Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin delta chain

Gene

TUBD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acts as a positive regulator of hedgehog signaling and regulates ciliary function.By similarity

Caution

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi143 – 149GTPSequence analysis7

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

SIGNORiQ9UJT1

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin delta chain
Alternative name(s):
Delta-tubulin
Gene namesi
Name:TUBD1
Synonyms:TUBD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000108423.14
HGNCiHGNC:16811 TUBD1
MIMi607344 gene
neXtProtiNX_Q9UJT1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51174
OpenTargetsiENSG00000108423
PharmGKBiPA134909953

Chemistry databases

DrugBankiDB00570 Vinblastine

Polymorphism and mutation databases

BioMutaiTUBD1
DMDMi124056483

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000484841 – 453Tubulin delta chainAdd BLAST453

Proteomic databases

PaxDbiQ9UJT1
PeptideAtlasiQ9UJT1
PRIDEiQ9UJT1

PTM databases

iPTMnetiQ9UJT1
PhosphoSitePlusiQ9UJT1

Expressioni

Gene expression databases

BgeeiENSG00000108423
CleanExiHS_TUBD1
ExpressionAtlasiQ9UJT1 baseline and differential
GenevisibleiQ9UJT1 HS

Organism-specific databases

HPAiCAB004609
HPA023980
HPA027090

Interactioni

Protein-protein interaction databases

BioGridi1193529 interactors.
IntActiQ9UJT1 1 interactor.
STRINGi9606.ENSP00000320797

Structurei

3D structure databases

ProteinModelPortaliQ9UJT1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the tubulin family.Curated

Phylogenomic databases

eggNOGiKOG1374 Eukaryota
COG5023 LUCA
GeneTreeiENSGT00760000119061
HOGENOMiHOG000006615
HOVERGENiHBG000807
InParanoidiQ9UJT1
KOiK10390
OMAiKMEEGID
OrthoDBiEOG091G07VL
PhylomeDBiQ9UJT1
TreeFamiTF329833

Family and domain databases

Gene3Di1.10.287.6001 hit
3.40.50.14401 hit
InterProiView protein in InterPro
IPR002967 Delta_tubulin
IPR008280 Tub_FtsZ_C
IPR000217 Tubulin
IPR036525 Tubulin/FtsZ_GTPase_sf
IPR023123 Tubulin_C
IPR017975 Tubulin_CS
IPR003008 Tubulin_FtsZ_GTPase
PANTHERiPTHR11588 PTHR11588, 1 hit
PTHR11588:SF4 PTHR11588:SF4, 1 hit
PfamiView protein in Pfam
PF00091 Tubulin, 1 hit
PRINTSiPR01224 DELTATUBULIN
PR01161 TUBULIN
SMARTiView protein in SMART
SM00864 Tubulin, 1 hit
SUPFAMiSSF52490 SSF52490, 1 hit
SSF55307 SSF55307, 1 hit
PROSITEiView protein in PROSITE
PS00227 TUBULIN, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9UJT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSIVTVQLGQ CGNQIGFEVF DALLSDSHSS QGLCSMRENE AYQASCKERF
60 70 80 90 100
FSEEENGVPI ARAVLVDMEP KVINQMLSKA AQSGQWKYGQ HACFCQKQGS
110 120 130 140 150
GNNWAYGYSV HGPRHEESIM NIIRKEVEKC DSFSGFFIIM SMAGGTGSGL
160 170 180 190 200
GAFVTQNLED QYSNSLKMNQ IIWPYGTGEV IVQNYNSILT LSHLYRSSDA
210 220 230 240 250
LLLHENDAIH KICAKLMNIK QISFSDINQV LAHQLGSVFQ PTYSAESSFH
260 270 280 290 300
YRRNPLGDLM EHLVPHPEFK MLSVRNIPHM SENSLAYTTF TWAGLLKHLR
310 320 330 340 350
QMLISNAKME EGIDRHVWPP LSGLPPLSKM SLNKDLHFNT SIANLVILRG
360 370 380 390 400
KDVQSADVEG FKDPALYTSW LKPVNAFNVW KTQRAFSKYE KSAVLVSNSQ
410 420 430 440 450
FLVKPLDMIV GKAWNMFASK AYIHQYTKFG IEEEDFLDSF TSLEQVVASY

CNL
Length:453
Mass (Da):51,034
Last modified:January 23, 2007 - v2
Checksum:i2D78AB3D9EEB9158
GO
Isoform 2 (identifier: Q9UJT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-311: Missing.

Show »
Length:398
Mass (Da):44,658
Checksum:iBEE6B7C9F36B5541
GO
Isoform 3 (identifier: Q9UJT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-311: Missing.

Show »
Length:199
Mass (Da):22,381
Checksum:iECCC2578542A1114
GO
Isoform 4 (identifier: Q9UJT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-216: Missing.

Note: No experimental confirmation available.
Show »
Length:237
Mass (Da):27,074
Checksum:iD16AE1CDD4E5E1C4
GO
Isoform 5 (identifier: Q9UJT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-420: VEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK → VGKKFR

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):44,555
Checksum:iE26BC25E242DC48D
GO
Isoform 6 (identifier: Q9UJT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     257-358: Missing.

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):39,525
Checksum:i2F6715FAD6D6E9B2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130C → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti270K → R in BAG60700 (PubMed:14702039).Curated1
Sequence conflicti398N → D in BAB14825 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03000076M → T2 PublicationsCorresponds to variant dbSNP:rs1292053Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451961 – 216Missing in isoform 4. 1 PublicationAdd BLAST216
Alternative sequenceiVSP_00668058 – 311Missing in isoform 3. 1 PublicationAdd BLAST254
Alternative sequenceiVSP_046949257 – 358Missing in isoform 6. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_006681257 – 311Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_046950358 – 420VEGFK…MFASK → VGKKFR in isoform 5. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201333 mRNA Translation: AAF09584.1
AB030837 mRNA Translation: BAD16590.1
AB031045 mRNA Translation: BAD83581.1
AK024096 mRNA Translation: BAB14825.1
AK298492 mRNA Translation: BAG60700.1
AK301312 mRNA Translation: BAG62863.1
AC004686 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94385.1
CH471109 Genomic DNA Translation: EAW94387.1
BC000258 mRNA Translation: AAH00258.1
CCDSiCCDS11620.1 [Q9UJT1-1]
CCDS54151.1 [Q9UJT1-4]
CCDS54152.1 [Q9UJT1-6]
CCDS54153.1 [Q9UJT1-2]
CCDS54154.1 [Q9UJT1-5]
RefSeqiNP_001180538.1, NM_001193609.1 [Q9UJT1-2]
NP_001180539.1, NM_001193610.1 [Q9UJT1-5]
NP_001180540.1, NM_001193611.1 [Q9UJT1-6]
NP_001180541.1, NM_001193612.1
NP_001180542.1, NM_001193613.1 [Q9UJT1-4]
NP_057345.2, NM_016261.3 [Q9UJT1-1]
UniGeneiHs.463638

Genome annotation databases

EnsembliENST00000325752; ENSP00000320797; ENSG00000108423 [Q9UJT1-1]
ENST00000340993; ENSP00000342399; ENSG00000108423 [Q9UJT1-2]
ENST00000346141; ENSP00000342561; ENSG00000108423 [Q9UJT1-3]
ENST00000376094; ENSP00000365262; ENSG00000108423 [Q9UJT1-6]
ENST00000394239; ENSP00000377785; ENSG00000108423 [Q9UJT1-5]
ENST00000539018; ENSP00000441757; ENSG00000108423 [Q9UJT1-4]
ENST00000592426; ENSP00000468518; ENSG00000108423 [Q9UJT1-1]
ENST00000613721; ENSP00000480387; ENSG00000108423 [Q9UJT1-6]
GeneIDi51174
KEGGihsa:51174
UCSCiuc002ixw.3 human [Q9UJT1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTBD_HUMAN
AccessioniPrimary (citable) accession number: Q9UJT1
Secondary accession number(s): B4DPT8
, B4DW01, D3DU02, E9PCA7, E9PCQ8, Q5KU36, Q9BWG9, Q9H7Z8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: April 25, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome