Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin delta chain

Gene

TUBD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi143 – 149GTPSequence analysis7

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

SIGNORiQ9UJT1.

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
Gene namesi
Name:TUBD1
Synonyms:TUBD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000108423.14.
HGNCiHGNC:16811. TUBD1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51174.
OpenTargetsiENSG00000108423.
PharmGKBiPA134909953.

Chemistry databases

DrugBankiDB00570. Vinblastine.

Polymorphism and mutation databases

BioMutaiTUBD1.
DMDMi124056483.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000484841 – 453Tubulin delta chainAdd BLAST453

Proteomic databases

EPDiQ9UJT1.
PaxDbiQ9UJT1.
PeptideAtlasiQ9UJT1.
PRIDEiQ9UJT1.

PTM databases

iPTMnetiQ9UJT1.
PhosphoSitePlusiQ9UJT1.

Expressioni

Gene expression databases

BgeeiENSG00000108423.
CleanExiHS_TUBD1.
ExpressionAtlasiQ9UJT1. baseline and differential.
GenevisibleiQ9UJT1. HS.

Organism-specific databases

HPAiCAB004609.
HPA023980.
HPA027090.

Interactioni

Protein-protein interaction databases

BioGridi119352. 9 interactors.
IntActiQ9UJT1. 1 interactor.
STRINGi9606.ENSP00000320797.

Structurei

3D structure databases

ProteinModelPortaliQ9UJT1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the tubulin family.Curated

Phylogenomic databases

eggNOGiKOG1374. Eukaryota.
COG5023. LUCA.
GeneTreeiENSGT00530000063251.
HOGENOMiHOG000006615.
HOVERGENiHBG000807.
InParanoidiQ9UJT1.
KOiK10390.
OMAiKMEEGID.
OrthoDBiEOG091G07VL.
PhylomeDBiQ9UJT1.
TreeFamiTF329833.

Family and domain databases

Gene3Di3.40.50.1440. 1 hit.
InterProiView protein in InterPro
IPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
PANTHERiPTHR11588. PTHR11588. 1 hit.
PTHR11588:SF234. PTHR11588:SF234. 1 hit.
PfamiView protein in Pfam
PF00091. Tubulin. 1 hit.
PRINTSiPR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTiView protein in SMART
SM00864. Tubulin. 1 hit.
SUPFAMiSSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEiView protein in PROSITE
PS00227. TUBULIN. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9UJT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF
60 70 80 90 100
FSEEENGVPI ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS
110 120 130 140 150
GNNWAYGYSV HGPRHEESIM NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL
160 170 180 190 200
GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV IVQNYNSILT LSHLYRSSDA
210 220 230 240 250
LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ PTYSAESSFH
260 270 280 290 300
YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR
310 320 330 340 350
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG
360 370 380 390 400
KDVQSADVEG FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ
410 420 430 440 450
FLVKPLDMIV GKAWNMFASK AYIHQYTKFG IEEEDFLDSF TSLEQVVASY

CNL
Length:453
Mass (Da):51,034
Last modified:January 23, 2007 - v2
Checksum:i2D78AB3D9EEB9158
GO
Isoform 2 (identifier: Q9UJT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.

Show »
Length:398
Mass (Da):44,658
Checksum:iBEE6B7C9F36B5541
GO
Isoform 3 (identifier: Q9UJT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.

Show »
Length:199
Mass (Da):22,381
Checksum:iECCC2578542A1114
GO
Isoform 4 (identifier: Q9UJT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.

Note: No experimental confirmation available.
Show »
Length:237
Mass (Da):27,074
Checksum:iD16AE1CDD4E5E1C4
GO
Isoform 5 (identifier: Q9UJT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):44,555
Checksum:iE26BC25E242DC48D
GO
Isoform 6 (identifier: Q9UJT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):39,525
Checksum:i2F6715FAD6D6E9B2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130C → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti270K → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti398N → D in BAB14825 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03000076M → T2 PublicationsCorresponds to variant dbSNP:rs1292053Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451961 – 216Missing in isoform 4. 1 PublicationAdd BLAST216
Alternative sequenceiVSP_00668058 – 311Missing in isoform 3. 1 PublicationAdd BLAST254
Alternative sequenceiVSP_046949257 – 358Missing in isoform 6. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_006681257 – 311Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_046950358 – 420VEGFK…MFASK → VGKKFR in isoform 5. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201333 mRNA. Translation: AAF09584.1.
AB030837 mRNA. Translation: BAD16590.1.
AB031045 mRNA. Translation: BAD83581.1.
AK024096 mRNA. Translation: BAB14825.1.
AK298492 mRNA. Translation: BAG60700.1.
AK301312 mRNA. Translation: BAG62863.1.
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1.
CH471109 Genomic DNA. Translation: EAW94387.1.
BC000258 mRNA. Translation: AAH00258.1.
CCDSiCCDS11620.1. [Q9UJT1-1]
CCDS54151.1. [Q9UJT1-4]
CCDS54152.1. [Q9UJT1-6]
CCDS54153.1. [Q9UJT1-2]
CCDS54154.1. [Q9UJT1-5]
RefSeqiNP_001180538.1. NM_001193609.1. [Q9UJT1-2]
NP_001180539.1. NM_001193610.1. [Q9UJT1-5]
NP_001180540.1. NM_001193611.1. [Q9UJT1-6]
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1. [Q9UJT1-4]
NP_057345.2. NM_016261.3. [Q9UJT1-1]
UniGeneiHs.463638.

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423. [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423. [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423. [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423. [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423. [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423. [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423. [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423. [Q9UJT1-6]
GeneIDi51174.
KEGGihsa:51174.
UCSCiuc002ixw.3. human. [Q9UJT1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTBD_HUMAN
AccessioniPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8
, B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: September 27, 2017
This is version 158 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families