Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin delta chain

Gene

TUBD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi143 – 1497GTPSequence Analysis

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
Gene namesi
Name:TUBD1
Synonyms:TUBD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:16811. TUBD1.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: ProtInc
  • cytoplasm Source: HPA
  • microtubule Source: UniProtKB-KW
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134909953.

Chemistry

DrugBankiDB00570. Vinblastine.

Polymorphism and mutation databases

BioMutaiTUBD1.
DMDMi124056483.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 453453Tubulin delta chainPRO_0000048484Add
BLAST

Proteomic databases

MaxQBiQ9UJT1.
PaxDbiQ9UJT1.
PRIDEiQ9UJT1.

PTM databases

PhosphoSiteiQ9UJT1.

Expressioni

Gene expression databases

BgeeiQ9UJT1.
CleanExiHS_TUBD1.
ExpressionAtlasiQ9UJT1. baseline and differential.
GenevisibleiQ9UJT1. HS.

Organism-specific databases

HPAiCAB004609.
HPA023980.
HPA027090.

Interactioni

Protein-protein interaction databases

BioGridi119352. 5 interactions.
STRINGi9606.ENSP00000320797.

Structurei

3D structure databases

ProteinModelPortaliQ9UJT1.
SMRiQ9UJT1. Positions 3-450.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the tubulin family.Curated

Phylogenomic databases

eggNOGiCOG5023.
GeneTreeiENSGT00530000063251.
HOGENOMiHOG000006615.
HOVERGENiHBG000807.
InParanoidiQ9UJT1.
KOiK10390.
OMAiPEFKMLS.
OrthoDBiEOG7KH9JK.
PhylomeDBiQ9UJT1.
TreeFamiTF329833.

Family and domain databases

Gene3Di1.10.287.600. 1 hit.
3.40.50.1440. 1 hit.
InterProiIPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR023123. Tubulin_C.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
[Graphical view]
PANTHERiPTHR11588. PTHR11588. 1 hit.
PTHR11588:SF4. PTHR11588:SF4. 1 hit.
PfamiPF00091. Tubulin. 1 hit.
[Graphical view]
PRINTSiPR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTiSM00864. Tubulin. 1 hit.
[Graphical view]
SUPFAMiSSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEiPS00227. TUBULIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q9UJT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF
60 70 80 90 100
FSEEENGVPI ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS
110 120 130 140 150
GNNWAYGYSV HGPRHEESIM NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL
160 170 180 190 200
GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV IVQNYNSILT LSHLYRSSDA
210 220 230 240 250
LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ PTYSAESSFH
260 270 280 290 300
YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR
310 320 330 340 350
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG
360 370 380 390 400
KDVQSADVEG FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ
410 420 430 440 450
FLVKPLDMIV GKAWNMFASK AYIHQYTKFG IEEEDFLDSF TSLEQVVASY

CNL
Length:453
Mass (Da):51,034
Last modified:January 23, 2007 - v2
Checksum:i2D78AB3D9EEB9158
GO
Isoform 2 (identifier: Q9UJT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.

Show »
Length:398
Mass (Da):44,658
Checksum:iBEE6B7C9F36B5541
GO
Isoform 3 (identifier: Q9UJT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.

Show »
Length:199
Mass (Da):22,381
Checksum:iECCC2578542A1114
GO
Isoform 4 (identifier: Q9UJT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.

Note: No experimental confirmation available.
Show »
Length:237
Mass (Da):27,074
Checksum:iD16AE1CDD4E5E1C4
GO
Isoform 5 (identifier: Q9UJT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):44,555
Checksum:iE26BC25E242DC48D
GO
Isoform 6 (identifier: Q9UJT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):39,525
Checksum:i2F6715FAD6D6E9B2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti130 – 1301C → R in BAG60700 (PubMed:14702039).Curated
Sequence conflicti270 – 2701K → R in BAG60700 (PubMed:14702039).Curated
Sequence conflicti398 – 3981N → D in BAB14825 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti76 – 761M → T.2 Publications
Corresponds to variant rs1292053 [ dbSNP | Ensembl ].
VAR_030000

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 216216Missing in isoform 4. 1 PublicationVSP_045196Add
BLAST
Alternative sequencei58 – 311254Missing in isoform 3. 1 PublicationVSP_006680Add
BLAST
Alternative sequencei257 – 358102Missing in isoform 6. 1 PublicationVSP_046949Add
BLAST
Alternative sequencei257 – 31155Missing in isoform 2. 1 PublicationVSP_006681Add
BLAST
Alternative sequencei358 – 42063VEGFK…MFASK → VGKKFR in isoform 5. 1 PublicationVSP_046950Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201333 mRNA. Translation: AAF09584.1.
AB030837 mRNA. Translation: BAD16590.1.
AB031045 mRNA. Translation: BAD83581.1.
AK024096 mRNA. Translation: BAB14825.1.
AK298492 mRNA. Translation: BAG60700.1.
AK301312 mRNA. Translation: BAG62863.1.
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1.
CH471109 Genomic DNA. Translation: EAW94387.1.
BC000258 mRNA. Translation: AAH00258.1.
CCDSiCCDS11620.1. [Q9UJT1-1]
CCDS54151.1. [Q9UJT1-4]
CCDS54152.1. [Q9UJT1-6]
CCDS54153.1. [Q9UJT1-2]
CCDS54154.1. [Q9UJT1-5]
RefSeqiNP_001180538.1. NM_001193609.1. [Q9UJT1-2]
NP_001180539.1. NM_001193610.1. [Q9UJT1-5]
NP_001180540.1. NM_001193611.1. [Q9UJT1-6]
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1. [Q9UJT1-4]
NP_057345.2. NM_016261.3. [Q9UJT1-1]
UniGeneiHs.463638.

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423. [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423. [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423. [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423. [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423. [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423. [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423. [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423. [Q9UJT1-6]
GeneIDi51174.
KEGGihsa:51174.
UCSCiuc002ixw.2. human. [Q9UJT1-1]
uc002ixx.2. human. [Q9UJT1-2]
uc010ddi.2. human. [Q9UJT1-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201333 mRNA. Translation: AAF09584.1.
AB030837 mRNA. Translation: BAD16590.1.
AB031045 mRNA. Translation: BAD83581.1.
AK024096 mRNA. Translation: BAB14825.1.
AK298492 mRNA. Translation: BAG60700.1.
AK301312 mRNA. Translation: BAG62863.1.
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1.
CH471109 Genomic DNA. Translation: EAW94387.1.
BC000258 mRNA. Translation: AAH00258.1.
CCDSiCCDS11620.1. [Q9UJT1-1]
CCDS54151.1. [Q9UJT1-4]
CCDS54152.1. [Q9UJT1-6]
CCDS54153.1. [Q9UJT1-2]
CCDS54154.1. [Q9UJT1-5]
RefSeqiNP_001180538.1. NM_001193609.1. [Q9UJT1-2]
NP_001180539.1. NM_001193610.1. [Q9UJT1-5]
NP_001180540.1. NM_001193611.1. [Q9UJT1-6]
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1. [Q9UJT1-4]
NP_057345.2. NM_016261.3. [Q9UJT1-1]
UniGeneiHs.463638.

3D structure databases

ProteinModelPortaliQ9UJT1.
SMRiQ9UJT1. Positions 3-450.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119352. 5 interactions.
STRINGi9606.ENSP00000320797.

Chemistry

DrugBankiDB00570. Vinblastine.

PTM databases

PhosphoSiteiQ9UJT1.

Polymorphism and mutation databases

BioMutaiTUBD1.
DMDMi124056483.

Proteomic databases

MaxQBiQ9UJT1.
PaxDbiQ9UJT1.
PRIDEiQ9UJT1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423. [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423. [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423. [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423. [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423. [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423. [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423. [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423. [Q9UJT1-6]
GeneIDi51174.
KEGGihsa:51174.
UCSCiuc002ixw.2. human. [Q9UJT1-1]
uc002ixx.2. human. [Q9UJT1-2]
uc010ddi.2. human. [Q9UJT1-3]

Organism-specific databases

CTDi51174.
GeneCardsiGC17M057936.
HGNCiHGNC:16811. TUBD1.
HPAiCAB004609.
HPA023980.
HPA027090.
MIMi607344. gene.
neXtProtiNX_Q9UJT1.
PharmGKBiPA134909953.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5023.
GeneTreeiENSGT00530000063251.
HOGENOMiHOG000006615.
HOVERGENiHBG000807.
InParanoidiQ9UJT1.
KOiK10390.
OMAiPEFKMLS.
OrthoDBiEOG7KH9JK.
PhylomeDBiQ9UJT1.
TreeFamiTF329833.

Miscellaneous databases

ChiTaRSiTUBD1. human.
GeneWikiiTUBD1.
GenomeRNAii51174.
NextBioi54125.
PROiQ9UJT1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UJT1.
CleanExiHS_TUBD1.
ExpressionAtlasiQ9UJT1. baseline and differential.
GenevisibleiQ9UJT1. HS.

Family and domain databases

Gene3Di1.10.287.600. 1 hit.
3.40.50.1440. 1 hit.
InterProiIPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR023123. Tubulin_C.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
[Graphical view]
PANTHERiPTHR11588. PTHR11588. 1 hit.
PTHR11588:SF4. PTHR11588:SF4. 1 hit.
PfamiPF00091. Tubulin. 1 hit.
[Graphical view]
PRINTSiPR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTiSM00864. Tubulin. 1 hit.
[Graphical view]
SUPFAMiSSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEiPS00227. TUBULIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function."
    Chang P., Stearns T.
    Nat. Cell Biol. 2:30-35(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-76.
  2. "Delta-tubulin is a component of intercellular bridges and both the early and mature perinuclear rings during spermatogenesis."
    Kato A., Nagata Y., Todokoro K.
    Dev. Biol. 269:196-205(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), VARIANT THR-76.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
    Tissue: Embryo, Mammary gland and Stomach.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye.

Entry informationi

Entry nameiTBD_HUMAN
AccessioniPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8
, B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: June 24, 2015
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.