Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UJT1 (TBD_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 127. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
Gene names
Name:TUBD1
Synonyms:TUBD
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length453 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head By similarity.

Subcellular location

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasm. Nucleus. Note: Associated with centrioles. Both cytoplasmic and nuclear.

Sequence similarities

Belongs to the tubulin family.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9UJT1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UJT1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.
Isoform 3 (identifier: Q9UJT1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.
Isoform 4 (identifier: Q9UJT1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9UJT1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9UJT1-6)

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 453453Tubulin delta chain
PRO_0000048484

Regions

Nucleotide binding143 – 1497GTP Potential

Natural variations

Alternative sequence1 – 216216Missing in isoform 4.
VSP_045196
Alternative sequence58 – 311254Missing in isoform 3.
VSP_006680
Alternative sequence257 – 358102Missing in isoform 6.
VSP_046949
Alternative sequence257 – 31155Missing in isoform 2.
VSP_006681
Alternative sequence358 – 42063VEGFK…MFASK → VGKKFR in isoform 5.
VSP_046950
Natural variant761M → T. Ref.1 Ref.2
Corresponds to variant rs1292053 [ dbSNP | Ensembl ].
VAR_030000

Experimental info

Sequence conflict1301C → R in BAG60700. Ref.3
Sequence conflict2701K → R in BAG60700. Ref.3
Sequence conflict3981N → D in BAB14825. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2007. Version 2.
Checksum: 2D78AB3D9EEB9158

FASTA45351,034
        10         20         30         40         50         60 
MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF FSEEENGVPI 

        70         80         90        100        110        120 
ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS GNNWAYGYSV HGPRHEESIM 

       130        140        150        160        170        180 
NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV 

       190        200        210        220        230        240 
IVQNYNSILT LSHLYRSSDA LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ 

       250        260        270        280        290        300 
PTYSAESSFH YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR 

       310        320        330        340        350        360 
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG KDVQSADVEG 

       370        380        390        400        410        420 
FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ FLVKPLDMIV GKAWNMFASK 

       430        440        450 
AYIHQYTKFG IEEEDFLDSF TSLEQVVASY CNL 

« Hide

Isoform 2 [UniParc].

Checksum: BEE6B7C9F36B5541
Show »

FASTA39844,658
Isoform 3 [UniParc].

Checksum: ECCC2578542A1114
Show »

FASTA19922,381
Isoform 4 [UniParc].

Checksum: D16AE1CDD4E5E1C4
Show »

FASTA23727,074
Isoform 5 [UniParc].

Checksum: E26BC25E242DC48D
Show »

FASTA39644,555
Isoform 6 [UniParc].

Checksum: 2F6715FAD6D6E9B2
Show »

FASTA35139,525

References

« Hide 'large scale' references
[1]"Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function."
Chang P., Stearns T.
Nat. Cell Biol. 2:30-35(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-76.
[2]"Delta-tubulin is a component of intercellular bridges and both the early and mature perinuclear rings during spermatogenesis."
Kato A., Nagata Y., Todokoro K.
Dev. Biol. 269:196-205(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), VARIANT THR-76.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
Tissue: Embryo, Mammary gland and Stomach.
[4]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Eye.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF201333 mRNA. Translation: AAF09584.1.
AB030837 mRNA. Translation: BAD16590.1.
AB031045 mRNA. Translation: BAD83581.1.
AK024096 mRNA. Translation: BAB14825.1.
AK298492 mRNA. Translation: BAG60700.1.
AK301312 mRNA. Translation: BAG62863.1.
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1.
CH471109 Genomic DNA. Translation: EAW94387.1.
BC000258 mRNA. Translation: AAH00258.1.
RefSeqNP_001180538.1. NM_001193609.1.
NP_001180539.1. NM_001193610.1.
NP_001180540.1. NM_001193611.1.
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1.
NP_057345.2. NM_016261.3.
UniGeneHs.463638.

3D structure databases

ProteinModelPortalQ9UJT1.
SMRQ9UJT1. Positions 3-450.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119352. 4 interactions.
STRING9606.ENSP00000320797.

PTM databases

PhosphoSiteQ9UJT1.

Polymorphism databases

DMDM124056483.

Proteomic databases

PaxDbQ9UJT1.
PRIDEQ9UJT1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000325752; ENSP00000320797; ENSG00000108423. [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423. [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423. [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423. [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423. [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423. [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423. [Q9UJT1-1]
GeneID51174.
KEGGhsa:51174.
UCSCuc002ixw.2. human. [Q9UJT1-1]
uc002ixx.2. human. [Q9UJT1-2]
uc010ddi.2. human. [Q9UJT1-3]

Organism-specific databases

CTD51174.
GeneCardsGC17M057936.
HGNCHGNC:16811. TUBD1.
HPACAB004609.
HPA023980.
HPA027090.
MIM607344. gene.
neXtProtNX_Q9UJT1.
PharmGKBPA134909953.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5023.
HOGENOMHOG000006615.
HOVERGENHBG000807.
InParanoidQ9UJT1.
KOK10390.
OMACSKRENE.
OrthoDBEOG7KH9JK.
PhylomeDBQ9UJT1.
TreeFamTF329833.

Gene expression databases

ArrayExpressQ9UJT1.
BgeeQ9UJT1.
CleanExHS_TUBD1.
GenevestigatorQ9UJT1.

Family and domain databases

Gene3D1.10.287.600. 1 hit.
3.40.50.1440. 1 hit.
InterProIPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR023123. Tubulin_C.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
[Graphical view]
PANTHERPTHR11588. PTHR11588. 1 hit.
PTHR11588:SF4. PTHR11588:SF4. 1 hit.
PfamPF00091. Tubulin. 1 hit.
[Graphical view]
PRINTSPR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTSM00864. Tubulin. 1 hit.
[Graphical view]
SUPFAMSSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEPS00227. TUBULIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTUBD1. human.
GeneWikiTUBD1.
GenomeRNAi51174.
NextBio54125.
PROQ9UJT1.
SOURCESearch...

Entry information

Entry nameTBD_HUMAN
AccessionPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8 expand/collapse secondary AC list , B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM