Q9UJU2 (LEF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lymphoid enhancer-binding factor 1 Short name=LEF-1 Alternative name(s): T cell-specific transcription factor 1-alpha Short name=TCF1-alpha | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 399 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the Wnt signaling pathway. Activates transcription of target genes in the presence of CTNNB1 and EP300. May play a role in hair cell differentiation and follicle morphogenesis. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Regulates T-cell receptor alpha enhancer function. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 By similarity. Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells. Ref.1 Ref.3 Ref.13 |
| Subunit structure | Binds the armadillo repeat of CTNNB1 and forms a stable complex. Interacts with EP300, TLE1 and PIASG By similarity. Binds ALYREF/THOC4, MDFI and MDFIC. Interacts with NLK. Ref.9 Ref.10 Ref.11 Ref.13 Ref.14 Ref.15 |
| Subcellular location | Nucleus By similarity. Note: Found in nuclear bodies upon PIASG binding By similarity. |
| Tissue specificity | Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are detected in several pancreatic cell lines. Ref.3 |
| Domain | Proline-rich and acidic regions are implicated in the activation functions of RNA polymerase II transcription factors. |
| Post-translational modification | Phosphorylated at Thr-155 and/or Ser-166 by NLK. Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway. Ref.15 |
| Sequence similarities | Belongs to the TCF/LEF family. Contains 1 HMG box DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CTNNB1 | P35222 | 4 | EBI-926131,EBI-491549 |
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9UJU2-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 2 (identifier: Q9UJU2-2) Also known as: B; 8A; The sequence of this isoform differs from the canonical sequence as follows: 283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL | ||||||
| Note: Produced by alternative splicing of isoform 1. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q9UJU2-3) Also known as: LEF-1-DN; The sequence of this isoform differs from the canonical sequence as follows: 1-115: Missing. | ||||||
| Note: Produced by alternative promoter usage. Acts as dominant negative mutant. | ||||||
| Isoform 4 (identifier: Q9UJU2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-115: Missing. 283-399: KPQHEQRKEQ...TGPRMTAAYI → CSAFLLPHPF...SQKDLTLRSL | ||||||
| Note: Produced by alternative splicing of isoform 3. | ||||||
| Isoform 5 (identifier: Q9UJU2-5) The sequence of this isoform differs from the canonical sequence as follows: 214-241: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 1. | ||||||
| Isoform 6 (identifier: Q9UJU2-6) The sequence of this isoform differs from the canonical sequence as follows: 214-241: Missing. 390-399: TGPRMTAAYI → GKRSSFPTCKAKAATPGPLLEMEAC | ||||||
| Note: Produced by alternative splicing of isoform 1. No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q9UJU2-7) The sequence of this isoform differs from the canonical sequence as follows: 1-70: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH → MA 214-241: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 399 | 399 | Lymphoid enhancer-binding factor 1 | PRO_0000048595 | |||||
Regions | |||||||||
| DNA binding | 299 – 367 | 69 | HMG box | ||||||
| Region | 1 – 62 | 62 | CTNNB1-binding By similarity | ||||||
| Compositional bias | 6 – 13 | 8 | Poly-Gly | ||||||
| Compositional bias | 14 – 52 | 39 | Asp/Glu-rich (acidic) | ||||||
| Compositional bias | 77 – 273 | 197 | Pro-rich | ||||||
| Compositional bias | 374 – 379 | 6 | Poly-Lys | ||||||
Amino acid modifications | |||||||||
| Modified residue | 132 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 155 | 1 | Phosphothreonine; by NLK Probable | ||||||
| Modified residue | 166 | 1 | Phosphoserine; by NLK Probable | ||||||
| Cross-link | 27 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
| Cross-link | 269 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 115 | 115 | Missing in isoform 3 and isoform 4. | VSP_007022 | |||||
| Alternative sequence | 1 – 70 | 70 | MPQLS…ASNGH → MA in isoform 7. | VSP_044877 | |||||
| Alternative sequence | 214 – 241 | 28 | Missing in isoform 5, isoform 6 and isoform 7. | VSP_040068 | |||||
| Alternative sequence | 283 – 399 | 117 | KPQHE…TAAYI → CSAFLLPHPFLIPSTPSPNH HHHHLLGSLSMNRERSRSQK DLTLRSL in isoform 2 and isoform 4. | VSP_002188 | |||||
| Alternative sequence | 390 – 399 | 10 | TGPRMTAAYI → GKRSSFPTCKAKAATPGPLL EMEAC in isoform 6. | VSP_040069 | |||||
| Natural variant | 113 | 1 | G → R in a colorectal cancer sample; somatic mutation. Ref.18 | VAR_035935 | |||||
Experimental info | |||||||||
| Mutagenesis | 155 | 1 | T → A: Reduced phosphorylation by NLK; when associated with A-166. Ref.15 | ||||||
| Mutagenesis | 166 | 1 | S → A: Reduced phosphorylation by NLK; when associated with A-155. Ref.15 | ||||||
| Sequence conflict | 146 | 1 | Q → R in BAH13928. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A thymus-specific member of the HMG protein family regulates the human T cell receptor C alpha enhancer." Waterman M.L., Fischer W.H., Jones K.A. Genes Dev. 5:656-669(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, FUNCTION. |
| [2] | "The human LEF-1 gene contains a promoter preferentially active in lymphocytes and encodes multiple isoforms derived from alternative splicing." Hovanes K., Li T.W., Waterman M.L. Nucleic Acids Res. 28:1994-2003(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [3] | "Lef-1 isoforms regulate different target genes and reduce cellular adhesion." Jesse S., Koenig A., Ellenrieder V., Menke A. Int. J. Cancer 126:1109-1120(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY. |
| [4] | "New transcript isoform of the human LEF-1 devoid of HMG domain, derived from alternative splicing of exon 8." Kobielak A., Kobielak K., Trzeciak W.H. Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 7). Tissue: Amygdala and Thymus. |
| [6] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6). Tissue: Skin and Testis. |
| [9] | "ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function." Bruhn L., Munnerlyn A., Grosschedl R. Genes Dev. 11:640-653(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ALYREF/THOC4. |
| [10] | "Two members of the Tcf family implicated in Wnt/b-catenin signaling during embryogenesis in the mouse." Korinek V., Barker N., Willert K., Molenaar M., Roose J., Wagenaar G., Markman M., Lamers W., Destree O., Clevers H. Mol. Cell. Biol. 18:1248-1256(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1. |
| [11] | "Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors." Levanon D., Goldstein R.E., Bernstein Y., Tang H., Goldenberg D., Stifani S., Paroush Z., Groner Y. Proc. Natl. Acad. Sci. U.S.A. 95:11590-11595(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TLE1, INHIBITION OF TRANSCRIPTIONAL ACTIVATION BY TLE1. |
| [12] | "Beta-catenin-sensitive isoforms of lymphoid enhancer factor-1 are selectively expressed in colon cancer." Hovanes K., Li T.W.H., Munguia J.E., Truong T., Milovanovic T., Lawrence Marsh J., Holcombe R.F., Waterman M.L. Nat. Genet. 28:53-57(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 3), EXPRESSION IN COLON CANCER. |
| [13] | "All Tcf HMG box transcription factors interact with Groucho-related co-repressors." Brantjes H., Roose J., van De Wetering M., Clevers H. Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTIONAL INTERACTION WITH TLE1; TLE2; TLE3 AND TLE4. |
| [14] | "I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways." Kusano S., Raab-Traub N. Mol. Cell. Biol. 22:6393-6405(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MDFI AND MDFIC. |
| [15] | "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling." Ishitani T., Ninomiya-Tsuji J., Matsumoto K. Mol. Cell. Biol. 23:1379-1389(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLK, PHOSPHORYLATION AT THR-155 AND/OR SER-166 BY NLK, MUTAGENESIS OF THR-155 AND SER-166. |
| [16] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [17] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [18] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-113. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF288571 mRNA. Translation: AAG01022.1. AF198532 mRNA. Translation: AAF13268.1. AF294627 mRNA. Translation: AAG26886.1. AK294395 mRNA. Translation: BAG57649.1. AK303272 mRNA. Translation: BAH13928.1. AC092539 Genomic DNA. No translation available. AC097067 Genomic DNA. No translation available. AC118062 Genomic DNA. No translation available. AC123576 Genomic DNA. No translation available. CH471057 Genomic DNA. Translation: EAX06223.1. CH471057 Genomic DNA. Translation: EAX06225.1. BC040559 mRNA. Translation: AAH40559.1. BC050632 mRNA. Translation: AAH50632.1. |
| IPI | IPI00007156. IPI00220455. IPI00220456. IPI00220457. IPI00651680. IPI00909155. IPI00946679. |
| PIR | A39625. |
| RefSeq | NP_001124185.1. NM_001130713.2. NP_001124186.1. NM_001130714.2. NP_001159591.1. NM_001166119.1. NP_057353.1. NM_016269.4. |
| UniGene | Hs.555947. |
3D structure databases | |
| ProteinModelPortal | Q9UJU2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29946N. |
| IntAct | Q9UJU2. 5 interactions. |
| STRING | 9606.ENSP00000265165. |
PTM databases | |
| PhosphoSite | Q9UJU2. |
Polymorphism databases | |
| DMDM | 8928194. |
Proteomic databases | |
| PaxDb | Q9UJU2. |
| PRIDE | Q9UJU2. |
Protocols and materials databases | |
| DNASU | 51176. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265165; ENSP00000265165; ENSG00000138795. ENST00000379951; ENSP00000369284; ENSG00000138795. ENST00000438313; ENSP00000406176; ENSG00000138795. ENST00000506680; ENSP00000422334; ENSG00000138795. ENST00000510624; ENSP00000422840; ENSG00000138795. |
| GeneID | 51176. |
| KEGG | hsa:51176. |
| UCSC | uc003hyt.2. human. uc003hyu.2. human. uc003hyv.2. human. |
Organism-specific databases | |
| CTD | 51176. |
| GeneCards | GC04M108968. |
| HGNC | HGNC:6551. LEF1. |
| HPA | CAB019405. HPA002087. |
| MIM | 153245. gene. |
| neXtProt | NX_Q9UJU2. |
| PharmGKB | PA30331. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG299161. |
| HOGENOM | HOG000116032. |
| HOVERGEN | HBG000419. |
| InParanoid | Q9UJU2. |
| KO | K04492. |
| OMA | GYSGYIM. |
| OrthoDB | EOG480HWS. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | wnt_canonical_pathway. Canonical Wnt signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q9UJU2. |
| Bgee | Q9UJU2. |
| CleanEx | HS_LEF1. |
| Genevestigator | Q9UJU2. |
| GermOnline | ENSG00000138795. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.30.10. 1 hit. |
| InterPro | IPR013558. CTNNB1-bd_N. IPR009071. HMG_box_dom. IPR024940. TCF/LEF. [Graphical view] |
| PANTHER | PTHR10373. PTHR10373. 1 hit. |
| Pfam | PF08347. CTNNB1_binding. 1 hit. PF00505. HMG_box. 1 hit. [Graphical view] |
| SMART | SM00398. HMG. 1 hit. [Graphical view] |
| SUPFAM | SSF47095. HMG-box. 1 hit. |
| PROSITE | PS50118. HMG_BOX_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LEF1. human. |
| GenomeRNAi | 51176. |
| NextBio | 54133. |
| SOURCE | Search... |
Entry information
| Entry name | LEF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UJU2 Secondary accession number(s): B4DG38 Q9HAZ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
