ]
    uc003hyu.2. human. [Q9UJU2-5 ]
    uc003hyv.2. human. [Q9UJU2-6 ]

    Organism-specific databases

    CTDi 51176.
    GeneCardsi GC04M108968.
    HGNCi HGNC:6551. LEF1.
    HPAi CAB019405.
    HPA002087.
    MIMi 153245. gene.
    neXtProti NX_Q9UJU2.
    PharmGKBi PA30331.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG299161.
    HOGENOMi HOG000116032.
    HOVERGENi HBG000419.
    InParanoidi Q9UJU2.
    KOi K04492.
    OMAi GYSGYIM.
    OrthoDBi EOG7QNVMG.
    PhylomeDBi Q9UJU2.
    TreeFami TF318448.

    Enzyme and pathway databases

    Reactomei REACT_172761. Ca2+ pathway.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    REACT_200799. binding of TCF/LEF:CTNNB1 to target gene promoters.
    SignaLinki Q9UJU2.

    Miscellaneous databases

    ChiTaRSi LEF1. human.
    GeneWikii Lymphoid_enhancer-binding_factor_1.
    GenomeRNAii 51176.
    NextBioi 54133.
    PROi Q9UJU2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UJU2.
    Bgeei Q9UJU2.
    CleanExi HS_LEF1.
    Genevestigatori Q9UJU2.

    Family and domain databases

    Gene3Di 1.10.30.10. 1 hit.
    4.10.900.10. 1 hit.
    InterProi IPR027397. Catenin_binding_dom.
    IPR013558. CTNNB1-bd_N.
    IPR009071. HMG_box_dom.
    IPR028769. LEF1.
    IPR024940. TCF/LEF.
    [Graphical view ]
    PANTHERi PTHR10373. PTHR10373. 1 hit.
    PTHR10373:SF11. PTHR10373:SF11. 1 hit.
    Pfami PF08347. CTNNB1_binding. 1 hit.
    PF00505. HMG_box. 1 hit.
    [Graphical view ]
    SMARTi SM00398. HMG. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47095. SSF47095. 1 hit.
    PROSITEi PS50118. HMG_BOX_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A thymus-specific member of the HMG protein family regulates the human T cell receptor C alpha enhancer."
      Waterman M.L., Fischer W.H., Jones K.A.
      Genes Dev. 5:656-669(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, FUNCTION.
    2. "The human LEF-1 gene contains a promoter preferentially active in lymphocytes and encodes multiple isoforms derived from alternative splicing."
      Hovanes K., Li T.W., Waterman M.L.
      Nucleic Acids Res. 28:1994-2003(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    3. "Lef-1 isoforms regulate different target genes and reduce cellular adhesion."
      Jesse S., Koenig A., Ellenrieder V., Menke A.
      Int. J. Cancer 126:1109-1120(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
    4. "New transcript isoform of the human LEF-1 devoid of HMG domain, derived from alternative splicing of exon 8."
      Kobielak A., Kobielak K., Trzeciak W.H.
      Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 7).
      Tissue: Amygdala and Thymus.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6).
      Tissue: Skin and Testis.
    9. "ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function."
      Bruhn L., Munnerlyn A., Grosschedl R.
      Genes Dev. 11:640-653(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ALYREF/THOC4.
    10. "Two members of the Tcf family implicated in Wnt/b-catenin signaling during embryogenesis in the mouse."
      Korinek V., Barker N., Willert K., Molenaar M., Roose J., Wagenaar G., Markman M., Lamers W., Destree O., Clevers H.
      Mol. Cell. Biol. 18:1248-1256(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CTNNB1.
    11. "Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors."
      Levanon D., Goldstein R.E., Bernstein Y., Tang H., Goldenberg D., Stifani S., Paroush Z., Groner Y.
      Proc. Natl. Acad. Sci. U.S.A. 95:11590-11595(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TLE1, INHIBITION OF TRANSCRIPTIONAL ACTIVATION BY TLE1.
    12. "Beta-catenin-sensitive isoforms of lymphoid enhancer factor-1 are selectively expressed in colon cancer."
      Hovanes K., Li T.W.H., Munguia J.E., Truong T., Milovanovic T., Lawrence Marsh J., Holcombe R.F., Waterman M.L.
      Nat. Genet. 28:53-57(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 3), EXPRESSION IN COLON CANCER.
    13. "All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
      Brantjes H., Roose J., van De Wetering M., Clevers H.
      Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTIONAL INTERACTION WITH TLE1; TLE2; TLE3 AND TLE4.
    14. "I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways."
      Kusano S., Raab-Traub N.
      Mol. Cell. Biol. 22:6393-6405(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MDFI AND MDFIC.
    15. "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling."
      Ishitani T., Ninomiya-Tsuji J., Matsumoto K.
      Mol. Cell. Biol. 23:1379-1389(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NLK, PHOSPHORYLATION AT THR-155 AND/OR SER-166 BY NLK, MUTAGENESIS OF THR-155 AND SER-166.
    16. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    18. Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-113.

    Entry informationi

    Entry nameiLEF1_HUMAN
    AccessioniPrimary (citable) accession number: Q9UJU2
    Secondary accession number(s): B4DG38
    , B7Z8E2, E9PDK3, Q3ZCU4, Q9HAZ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 140 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3