SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UJT1

- TBD_HUMAN

UniProt

Q9UJT1 - TBD_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Tubulin delta chain
Gene
TUBD1, TUBD
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi143 – 1497GTP Reviewed prediction

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW
  2. GTPase activity Source: InterPro
  3. structural constituent of cytoskeleton Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. microtubule-based process Source: InterPro
  3. multicellular organismal development Source: UniProtKB-KW
  4. protein polymerization Source: InterPro
  5. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
Gene namesi
Name:TUBD1
Synonyms:TUBD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:16811. TUBD1.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasm. Nucleus
Note: Associated with centrioles. Both cytoplasmic and nuclear.

GO - Cellular componenti

  1. centriole Source: ProtInc
  2. cytoplasm Source: HPA
  3. microtubule Source: UniProtKB-KW
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134909953.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 453453Tubulin delta chain
PRO_0000048484Add
BLAST

Proteomic databases

MaxQBiQ9UJT1.
PaxDbiQ9UJT1.
PRIDEiQ9UJT1.

PTM databases

PhosphoSiteiQ9UJT1.

Expressioni

Gene expression databases

ArrayExpressiQ9UJT1.
BgeeiQ9UJT1.
CleanExiHS_TUBD1.
GenevestigatoriQ9UJT1.

Organism-specific databases

HPAiCAB004609.
HPA023980.
HPA027090.

Interactioni

Protein-protein interaction databases

BioGridi119352. 4 interactions.
STRINGi9606.ENSP00000320797.

Structurei

3D structure databases

ProteinModelPortaliQ9UJT1.
SMRiQ9UJT1. Positions 3-450.

Family & Domainsi

Sequence similaritiesi

Belongs to the tubulin family.

Phylogenomic databases

eggNOGiCOG5023.
HOGENOMiHOG000006615.
HOVERGENiHBG000807.
InParanoidiQ9UJT1.
KOiK10390.
OMAiCSKRENE.
OrthoDBiEOG7KH9JK.
PhylomeDBiQ9UJT1.
TreeFamiTF329833.

Family and domain databases

Gene3Di1.10.287.600. 1 hit.
3.40.50.1440. 1 hit.
InterProiIPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR023123. Tubulin_C.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
[Graphical view]
PANTHERiPTHR11588. PTHR11588. 1 hit.
PTHR11588:SF4. PTHR11588:SF4. 1 hit.
PfamiPF00091. Tubulin. 1 hit.
[Graphical view]
PRINTSiPR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTiSM00864. Tubulin. 1 hit.
[Graphical view]
SUPFAMiSSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEiPS00227. TUBULIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q9UJT1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF    50
FSEEENGVPI ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS 100
GNNWAYGYSV HGPRHEESIM NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL 150
GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV IVQNYNSILT LSHLYRSSDA 200
LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ PTYSAESSFH 250
YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR 300
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG 350
KDVQSADVEG FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ 400
FLVKPLDMIV GKAWNMFASK AYIHQYTKFG IEEEDFLDSF TSLEQVVASY 450
CNL 453
Length:453
Mass (Da):51,034
Last modified:January 23, 2007 - v2
Checksum:i2D78AB3D9EEB9158
GO
Isoform 2 (identifier: Q9UJT1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.

Show »
Length:398
Mass (Da):44,658
Checksum:iBEE6B7C9F36B5541
GO
Isoform 3 (identifier: Q9UJT1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.

Show »
Length:199
Mass (Da):22,381
Checksum:iECCC2578542A1114
GO
Isoform 4 (identifier: Q9UJT1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.

Note: No experimental confirmation available.

Show »
Length:237
Mass (Da):27,074
Checksum:iD16AE1CDD4E5E1C4
GO
Isoform 5 (identifier: Q9UJT1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR

Note: No experimental confirmation available.

Show »
Length:396
Mass (Da):44,555
Checksum:iE26BC25E242DC48D
GO
Isoform 6 (identifier: Q9UJT1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.

Note: No experimental confirmation available.

Show »
Length:351
Mass (Da):39,525
Checksum:i2F6715FAD6D6E9B2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti76 – 761M → T.2 Publications
Corresponds to variant rs1292053 [ dbSNP | Ensembl ].
VAR_030000

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 216216Missing in isoform 4.
VSP_045196Add
BLAST
Alternative sequencei58 – 311254Missing in isoform 3.
VSP_006680Add
BLAST
Alternative sequencei257 – 358102Missing in isoform 6.
VSP_046949Add
BLAST
Alternative sequencei257 – 31155Missing in isoform 2.
VSP_006681Add
BLAST
Alternative sequencei358 – 42063VEGFK…MFASK → VGKKFR in isoform 5.
VSP_046950Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti130 – 1301C → R in BAG60700. 1 Publication
Sequence conflicti270 – 2701K → R in BAG60700. 1 Publication
Sequence conflicti398 – 3981N → D in BAB14825. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF201333 mRNA. Translation: AAF09584.1.
AB030837 mRNA. Translation: BAD16590.1.
AB031045 mRNA. Translation: BAD83581.1.
AK024096 mRNA. Translation: BAB14825.1.
AK298492 mRNA. Translation: BAG60700.1.
AK301312 mRNA. Translation: BAG62863.1.
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1.
CH471109 Genomic DNA. Translation: EAW94387.1.
BC000258 mRNA. Translation: AAH00258.1.
CCDSiCCDS11620.1. [Q9UJT1-1]
CCDS54151.1. [Q9UJT1-4]
CCDS54152.1. [Q9UJT1-6]
CCDS54153.1. [Q9UJT1-2]
CCDS54154.1. [Q9UJT1-5]
RefSeqiNP_001180538.1. NM_001193609.1. [Q9UJT1-2]
NP_001180539.1. NM_001193610.1. [Q9UJT1-5]
NP_001180540.1. NM_001193611.1. [Q9UJT1-6]
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1. [Q9UJT1-4]
NP_057345.2. NM_016261.3. [Q9UJT1-1]
UniGeneiHs.463638.

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423. [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423. [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423. [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423. [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423. [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423. [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423. [Q9UJT1-1]
GeneIDi51174.
KEGGihsa:51174.
UCSCiuc002ixw.2. human. [Q9UJT1-1]
uc002ixx.2. human. [Q9UJT1-2]
uc010ddi.2. human. [Q9UJT1-3]

Polymorphism databases

DMDMi124056483.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF201333 mRNA. Translation: AAF09584.1 .
AB030837 mRNA. Translation: BAD16590.1 .
AB031045 mRNA. Translation: BAD83581.1 .
AK024096 mRNA. Translation: BAB14825.1 .
AK298492 mRNA. Translation: BAG60700.1 .
AK301312 mRNA. Translation: BAG62863.1 .
AC004686 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94385.1 .
CH471109 Genomic DNA. Translation: EAW94387.1 .
BC000258 mRNA. Translation: AAH00258.1 .
CCDSi CCDS11620.1. [Q9UJT1-1 ]
CCDS54151.1. [Q9UJT1-4 ]
CCDS54152.1. [Q9UJT1-6 ]
CCDS54153.1. [Q9UJT1-2 ]
CCDS54154.1. [Q9UJT1-5 ]
RefSeqi NP_001180538.1. NM_001193609.1. [Q9UJT1-2 ]
NP_001180539.1. NM_001193610.1. [Q9UJT1-5 ]
NP_001180540.1. NM_001193611.1. [Q9UJT1-6 ]
NP_001180541.1. NM_001193612.1.
NP_001180542.1. NM_001193613.1. [Q9UJT1-4 ]
NP_057345.2. NM_016261.3. [Q9UJT1-1 ]
UniGenei Hs.463638.

3D structure databases

ProteinModelPortali Q9UJT1.
SMRi Q9UJT1. Positions 3-450.
ModBasei Search...

Protein-protein interaction databases

BioGridi 119352. 4 interactions.
STRINGi 9606.ENSP00000320797.

PTM databases

PhosphoSitei Q9UJT1.

Polymorphism databases

DMDMi 124056483.

Proteomic databases

MaxQBi Q9UJT1.
PaxDbi Q9UJT1.
PRIDEi Q9UJT1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000325752 ; ENSP00000320797 ; ENSG00000108423 . [Q9UJT1-1 ]
ENST00000340993 ; ENSP00000342399 ; ENSG00000108423 . [Q9UJT1-2 ]
ENST00000346141 ; ENSP00000342561 ; ENSG00000108423 . [Q9UJT1-3 ]
ENST00000376094 ; ENSP00000365262 ; ENSG00000108423 . [Q9UJT1-6 ]
ENST00000394239 ; ENSP00000377785 ; ENSG00000108423 . [Q9UJT1-5 ]
ENST00000539018 ; ENSP00000441757 ; ENSG00000108423 . [Q9UJT1-4 ]
ENST00000592426 ; ENSP00000468518 ; ENSG00000108423 . [Q9UJT1-1 ]
GeneIDi 51174.
KEGGi hsa:51174.
UCSCi uc002ixw.2. human. [Q9UJT1-1 ]
uc002ixx.2. human. [Q9UJT1-2 ]
uc010ddi.2. human. [Q9UJT1-3 ]

Organism-specific databases

CTDi 51174.
GeneCardsi GC17M057936.
HGNCi HGNC:16811. TUBD1.
HPAi CAB004609.
HPA023980.
HPA027090.
MIMi 607344. gene.
neXtProti NX_Q9UJT1.
PharmGKBi PA134909953.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5023.
HOGENOMi HOG000006615.
HOVERGENi HBG000807.
InParanoidi Q9UJT1.
KOi K10390.
OMAi CSKRENE.
OrthoDBi EOG7KH9JK.
PhylomeDBi Q9UJT1.
TreeFami TF329833.

Miscellaneous databases

ChiTaRSi TUBD1. human.
GeneWikii TUBD1.
GenomeRNAii 51174.
NextBioi 54125.
PROi Q9UJT1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UJT1.
Bgeei Q9UJT1.
CleanExi HS_TUBD1.
Genevestigatori Q9UJT1.

Family and domain databases

Gene3Di 1.10.287.600. 1 hit.
3.40.50.1440. 1 hit.
InterProi IPR002967. Delta_tubulin.
IPR008280. Tub_FtsZ_C.
IPR000217. Tubulin.
IPR023123. Tubulin_C.
IPR017975. Tubulin_CS.
IPR003008. Tubulin_FtsZ_GTPase.
[Graphical view ]
PANTHERi PTHR11588. PTHR11588. 1 hit.
PTHR11588:SF4. PTHR11588:SF4. 1 hit.
Pfami PF00091. Tubulin. 1 hit.
[Graphical view ]
PRINTSi PR01224. DELTATUBULIN.
PR01161. TUBULIN.
SMARTi SM00864. Tubulin. 1 hit.
[Graphical view ]
SUPFAMi SSF52490. SSF52490. 1 hit.
SSF55307. SSF55307. 1 hit.
PROSITEi PS00227. TUBULIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function."
    Chang P., Stearns T.
    Nat. Cell Biol. 2:30-35(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-76.
  2. "Delta-tubulin is a component of intercellular bridges and both the early and mature perinuclear rings during spermatogenesis."
    Kato A., Nagata Y., Todokoro K.
    Dev. Biol. 269:196-205(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), VARIANT THR-76.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
    Tissue: Embryo, Mammary gland and Stomach.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye.

Entry informationi

Entry nameiTBD_HUMAN
AccessioniPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8
, B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: July 9, 2014
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi